F472196

General Info

Members Datasets Scaffolds Average Seq Length
646 257 637 316

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10008792|Ga0105249_100087922
Length 378
Sequence MATHQYRITNSAYYSIWCYLSADQKKKIFVIPDSDSRPLTSDFNFPVLIFASQFSRMTSDQISYLVFGVVLVLALIFDLGLLSKRGKKVTIKQALYQTFFWVGLALCFFIFLWIENGSTLALQYLSGYLMEWSLSIDNIFVFIIIFSAFSVKEKYYGRVLLAGILMAIVFRVIFITAGVALVHRFEWILYIFGAFLIYTGYKMFTSNDDEEFDPLNSKIFKLMKQFFPLVAHDGEGKYVVKENGKRMYTTLFVVIIMLAFIDLVFALDSIPAVMGISRDRIVIYTSNIFAVLGLRSLFFLLRGAVSRFDYLQQGIAIVLVFIGLKMLTEHWINQWIDKTVQVFLSLGIIILCITGSIFYSIFMKKKGVPPDTENLDVY

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
6 2914759650 Rhizosphaericola mali Isolate Rhizosphere
7 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
8 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
9 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
10 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
221 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
222 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
223 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
224 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
225 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
226 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
227 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
228 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
229 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
230 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
231 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
232 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
233 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
247 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
248 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
252 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
256 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
257 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 0
Rhizoplane 0
Rhizosphere 92.57
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001840 3300002459 Bacteria 4349
2 JGI25157J39369_1005145 3300002741 Bacteria 2184
3 JGI25406J46586_10007164 3300003203 Bacteria 5109
4 JGI25153J46596_10007702 3300003215 Bacteria 5248
5 rootH1_10020270 3300003316 Unclassified 1408
6 rootH1_10009137 3300003323 Bacteria 14213
7 rootH1_10010982 3300003316 Bacteria 3724
8 rootH1_10010982 3300003323 Bacteria 18286
9 rootH1_10164670 3300003323 Bacteria 2642
10 JGI25160J50197_1001338 3300003354 Bacteria 12423
11 JGI25160J50197_1002285 3300003354 Bacteria 8980
12 JGI25160J50197_1002656 3300003354 Bacteria 8238
13 Ga0065704_10077623 3300005289 Bacteria 4678
14 Ga0065712_10003121 3300005290 Bacteria 3931
15 Ga0065712_10003730 3300005290 Bacteria 4436
16 Ga0065712_10104546 3300005290 Bacteria 1958
17 Ga0065715_10009105 3300005293 Bacteria 2908
18 Ga0070658_10023254 3300005327 Bacteria 4976
19 Ga0070658_10135716 3300005327 Bacteria 2053
20 Ga0070676_10000522 3300005328 Bacteria 18465
21 Ga0070676_10067054 3300005328 Bacteria 2145
22 Ga0070676_10089796 3300005328 Bacteria 1880
23 Ga0070683_100002538 3300005329 Bacteria 14571
24 Ga0070683_100019545 3300005329 Bacteria 6018
25 Ga0070683_100149174 3300005329 Bacteria 2217
26 Ga0070683_100390700 3300005329 Bacteria 1326
27 Ga0070690_100063936 3300005330 Bacteria 2376
28 Ga0070670_100037082 3300005331 Bacteria 4195
29 Ga0070670_100050471 3300005331 Unclassified 3575
30 Ga0070670_100053760 3300005331 Bacteria 3458
31 Ga0070670_100086672 3300005331 Bacteria 2691
32 Ga0070670_100107920 3300005331 Unclassified 2399
33 Ga0070670_100126707 3300005331 Bacteria 2204
34 Ga0070670_100170607 3300005331 Bacteria 1887
35 Ga0070670_100267197 3300005331 Unclassified 1492
36 Ga0070670_100309883 3300005331 Bacteria 1382
37 Ga0070670_100499590 3300005331 Bacteria 1081
38 Ga0070677_10004564 3300005333 Unclassified 4526
39 Ga0068869_100048915 3300005334 Bacteria 3059
40 Ga0068869_100265593 3300005334 Unclassified 1375
41 Ga0068869_100319700 3300005334 Bacteria 1258
42 Ga0070666_10000086 3300005335 Bacteria 66096
43 Ga0070666_10000558 3300005335 Bacteria 22499
44 Ga0070666_10011413 3300005335 Bacteria 5573
45 Ga0070666_10035896 3300005335 Bacteria 3287
46 Ga0070682_100000005 3300005337 Bacteria 386439
47 Ga0070682_100013896 3300005337 Bacteria 4643
48 Ga0070682_100078608 3300005337 Bacteria 2128
49 Ga0068868_100001638 3300005338 Bacteria 15280
50 Ga0068868_100020263 3300005338 Bacteria 4992
51 Ga0068868_100032679 3300005338 Bacteria 4005
52 Ga0068868_100113568 3300005338 Bacteria 2203
53 Ga0070660_100005266 3300005339 Bacteria 8945
54 Ga0070660_100067897 3300005339 Bacteria 2778
55 Ga0070689_100082569 3300005340 Unclassified 2524
56 Ga0070689_100226633 3300005340 Unclassified 1535
57 Ga0070661_100003416 3300005344 Bacteria 10966
58 Ga0070668_100000222 3300005347 Bacteria 36600
59 Ga0070668_100056922 3300005347 Unclassified 3020
60 Ga0070668_100068418 3300005347 Unclassified 2760
61 Ga0070668_100144573 3300005347 Bacteria 1918
62 Ga0070669_100001129 3300005353 Bacteria 19498
63 Ga0070669_100011286 3300005353 Bacteria 6343
64 Ga0070669_100081853 3300005353 Bacteria 2406
65 Ga0070675_100030928 3300005354 Bacteria 4324
66 Ga0070675_100040318 3300005354 Bacteria 3812
67 Ga0070675_100042509 3300005354 Unclassified 3713
68 Ga0070675_100173314 3300005354 Bacteria 1861
69 Ga0070671_100005468 3300005355 Bacteria 10139
70 Ga0070671_100080979 3300005355 Bacteria 2715
71 Ga0070674_100057786 3300005356 Bacteria 2694
72 Ga0070673_100001715 3300005364 Bacteria 13018
73 Ga0070673_100050843 3300005364 Unclassified 3242
74 Ga0070673_100052930 3300005364 Unclassified 3186
75 Ga0070673_100072573 3300005364 Bacteria 2768
76 Ga0070673_100130348 3300005364 Bacteria 2109
77 Ga0070673_100278198 3300005364 Bacteria 1467
78 Ga0070688_100000319 3300005365 Bacteria 24587
79 Ga0070688_100012919 3300005365 Bacteria 4693
80 Ga0070688_100022392 3300005365 Bacteria 3702
81 Ga0070659_100095744 3300005366 Bacteria 2384
82 Ga0070667_100000240 3300005367 Bacteria 62100
83 Ga0070667_100016907 3300005367 Bacteria 6037
84 Ga0070700_100137211 3300005441 Bacteria 1658
85 Ga0070678_100055647 3300005456 Unclassified 2889
86 Ga0070678_100094885 3300005456 Unclassified 2297
87 Ga0070662_100007971 3300005457 Bacteria 6891
88 Ga0070662_100031637 3300005457 Bacteria 3715
89 Ga0070662_100070616 3300005457 Bacteria 2573
90 Ga0068867_100014407 3300005459 Bacteria 5603
91 Ga0068867_100014419 3300005459 Bacteria 5600
92 Ga0068867_100014598 3300005459 Bacteria 5566
93 Ga0068867_100023345 3300005459 Bacteria 4428
94 Ga0068867_100045818 3300005459 Bacteria 3209
95 Ga0068867_100163188 3300005459 Bacteria 1758
96 Ga0070685_10004932 3300005466 Bacteria 6750
97 Ga0070685_10009255 3300005466 Bacteria 5084
98 Ga0070685_10160657 3300005466 Unclassified 1432
99 Ga0070685_10211595 3300005466 Bacteria 1266
100 Ga0070707_100096798 3300005468 Bacteria 2859
101 Ga0070698_100011419 3300005471 Bacteria 9422
102 Ga0070679_100002080 3300005530 Bacteria 18017
103 Ga0070679_100092187 3300005530 Bacteria 3017
104 Ga0070684_100007926 3300005535 Bacteria 8288
105 Ga0070684_100096486 3300005535 Bacteria 2635
106 Ga0068853_100012242 3300005539 Bacteria 6977
107 Ga0068853_100015100 3300005539 Bacteria 6349
108 Ga0068853_100038991 3300005539 Bacteria 4050
109 Ga0068853_100047310 3300005539 Bacteria 3691
110 Ga0068853_100114367 3300005539 Bacteria 2400
111 Ga0070672_100000235 3300005543 Bacteria 30880
112 Ga0070672_100013723 3300005543 Bacteria 5728
113 Ga0070672_100034070 3300005543 Bacteria 3862
114 Ga0070672_100103589 3300005543 Bacteria 2311
115 Ga0070672_100182164 3300005543 Bacteria 1751
116 Ga0070672_100346714 3300005543 Bacteria 1265
117 Ga0070665_100000002 3300005548 Bacteria 849037
118 Ga0070665_100000805 3300005548 Bacteria 41003
119 Ga0070665_100232132 3300005548 Unclassified 1845
120 Ga0070704_100327149 3300005549 Bacteria 1286
121 Ga0068855_100014952 3300005563 Bacteria 9351
122 Ga0068855_100028646 3300005563 Bacteria 6664
123 Ga0068855_100078200 3300005563 Bacteria 3838
124 Ga0068855_100338288 3300005563 Bacteria 1660
125 Ga0070664_100036917 3300005564 Bacteria 4106
126 Ga0070664_100070966 3300005564 Bacteria 2984
127 Ga0070664_100320942 3300005564 Bacteria 1403
128 Ga0068857_100026239 3300005577 Bacteria 5134
129 Ga0068857_100042021 3300005577 Bacteria 4054
130 Ga0068857_100050448 3300005577 Bacteria 3692
131 Ga0068857_100121074 3300005577 Unclassified 2356
132 Ga0068857_100306803 3300005577 Unclassified 1464
133 Ga0068854_100082806 3300005578 Unclassified 2372
134 Ga0068854_100083641 3300005578 Unclassified 2360
135 Ga0068854_100092340 3300005578 Bacteria 2255
136 Ga0068856_100023003 3300005614 Bacteria 6059
137 Ga0068856_100024761 3300005614 Bacteria 5845
138 Ga0068852_100014267 3300005616 Bacteria 6109
139 Ga0068852_100021984 3300005616 Bacteria 5105
140 Ga0068852_100048871 3300005616 Bacteria 3616
141 Ga0068852_100590231 3300005616 Bacteria 1114
142 Ga0068859_100001806 3300005617 Bacteria 21791
143 Ga0068859_100005897 3300005617 Bacteria 12434
144 Ga0068859_100010703 3300005617 Bacteria 9234
145 Ga0068859_100012515 3300005617 Bacteria 8536
146 Ga0068859_100036219 3300005617 Bacteria 4954
147 Ga0068859_100037766 3300005617 Bacteria 4847
148 Ga0068859_100098433 3300005617 Bacteria 2979
149 Ga0068859_100107698 3300005617 Bacteria 2847
150 Ga0068864_100001901 3300005618 Bacteria 17135
151 Ga0068864_100012370 3300005618 Bacteria 7055
152 Ga0068864_100014460 3300005618 Bacteria 6555
153 Ga0068864_100017290 3300005618 Bacteria 6011
154 Ga0068864_100039932 3300005618 Bacteria 4012
155 Ga0068864_100085419 3300005618 Bacteria 2775
156 Ga0068864_100094598 3300005618 Bacteria 2641
157 Ga0068864_100529904 3300005618 Bacteria 1136
158 Ga0068866_10008983 3300005718 Bacteria 4233
159 Ga0068866_10019933 3300005718 Bacteria 3063
160 Ga0068861_100001569 3300005719 Bacteria 14529
161 Ga0068861_100006965 3300005719 Bacteria 7724
162 Ga0068861_100008893 3300005719 Bacteria 6922
163 Ga0068861_100020474 3300005719 Bacteria 4740
164 Ga0068851_10000328 3300005834 Bacteria 21556
165 Ga0068851_10004926 3300005834 Bacteria 6048
166 Ga0068851_10106515 3300005834 Bacteria 1493
167 Ga0068870_10022092 3300005840 Bacteria 3122
168 Ga0068870_10031522 3300005840 Bacteria 2687
169 Ga0068863_100013411 3300005841 Bacteria 7902
170 Ga0068863_100018735 3300005841 Bacteria 6624
171 Ga0068863_100024361 3300005841 Bacteria 5772
172 Ga0068858_100002517 3300005842 Bacteria 18457
173 Ga0068858_100006622 3300005842 Bacteria 11272
174 Ga0068858_100151779 3300005842 Unclassified 2179
175 Ga0068858_100522497 3300005842 Bacteria 1148
176 Ga0068860_100000443 3300005843 Bacteria 52294
177 Ga0068860_100003164 3300005843 Bacteria 16987
178 Ga0068860_100022032 3300005843 Bacteria 6168
179 Ga0068860_100023046 3300005843 Bacteria 6022
180 Ga0068860_100139759 3300005843 Bacteria 2327
181 Ga0068860_100227991 3300005843 Bacteria 1810
182 Ga0068862_100008675 3300005844 Bacteria 8408
183 Ga0068862_100016242 3300005844 Bacteria 6195
184 Ga0068862_100127986 3300005844 Bacteria 2244
185 Ga0068862_100129422 3300005844 Bacteria 2231
186 Ga0081539_10000337 3300005985 Bacteria 103868
187 Ga0075427_10009478 3300006194 Bacteria 1451
188 Ga0075366_10004422 3300006195 Bacteria 7547
189 Ga0097621_100000869 3300006237 Bacteria 21243
190 Ga0097621_100009909 3300006237 Bacteria 6943
191 Ga0097621_100011328 3300006237 Bacteria 6561
192 Ga0097621_100043426 3300006237 Bacteria 3623
193 Ga0097621_100128955 3300006237 Bacteria 2151
194 Ga0097621_100141112 3300006237 Bacteria 2059
195 Ga0097621_100173498 3300006237 Unclassified 1860
196 Ga0097621_100211907 3300006237 Bacteria 1685
197 Ga0068871_100000042 3300006358 Bacteria 67951
198 Ga0068871_100002350 3300006358 Bacteria 12893
199 Ga0068871_100004552 3300006358 Bacteria 9669
200 Ga0068871_100041031 3300006358 Bacteria 3709
201 Ga0068871_100073298 3300006358 Bacteria 2822
202 Ga0075428_100001033 3300006844 Bacteria 29496
203 Ga0075428_100003670 3300006844 Bacteria 16837
204 Ga0075430_100016499 3300006846 Bacteria 6291
205 Ga0075431_100005685 3300006847 Bacteria 12324
206 Ga0068865_100249980 3300006881 Bacteria 1399
207 Ga0097620_100001806 3300006931 Bacteria 21791
208 Ga0097620_100005897 3300006931 Bacteria 12434
209 Ga0097620_100010702 3300006931 Bacteria 9234
210 Ga0097620_100012515 3300006931 Bacteria 8536
211 Ga0097620_100036219 3300006931 Bacteria 4954
212 Ga0097620_100037766 3300006931 Bacteria 4847
213 Ga0097620_100098435 3300006931 Bacteria 2979
214 Ga0097620_100107696 3300006931 Bacteria 2847
215 Ga0105240_10000354 3300009093 Bacteria 86047
216 Ga0105240_10000421 3300009093 Bacteria 78509
217 Ga0105240_10048850 3300009093 Bacteria 5345
218 Ga0105240_10169983 3300009093 Bacteria 2583
219 Ga0111539_10002979 3300009094 Bacteria 22456
220 Ga0111539_10016538 3300009094 Bacteria 9143
221 Ga0105245_10009577 3300009098 Bacteria 8451
222 Ga0105247_10011054 3300009101 Bacteria 5446
223 Ga0105247_10017140 3300009101 Bacteria 4348
224 Ga0114129_10065323 3300009147 Bacteria 5078
225 Ga0114129_10066106 3300009147 Bacteria 5044
226 Ga0105241_10003599 3300009174 Bacteria 11528
227 Ga0105241_10121232 3300009174 Bacteria 2106
228 Ga0105242_10013830 3300009176 Bacteria 6246
229 Ga0105242_10015972 3300009176 Bacteria 5834
230 Ga0105242_10024446 3300009176 Unclassified 4771
231 Ga0105242_10039987 3300009176 Bacteria 3777
232 Ga0105242_10088209 3300009176 Bacteria 2606
233 Ga0105242_10167527 3300009176 Bacteria 1928
234 Ga0105242_10170597 3300009176 Bacteria 1912
235 Ga0105242_10234110 3300009176 Bacteria 1647
236 Ga0105242_10289359 3300009176 Bacteria 1491
237 Ga0105248_10019795 3300009177 Bacteria 7454
238 Ga0105248_10027116 3300009177 Bacteria 6373
239 Ga0105248_10057349 3300009177 Bacteria 4372
240 Ga0105248_10748386 3300009177 Unclassified 1103
241 Ga0105237_10001446 3300009545 Bacteria 31378
242 Ga0105237_10012169 3300009545 Bacteria 9076
243 Ga0105237_10354019 3300009545 Unclassified 1473
244 Ga0105238_10015007 3300009551 Bacteria 7844
245 Ga0105249_10001076 3300009553 Bacteria 24251
246 Ga0105249_10001887 3300009553 Bacteria 18138
247 Ga0105249_10003374 3300009553 Bacteria 13829
248 Ga0105249_10008792 3300009553 Bacteria 8814
249 Ga0105249_10016593 3300009553 Bacteria 6536
250 Ga0105249_10035140 3300009553 Unclassified 4543
251 Ga0105249_10218796 3300009553 Bacteria 1873
252 Ga0105239_10000662 3300010375 Bacteria 49050
253 Ga0105239_10007552 3300010375 Bacteria 12471
254 Ga0105239_10185416 3300010375 Bacteria 2328
255 Ga0105246_10004104 3300011119 Bacteria 8841
256 Ga0105246_10034399 3300011119 Bacteria 3376
257 Ga0157373_10014616 3300013100 Bacteria 5754
258 Ga0157373_10015880 3300013100 Bacteria 5497
259 Ga0157373_10021504 3300013100 Bacteria 4686
260 Ga0157373_10030380 3300013100 Bacteria 3888
261 Ga0157371_10016005 3300013102 Bacteria 5609
262 Ga0157371_10026084 3300013102 Bacteria 4252
263 Ga0157371_10029211 3300013102 Bacteria 3990
264 Ga0157371_10044628 3300013102 Unclassified 3156
265 Ga0157371_10108072 3300013102 Bacteria 1974
266 Ga0157370_10030582 3300013104 Bacteria 5276
267 Ga0157370_10037851 3300013104 Bacteria 4670
268 Ga0157370_10300294 3300013104 Bacteria 1482
269 Ga0157370_10307079 3300013104 Bacteria 1464
270 Ga0157369_10024502 3300013105 Bacteria 6711
271 Ga0157374_10000311 3300013296 Bacteria 45181
272 Ga0157374_10011356 3300013296 Bacteria 7707
273 Ga0157374_10045856 3300013296 Bacteria 4046
274 Ga0157374_10053711 3300013296 Bacteria 3757
275 Ga0157374_10087860 3300013296 Bacteria 2960
276 Ga0157374_10197113 3300013296 Unclassified 1971
277 Ga0157374_10210504 3300013296 Bacteria 1906
278 Ga0157374_10271886 3300013296 Bacteria 1671
279 Ga0157378_10005625 3300013297 Bacteria 10980
280 Ga0157378_10010375 3300013297 Bacteria 8132
281 Ga0157378_10021864 3300013297 Bacteria 5625
282 Ga0157378_10022653 3300013297 Bacteria 5529
283 Ga0157378_10125679 3300013297 Bacteria 2368
284 Ga0157378_10296378 3300013297 Unclassified 1564
285 Ga0157378_10580684 3300013297 Bacteria 1130
286 Ga0163162_10000542 3300013306 Bacteria 34914
287 Ga0163162_10003276 3300013306 Bacteria 15502
288 Ga0163162_10004364 3300013306 Bacteria 13614
289 Ga0163162_10005496 3300013306 Bacteria 12245
290 Ga0163162_10035903 3300013306 Bacteria 4938
291 Ga0163162_10517536 3300013306 Bacteria 1323
292 Ga0163162_10711524 3300013306 Bacteria 1125
293 Ga0157372_10005711 3300013307 Bacteria 13244
294 Ga0157372_10019773 3300013307 Bacteria 7257
295 Ga0157372_10030147 3300013307 Bacteria 5931
296 Ga0157372_10035550 3300013307 Bacteria 5486
297 Ga0157372_10052832 3300013307 Bacteria 4527
298 Ga0157372_10053085 3300013307 Bacteria 4516
299 Ga0157372_10092051 3300013307 Unclassified 3449
300 Ga0157372_10174900 3300013307 Unclassified 2485
301 Ga0157372_10234961 3300013307 Bacteria 2126
302 Ga0157372_10328306 3300013307 Bacteria 1781
303 Ga0157372_10690268 3300013307 Unclassified 1188
304 Ga0157375_10000182 3300013308 Bacteria 59120
305 Ga0157375_10004880 3300013308 Bacteria 11656
306 Ga0157375_10112721 3300013308 Bacteria 2820
307 Ga0157375_10170388 3300013308 Bacteria 2324
308 Ga0157375_10403523 3300013308 Unclassified 1533
309 Ga0157375_10451212 3300013308 Bacteria 1451
310 Ga0157375_10600134 3300013308 Bacteria 1260
311 Ga0163163_10000369 3300014325 Bacteria 43150
312 Ga0163163_10002634 3300014325 Bacteria 15189
313 Ga0163163_10023394 3300014325 Bacteria 5863
314 Ga0163163_10120377 3300014325 Bacteria 2659
315 Ga0163163_10121316 3300014325 Bacteria 2648
316 Ga0163163_10273510 3300014325 Unclassified 1740
317 Ga0163163_10424956 3300014325 Bacteria 1388
318 Ga0163163_10526925 3300014325 Bacteria 1244
319 Ga0157380_10000534 3300014326 Bacteria 23366
320 Ga0157380_10001098 3300014326 Bacteria 17446
321 Ga0157380_10007851 3300014326 Bacteria 7598
322 Ga0157380_10014499 3300014326 Bacteria 5767
323 Ga0157380_10029088 3300014326 Bacteria 4222
324 Ga0157380_10567323 3300014326 Bacteria 1117
325 Ga0157377_10196697 3300014745 Unclassified 1277
326 Ga0157379_10004066 3300014968 Bacteria 12477
327 Ga0157379_10038307 3300014968 Bacteria 4278
328 Ga0157379_10119943 3300014968 Bacteria 2366
329 Ga0157379_10121118 3300014968 Bacteria 2353
330 Ga0157379_10320028 3300014968 Bacteria 1416
331 Ga0157376_10000636 3300014969 Bacteria 22723
332 Ga0157376_10001263 3300014969 Bacteria 16636
333 Ga0157376_10035160 3300014969 Bacteria 4052
334 Ga0157376_10186326 3300014969 Bacteria 1900
335 Ga0163161_10026776 3300017792 Bacteria 4087
336 Ga0163161_10033428 3300017792 Bacteria 3675
337 Ga0163161_10158775 3300017792 Bacteria 1723
338 Ga0213876_10008947 3300021384 Bacteria 5401
339 Ga0213876_10039570 3300021384 Bacteria 2491
340 Ga0209436_102431 3300025208 Bacteria 5617
341 Ga0207425_1012182 3300025245 Bacteria 2027
342 Ga0209646_1000005 3300025246 Bacteria 717627
343 Ga0209646_1001229 3300025246 Bacteria 7286
344 Ga0209026_1000344 3300025250 Bacteria 44543
345 Ga0209130_1001504 3300025284 Bacteria 15049
346 Ga0209758_1000346 3300025297 Bacteria 84821
347 Ga0207426_1000026 3300025302 Bacteria 515228
348 Ga0207426_1000415 3300025302 Bacteria 70247
349 Ga0207426_1000536 3300025302 Bacteria 54323
350 Ga0207697_10034016 3300025315 Bacteria 2086
351 Ga0207697_10075707 3300025315 Unclassified 1414
352 Ga0207656_10000482 3300025321 Bacteria 13181
353 Ga0207656_10066396 3300025321 Bacteria 1595
354 Ga0207682_10010611 3300025893 Unclassified 3606
355 Ga0207682_10046787 3300025893 Unclassified 1779
356 Ga0207710_10003281 3300025900 Bacteria 7230
357 Ga0207710_10016230 3300025900 Bacteria 3149
358 Ga0207688_10050873 3300025901 Bacteria 2320
359 Ga0207680_10000199 3300025903 Bacteria 29010
360 Ga0207680_10000263 3300025903 Bacteria 25264
361 Ga0207680_10015557 3300025903 Bacteria 3973
362 Ga0207680_10073630 3300025903 Bacteria 2124
363 Ga0207685_10009490 3300025905 Bacteria 2829
364 Ga0207645_10000578 3300025907 Bacteria 30355
365 Ga0207645_10000684 3300025907 Bacteria 28112
366 Ga0207645_10132195 3300025907 Bacteria 1624
367 Ga0207643_10010404 3300025908 Bacteria 5011
368 Ga0207643_10019150 3300025908 Bacteria 3750
369 Ga0207643_10062316 3300025908 Bacteria 2131
370 Ga0207705_10001264 3300025909 Bacteria 20293
371 Ga0207705_10025007 3300025909 Bacteria 4263
372 Ga0207705_10054740 3300025909 Bacteria 2875
373 Ga0207705_10104672 3300025909 Bacteria 2085
374 Ga0207695_10000156 3300025913 Bacteria 204576
375 Ga0207695_10000421 3300025913 Bacteria 93835
376 Ga0207695_10101150 3300025913 Bacteria 2877
377 Ga0207695_10136620 3300025913 Bacteria 2404
378 Ga0207671_10005837 3300025914 Bacteria 11188
379 Ga0207671_10036387 3300025914 Unclassified 3651
380 Ga0207660_10030634 3300025917 Unclassified 3699
381 Ga0207660_10301410 3300025917 Bacteria 1276
382 Ga0207662_10019646 3300025918 Unclassified 3848
383 Ga0207657_10008310 3300025919 Bacteria 10562
384 Ga0207652_10000090 3300025921 Bacteria 99245
385 Ga0207681_10040003 3300025923 Bacteria 3116
386 Ga0207681_10071169 3300025923 Bacteria 2425
387 Ga0207681_10084374 3300025923 Unclassified 2252
388 Ga0207681_10090781 3300025923 Bacteria 2181
389 Ga0207650_10002058 3300025925 Bacteria 14067
390 Ga0207650_10022827 3300025925 Bacteria 4433
391 Ga0207650_10037197 3300025925 Bacteria 3546
392 Ga0207650_10085012 3300025925 Bacteria 2406
393 Ga0207650_10127925 3300025925 Bacteria 1985
394 Ga0207650_10189539 3300025925 Bacteria 1642
395 Ga0207650_10191276 3300025925 Bacteria 1635
396 Ga0207650_10193635 3300025925 Bacteria 1625
397 Ga0207650_10280723 3300025925 Unclassified 1356
398 Ga0207659_10053660 3300025926 Bacteria 2875
399 Ga0207659_10136471 3300025926 Bacteria 1899
400 Ga0207659_10229483 3300025926 Bacteria 1496
401 Ga0207687_10171842 3300025927 Bacteria 1672
402 Ga0207644_10007784 3300025931 Bacteria 6997
403 Ga0207644_10032153 3300025931 Bacteria 3659
404 Ga0207644_10390962 3300025931 Unclassified 1135
405 Ga0207690_10035274 3300025932 Bacteria 3230
406 Ga0207690_10385768 3300025932 Unclassified 1114
407 Ga0207706_10001373 3300025933 Bacteria 24327
408 Ga0207706_10015286 3300025933 Bacteria 6941
409 Ga0207706_10048273 3300025933 Bacteria 3765
410 Ga0207706_10100520 3300025933 Bacteria 2544
411 Ga0207686_10003016 3300025934 Bacteria 9072
412 Ga0207686_10047551 3300025934 Bacteria 2653
413 Ga0207686_10094101 3300025934 Bacteria 1986
414 Ga0207686_10140125 3300025934 Bacteria 1670
415 Ga0207709_10042621 3300025935 Bacteria 2731
416 Ga0207670_10225231 3300025936 Unclassified 1437
417 Ga0207669_10048974 3300025937 Bacteria 2515
418 Ga0207704_10247792 3300025938 Unclassified 1335
419 Ga0207691_10000076 3300025940 Bacteria 83005
420 Ga0207691_10003044 3300025940 Bacteria 16345
421 Ga0207691_10011209 3300025940 Bacteria 8603
422 Ga0207691_10063039 3300025940 Bacteria 3363
423 Ga0207691_10068796 3300025940 Bacteria 3199
424 Ga0207691_10079293 3300025940 Bacteria 2955
425 Ga0207691_10365455 3300025940 Bacteria 1233
426 Ga0207711_10034397 3300025941 Bacteria 4292
427 Ga0207711_10076878 3300025941 Bacteria 2909
428 Ga0207689_10004465 3300025942 Bacteria 12687
429 Ga0207689_10004854 3300025942 Bacteria 12114
430 Ga0207689_10012364 3300025942 Bacteria 7301
431 Ga0207689_10069800 3300025942 Bacteria 2887
432 Ga0207689_10251237 3300025942 Bacteria 1462
433 Ga0207661_10003918 3300025944 Bacteria 10392
434 Ga0207661_10057885 3300025944 Bacteria 3118
435 Ga0207661_10141040 3300025944 Bacteria 2074
436 Ga0207661_10351407 3300025944 Bacteria 1330
437 Ga0207679_10010918 3300025945 Bacteria 5859
438 Ga0207679_10045434 3300025945 Bacteria 3176
439 Ga0207679_10295241 3300025945 Bacteria 1395
440 Ga0207667_10008349 3300025949 Bacteria 12309
441 Ga0207667_10036319 3300025949 Bacteria 5282
442 Ga0207667_10041358 3300025949 Bacteria 4902
443 Ga0207667_10049304 3300025949 Bacteria 4448
444 Ga0207667_10122181 3300025949 Bacteria 2683
445 Ga0207651_10000830 3300025960 Bacteria 13402
446 Ga0207651_10071365 3300025960 Bacteria 2461
447 Ga0207651_10132813 3300025960 Bacteria 1909
448 Ga0207651_10401734 3300025960 Bacteria 1166
449 Ga0207712_10001244 3300025961 Bacteria 17583
450 Ga0207712_10002438 3300025961 Bacteria 12023
451 Ga0207712_10014691 3300025961 Bacteria 5042
452 Ga0207712_10019612 3300025961 Bacteria 4420
453 Ga0207712_10035521 3300025961 Bacteria 3387
454 Ga0207712_10088807 3300025961 Bacteria 2271
455 Ga0207668_10000318 3300025972 Bacteria 31353
456 Ga0207668_10013054 3300025972 Bacteria 5104
457 Ga0207668_10054430 3300025972 Bacteria 2778
458 Ga0207668_10153259 3300025972 Bacteria 1787
459 Ga0207668_10216698 3300025972 Bacteria 1534
460 Ga0207640_10097323 3300025981 Bacteria 2054
461 Ga0207658_10000312 3300025986 Bacteria 49332
462 Ga0207658_10059938 3300025986 Bacteria 2838
463 Ga0207658_10065033 3300025986 Bacteria 2738
464 Ga0207677_10000702 3300026023 Bacteria 19882
465 Ga0207677_10008575 3300026023 Bacteria 5719
466 Ga0207677_10018682 3300026023 Bacteria 4165
467 Ga0207703_10001961 3300026035 Bacteria 18184
468 Ga0207703_10007439 3300026035 Bacteria 8698
469 Ga0207703_10052493 3300026035 Bacteria 3311
470 Ga0207703_10372197 3300026035 Bacteria 1320
471 Ga0207703_10450682 3300026035 Bacteria 1202
472 Ga0207639_10029795 3300026041 Unclassified 3999
473 Ga0207639_10046472 3300026041 Bacteria 3276
474 Ga0207639_10089258 3300026041 Bacteria 2462
475 Ga0207639_10103255 3300026041 Bacteria 2309
476 Ga0207639_10129821 3300026041 Unclassified 2084
477 Ga0207639_10159261 3300026041 Bacteria 1900
478 Ga0207639_10257985 3300026041 Bacteria 1523
479 Ga0207639_10497874 3300026041 Bacteria 1113
480 Ga0207708_10078068 3300026075 Bacteria 2542
481 Ga0207702_10023396 3300026078 Bacteria 5123
482 Ga0207702_10054670 3300026078 Bacteria 3383
483 Ga0207641_10000132 3300026088 Bacteria 109247
484 Ga0207641_10009426 3300026088 Bacteria 8043
485 Ga0207641_10033323 3300026088 Bacteria 4280
486 Ga0207641_10124778 3300026088 Bacteria 2303
487 Ga0207641_10141716 3300026088 Unclassified 2169
488 Ga0207648_10033411 3300026089 Bacteria 4537
489 Ga0207648_10036512 3300026089 Bacteria 4329
490 Ga0207648_10051868 3300026089 Bacteria 3586
491 Ga0207648_10064664 3300026089 Bacteria 3188
492 Ga0207648_10073655 3300026089 Bacteria 2976
493 Ga0207648_10098867 3300026089 Bacteria 2555
494 Ga0207676_10002091 3300026095 Bacteria 14485
495 Ga0207676_10005940 3300026095 Bacteria 8613
496 Ga0207676_10053353 3300026095 Bacteria 3164
497 Ga0207676_10134838 3300026095 Bacteria 2105
498 Ga0207676_10145376 3300026095 Bacteria 2036
499 Ga0207676_10237674 3300026095 Bacteria 1632
500 Ga0207674_10027910 3300026116 Bacteria 5964
501 Ga0207674_10055695 3300026116 Unclassified 4019
502 Ga0207674_10159485 3300026116 Bacteria 2211
503 Ga0207675_100004244 3300026118 Bacteria 13858
504 Ga0207675_100005539 3300026118 Bacteria 12077
505 Ga0207675_100008307 3300026118 Bacteria 9779
506 Ga0207675_100012173 3300026118 Bacteria 8036
507 Ga0207675_100025080 3300026118 Bacteria 5549
508 Ga0207683_10002642 3300026121 Bacteria 15658
509 Ga0207683_10012830 3300026121 Bacteria 7153
510 Ga0207683_10037817 3300026121 Bacteria 4205
511 Ga0207683_10291410 3300026121 Bacteria 1492
512 Ga0207698_10010232 3300026142 Bacteria 6014
513 Ga0207698_10016603 3300026142 Bacteria 4969
514 Ga0207698_10045358 3300026142 Bacteria 3311
515 Ga0207698_10117030 3300026142 Bacteria 2247
516 Ga0207698_10163007 3300026142 Unclassified 1953
517 Ga0207698_10167043 3300026142 Bacteria 1932
518 Ga0207698_10488108 3300026142 Bacteria 1196
519 Ga0209995_1002026 3300027471 Bacteria 3175
520 Ga0207428_10012331 3300027907 Bacteria 7513
521 Ga0268266_10000022 3300028379 Bacteria 508060
522 Ga0268266_10062798 3300028379 Bacteria 3206
523 Ga0268265_10006021 3300028380 Bacteria 8252
524 Ga0268264_10000507 3300028381 Bacteria 50105
525 Ga0268264_10003951 3300028381 Bacteria 12698
526 Ga0268264_10008108 3300028381 Bacteria 8736
527 Ga0265327_10002557 3300031251 Bacteria 18876
528 Ga0265327_10036444 3300031251 Bacteria 2703
529 Ga0307509_10041068 3300031507 Bacteria 5024
530 Ga0307408_100199546 3300031548 Bacteria 1618
531 Ga0265313_10048290 3300031595 Bacteria 2055
532 Ga0307410_10092335 3300031852 Bacteria 2152
533 Ga0307416_100035256 3300032002 Bacteria 3819
534 Ga0307414_10319340 3300032004 Unclassified 1321
535 Ga0307411_10032001 3300032005 Bacteria 3245
536 Ga0307415_100015213 3300032126 Bacteria 4548
537 Ga0307507_10139813 3300033179 Bacteria 1861
538 Ga0395899_0006114 3300037312 Bacteria 9328
539 Ga0395899_0141944 3300037312 Bacteria 1708
540 Ga0395900_0002720 3300037418 Bacteria 19323
541 Ga0395900_0010916 3300037418 Bacteria 9288
542 Ga0395900_0050493 3300037418 Unclassified 4284
543 Ga0395898_0001101 3300037466 Bacteria 41709
544 Ga0395905_0000744 3300037471 Bacteria 42929
545 Ga0395901_0003505 3300038443 Bacteria 15808
546 Ga0436365_1251897 3300039437 Bacteria 24739
547 Ga0436365_1864275 3300039437 Bacteria 15414
548 Ga0439431_0001217 3300041997 Bacteria 5631
549 Ga0439449_0001616 3300042007 Bacteria 8829
550 Ga0439449_0065096 3300042007 Bacteria 1345
551 Ga0439457_004522 3300042014 Bacteria 3610
552 Ga0451577_0141624 3300042876 Unclassified 2161
553 Ga0451577_0190107 3300042876 Unclassified 1852
554 Ga0466972_0000212 3300044658 Bacteria 41192
555 Ga0466972_0000245 3300044658 Bacteria 36884
556 Ga0453683_0036277 3300044673 Bacteria 3103
557 Ga0453683_0193339 3300044673 Bacteria 1291
558 Ga0453684_0088274 3300044712 Bacteria 3840
559 Ga0453684_0092001 3300044712 Bacteria 3741
560 Ga0453684_0169775 3300044712 Bacteria 2572
561 Ga0453684_0285294 3300044712 Unclassified 1881
562 Ga0453684_0299020 3300044712 Bacteria 1830
563 Ga0466970_0001574 3300044765 Bacteria 11016
564 Ga0466957_0015617 3300044842 Bacteria 4436
565 Ga0466960_0073983 3300044901 Unclassified 1702
566 Ga0451576_0202924 3300045051 Bacteria 2071
567 Ga0466967_0132534 3300045976 Bacteria 2315
568 Ga0495638_0037080 3300046460 Bacteria 3103
569 Ga0495594_0115413 3300046499 Bacteria 1516
570 Ga0495648_0007825 3300046524 Bacteria 8504
571 Ga0495598_0029290 3300046537 Bacteria 1534
572 Ga0495621_0057818 3300046539 Bacteria 1401
573 Ga0495672_0009173 3300047320 Bacteria 7205
574 Ga0495687_000278 3300047443 Bacteria 67787
575 Ga0495686_0004775 3300047472 Bacteria 10955
576 Ga0501031_0001894 3300049568 Bacteria 13194
577 Ga0501033_0025776 3300049570 Bacteria 4429
578 Ga0501034_0021697 3300049571 Bacteria 6542
579 Ga0501034_0097566 3300049571 Bacteria 2934
580 Ga0501037_0006836 3300049573 Bacteria 8333
581 Ga0501038_0032513 3300049574 Unclassified 4602
582 Ga0501038_0140655 3300049574 Bacteria 1975
583 Ga0501039_0015549 3300049575 Bacteria 5823
584 Ga0501043_0009348 3300049579 Bacteria 7699
585 Ga0501046_0006163 3300049580 Bacteria 10648
586 Ga0501047_0017978 3300049581 Bacteria 6776
587 Ga0501047_0125833 3300049581 Bacteria 2443
588 Ga0501047_0179875 3300049581 Bacteria 1981
589 Ga0501048_0267322 3300049582 Bacteria 1215
590 Ga0501207_001878 3300049654 Bacteria 2675
591 Ga0501207_009118 3300049654 Bacteria 1445
592 Ga0501223_004698 3300049663 Bacteria 2904
593 Ga0501223_012995 3300049663 Bacteria 1661
594 Ga0501233_002227 3300049668 Bacteria 3397
595 Ga0501240_005953 3300049673 Unclassified 1482
596 Ga0501242_012527 3300049674 Bacteria 1033
597 Ga0501249_023428 3300049679 Bacteria 1356
598 Ga0501250_001665 3300049680 Unclassified 1889
599 Ga0501257_001706 3300049686 Bacteria 4579
600 Ga0501259_000498 3300049688 Bacteria 6298
601 Ga0501219_000056 3300049703 Bacteria 18514
602 Ga0501221_004362 3300049704 Bacteria 2345
603 Ga0501225_0003182 3300049705 Bacteria 5017
604 Ga0501234_010185 3300049707 Bacteria 1465
605 Ga0501245_003961 3300049708 Bacteria 2024
606 Ga0501245_004208 3300049708 Unclassified 1971
607 Ga0501080_0244590 3300049742 Unclassified 1637
608 Ga0501268_005840 3300049765 Bacteria 1782
609 Ga0501035_0063573 3300049822 Bacteria 3282
610 Ga0501035_0108436 3300049822 Bacteria 2435
611 Ga0501044_0025969 3300049823 Bacteria 6205
612 Ga0501284_00170 3300050005 Bacteria 5866
613 nmdc:mga0k408_9266_c1 3300050493 Bacteria 5305
614 nmdc:mga05p37_153393_c1 3300050507 Bacteria 2816
615 nmdc:mga05p37_21738_c1 3300050507 Bacteria 7772
616 nmdc:mga05p37_429063_c1 3300050507 Unclassified 1536
617 nmdc:mga09592_1410_c1 3300050508 Bacteria 19253
618 nmdc:mga0qj67_17807_c1 3300050509 Bacteria 5404
619 nmdc:mga06r32_6846_c1 3300050510 Bacteria 10243
620 nmdc:mga08y16_127877_c1 3300050511 Bacteria 2643
621 nmdc:mga08y16_2620_c1 3300050511 Bacteria 18482
622 nmdc:mga08y16_285304_c1 3300050511 Bacteria 1702
623 Ga0500644_0005448 3300053088 Bacteria 3214
624 Ga0500583_0000124 3300053092 Bacteria 35474
625 Ga0500641_0033993 3300053096 Unclassified 2027
626 Ga0500562_000051 3300053108 Bacteria 59249
627 Ga0500658_0020247 3300053134 Bacteria 2510
628 Ga0500568_0001401 3300053139 Bacteria 15635
629 Ga0500568_0018015 3300053139 Unclassified 3103
630 Ga0500573_0144525 3300053140 Bacteria 1307
631 Ga0500588_0002526 3300053146 Bacteria 3738
632 Ga0500616_0003892 3300053153 Bacteria 10981
633 Ga0500622_0004869 3300053156 Bacteria 8217
634 Ga0500622_0018705 3300053156 Bacteria 3680
635 Ga0500636_0069540 3300053177 Bacteria 2043
636 Ga0500611_000004 3300053727 Bacteria 253326
637 Ga0500645_048989 3300053730 Unclassified 1236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0108436 Ga0501035_0108436_1456_2379 280
2 3300005563 Ga0068855_100014952 Ga0068855_1000149523 282
3 3300025949 Ga0207667_10036319 Ga0207667_100363192 282
4 3300026041 Ga0207639_10046472 Ga0207639_100464723 282
5 3300026116 Ga0207674_10159485 Ga0207674_101594853 282
6 3300013100 Ga0157373_10014616 Ga0157373_100146167 291
7 3300049708 Ga0501245_004208 Ga0501245_004208_11_892 292
8 3300026118 Ga0207675_100012173 Ga0207675_1000121734 296
9 3300003323 rootH1_10164670 rootH1_101646701 299
10 3300013307 Ga0157372_10328306 Ga0157372_103283062 299
11 3300037471 Ga0395905_0000744 Ga0395905_0000744_6557_7459 300
12 3300009093 Ga0105240_10000354 Ga0105240_1000035430 301
13 3300013102 Ga0157371_10044628 Ga0157371_100446282 301
14 3300013104 Ga0157370_10300294 Ga0157370_103002942 301
15 3300013307 Ga0157372_10092051 Ga0157372_100920512 301
16 3300025913 Ga0207695_10000421 Ga0207695_1000042145 301
17 3300049571 Ga0501034_0021697 Ga0501034_0021697_4498_5454 301
18 3300049703 Ga0501219_000056 Ga0501219_000056_15791_16768 301
19 3300050005 Ga0501284_00170 Ga0501284_00170_3202_4179 301
20 3300053730 Ga0500645_048989 Ga0500645_048989_118_1053 301
21 iso_pu_bacteria 2914759650 2914762298 302
22 3300005290 Ga0065712_10104546 Ga0065712_101045462 303
23 3300005331 Ga0070670_100170607 Ga0070670_1001706072 303
24 3300005354 Ga0070675_100040318 Ga0070675_1000403182 303
25 3300005543 Ga0070672_100182164 Ga0070672_1001821641 303
26 3300014325 Ga0163163_10273510 Ga0163163_102735102 303
27 3300014326 Ga0157380_10029088 Ga0157380_100290883 303
28 3300025925 Ga0207650_10189539 Ga0207650_101895391 303
29 3300025926 Ga0207659_10053660 Ga0207659_100536602 303
30 3300025940 Ga0207691_10365455 Ga0207691_103654551 303
31 3300026121 Ga0207683_10012830 Ga0207683_100128302 303
32 3300037312 Ga0395899_0006114 Ga0395899_0006114_1522_2466 303
33 3300037418 Ga0395900_0002720 Ga0395900_0002720_5786_6730 303
34 3300037466 Ga0395898_0001101 Ga0395898_0001101_27231_28175 303
35 3300038443 Ga0395901_0003505 Ga0395901_0003505_13552_14496 303
36 3300005578 Ga0068854_100083641 Ga0068854_1000836412 304
37 3300009553 Ga0105249_10035140 Ga0105249_100351403 304
38 3300013306 Ga0163162_10005496 Ga0163162_100054965 304
39 3300013308 Ga0157375_10403523 Ga0157375_104035232 304
40 3300014968 Ga0157379_10121118 Ga0157379_101211182 304
41 3300017792 Ga0163161_10033428 Ga0163161_100334282 304
42 3300025961 Ga0207712_10019612 Ga0207712_100196123 304
43 3300026142 Ga0207698_10045358 Ga0207698_100453582 304
44 3300005327 Ga0070658_10135716 Ga0070658_101357161 305
45 3300005339 Ga0070660_100067897 Ga0070660_1000678972 305
46 3300005366 Ga0070659_100095744 Ga0070659_1000957442 305
47 3300005530 Ga0070679_100002080 Ga0070679_10000208012 305
48 3300005530 Ga0070679_100092187 Ga0070679_1000921872 305
49 3300013104 Ga0157370_10030582 Ga0157370_100305823 305
50 3300013307 Ga0157372_10234961 Ga0157372_102349612 305
51 3300025909 Ga0207705_10104672 Ga0207705_101046721 305
52 3300025917 Ga0207660_10301410 Ga0207660_103014101 305
53 3300025921 Ga0207652_10000090 Ga0207652_100000904 305
54 3300025932 Ga0207690_10035274 Ga0207690_100352742 305
55 3300026041 Ga0207639_10257985 Ga0207639_102579852 305
56 3300026142 Ga0207698_10163007 Ga0207698_101630072 305
57 3300031595 Ga0265313_10048290 Ga0265313_100482901 305
58 3300037312 Ga0395899_0141944 Ga0395899_0141944_560_1504 305
59 3300037418 Ga0395900_0010916 Ga0395900_0010916_4491_5435 305
60 3300053140 Ga0500573_0144525 Ga0500573_0144525_265_1230 305
61 3300013296 Ga0157374_10210504 Ga0157374_102105042 306
62 3300014325 Ga0163163_10526925 Ga0163163_105269251 306
63 3300025986 Ga0207658_10065033 Ga0207658_100650332 306
64 3300003354 JGI25160J50197_1002285 JGI25160J50197_10022857 307
65 3300005331 Ga0070670_100309883 Ga0070670_1003098832 307
66 3300005543 Ga0070672_100034070 Ga0070672_1000340702 307
67 3300005548 Ga0070665_100000002 Ga0070665_100000002289 307
68 3300013307 Ga0157372_10053085 Ga0157372_100530852 307
69 3300017792 Ga0163161_10158775 Ga0163161_101587752 307
70 3300025208 Ga0209436_102431 Ga0209436_1024312 307
71 3300025284 Ga0209130_1001504 Ga0209130_10015048 307
72 3300025302 Ga0207426_1000415 Ga0207426_10004159 307
73 3300025940 Ga0207691_10068796 Ga0207691_100687962 307
74 3300028379 Ga0268266_10000022 Ga0268266_10000022148 307
75 3300005327 Ga0070658_10023254 Ga0070658_100232542 308
76 3300005329 Ga0070683_100019545 Ga0070683_1000195453 308
77 3300005330 Ga0070690_100063936 Ga0070690_1000639362 308
78 3300005335 Ga0070666_10011413 Ga0070666_100114135 308
79 3300005337 Ga0070682_100013896 Ga0070682_1000138962 308
80 3300005338 Ga0068868_100032679 Ga0068868_1000326792 308
81 3300005339 Ga0070660_100005266 Ga0070660_1000052661 308
82 3300005344 Ga0070661_100003416 Ga0070661_1000034162 308
83 3300005364 Ga0070673_100278198 Ga0070673_1002781981 308
84 3300005456 Ga0070678_100055647 Ga0070678_1000556472 308
85 3300005457 Ga0070662_100031637 Ga0070662_1000316372 308
86 3300005535 Ga0070684_100096486 Ga0070684_1000964862 308
87 3300005539 Ga0068853_100038991 Ga0068853_1000389912 308
88 3300005563 Ga0068855_100078200 Ga0068855_1000782002 308
89 3300005564 Ga0070664_100070966 Ga0070664_1000709662 308
90 3300005577 Ga0068857_100050448 Ga0068857_1000504483 308
91 3300005578 Ga0068854_100092340 Ga0068854_1000923402 308
92 3300005614 Ga0068856_100024761 Ga0068856_1000247613 308
93 3300005618 Ga0068864_100085419 Ga0068864_1000854193 308
94 3300005834 Ga0068851_10106515 Ga0068851_101065152 308
95 3300005842 Ga0068858_100151779 Ga0068858_1001517793 308
96 3300006237 Ga0097621_100173498 Ga0097621_1001734982 308
97 3300009093 Ga0105240_10000421 Ga0105240_1000042140 308
98 3300009545 Ga0105237_10012169 Ga0105237_100121694 308
99 3300010375 Ga0105239_10007552 Ga0105239_100075522 308
100 3300013100 Ga0157373_10015880 Ga0157373_100158805 308
101 3300013102 Ga0157371_10026084 Ga0157371_100260843 308
102 3300013104 Ga0157370_10037851 Ga0157370_100378512 308
103 3300013105 Ga0157369_10024502 Ga0157369_100245025 308
104 3300013296 Ga0157374_10011356 Ga0157374_100113562 308
105 3300013297 Ga0157378_10022653 Ga0157378_100226534 308
106 3300013307 Ga0157372_10174900 Ga0157372_101749002 308
107 3300013307 Ga0157372_10690268 Ga0157372_106902682 308
108 3300014745 Ga0157377_10196697 Ga0157377_101966971 308
109 3300025246 Ga0209646_1001229 Ga0209646_10012292 308
110 3300025321 Ga0207656_10066396 Ga0207656_100663961 308
111 3300025903 Ga0207680_10015557 Ga0207680_100155572 308
112 3300025909 Ga0207705_10025007 Ga0207705_100250072 308
113 3300025913 Ga0207695_10000156 Ga0207695_10000156154 308
114 3300025914 Ga0207671_10036387 Ga0207671_100363872 308
115 3300025919 Ga0207657_10008310 Ga0207657_1000831010 308
116 3300025932 Ga0207690_10385768 Ga0207690_103857681 308
117 3300025933 Ga0207706_10001373 Ga0207706_100013735 308
118 3300025944 Ga0207661_10057885 Ga0207661_100578852 308
119 3300025945 Ga0207679_10045434 Ga0207679_100454342 308
120 3300025949 Ga0207667_10122181 Ga0207667_101221812 308
121 3300025960 Ga0207651_10071365 Ga0207651_100713652 308
122 3300025981 Ga0207640_10097323 Ga0207640_100973232 308
123 3300026041 Ga0207639_10029795 Ga0207639_100297953 308
124 3300026078 Ga0207702_10023396 Ga0207702_100233962 308
125 3300026116 Ga0207674_10055695 Ga0207674_100556951 308
126 3300026142 Ga0207698_10117030 Ga0207698_101170302 308
127 3300041997 Ga0439431_0001217 Ga0439431_0001217_1142_2095 308
128 3300042876 Ga0451577_0141624 Ga0451577_0141624_289_1266 308
129 3300044673 Ga0453683_0193339 Ga0453683_0193339_73_1011 308
130 3300044712 Ga0453684_0092001 Ga0453684_0092001_665_1603 308
131 3300044712 Ga0453684_0169775 Ga0453684_0169775_1548_2525 308
132 3300046524 Ga0495648_0007825 Ga0495648_0007825_4405_5331 308
133 3300047443 Ga0495687_000278 Ga0495687_000278_8872_9798 308
134 3300053139 Ga0500568_0018015 Ga0500568_0018015_1029_1955 308
135 3300053156 Ga0500622_0004869 Ga0500622_0004869_5350_6276 308
136 3300053177 Ga0500636_0069540 Ga0500636_0069540_516_1487 308
137 iso_pu_bacteria 2818991460 2819677375 308
138 3300005328 Ga0070676_10000522 Ga0070676_1000052212 309
139 3300005335 Ga0070666_10000558 Ga0070666_1000055813 309
140 3300005338 Ga0068868_100001638 Ga0068868_1000016382 309
141 3300005347 Ga0070668_100000222 Ga0070668_1000002223 309
142 3300005364 Ga0070673_100001715 Ga0070673_1000017154 309
143 3300005367 Ga0070667_100000240 Ga0070667_1000002409 309
144 3300005457 Ga0070662_100007971 Ga0070662_1000079715 309
145 3300005543 Ga0070672_100000235 Ga0070672_10000023521 309
146 3300005548 Ga0070665_100000805 Ga0070665_1000008056 309
147 3300005563 Ga0068855_100028646 Ga0068855_1000286462 309
148 3300005616 Ga0068852_100021984 Ga0068852_1000219845 309
149 3300005617 Ga0068859_100005897 Ga0068859_1000058979 309
150 3300005618 Ga0068864_100001901 Ga0068864_1000019019 309
151 3300005719 Ga0068861_100008893 Ga0068861_1000088933 309
152 3300005834 Ga0068851_10004926 Ga0068851_100049264 309
153 3300005841 Ga0068863_100013411 Ga0068863_1000134113 309
154 3300005842 Ga0068858_100002517 Ga0068858_1000025175 309
155 3300005843 Ga0068860_100023046 Ga0068860_1000230462 309
156 3300006237 Ga0097621_100011328 Ga0097621_1000113282 309
157 3300006358 Ga0068871_100004552 Ga0068871_1000045525 309
158 3300006931 Ga0097620_100005897 Ga0097620_1000058979 309
159 3300009093 Ga0105240_10048850 Ga0105240_100488502 309
160 3300009098 Ga0105245_10009577 Ga0105245_100095772 309
161 3300009176 Ga0105242_10088209 Ga0105242_100882092 309
162 3300009177 Ga0105248_10019795 Ga0105248_100197953 309
163 3300009553 Ga0105249_10016593 Ga0105249_100165932 309
164 3300010375 Ga0105239_10185416 Ga0105239_101854162 309
165 3300011119 Ga0105246_10034399 Ga0105246_100343991 309
166 3300013296 Ga0157374_10000311 Ga0157374_1000031129 309
167 3300013297 Ga0157378_10125679 Ga0157378_101256792 309
168 3300013306 Ga0163162_10000542 Ga0163162_1000054221 309
169 3300013308 Ga0157375_10004880 Ga0157375_100048806 309
170 3300014325 Ga0163163_10000369 Ga0163163_1000036931 309
171 3300014968 Ga0157379_10004066 Ga0157379_100040663 309
172 3300014969 Ga0157376_10000636 Ga0157376_1000063612 309
173 3300017792 Ga0163161_10026776 Ga0163161_100267762 309
174 3300025315 Ga0207697_10075707 Ga0207697_100757071 309
175 3300025903 Ga0207680_10000263 Ga0207680_1000026318 309
176 3300025907 Ga0207645_10000684 Ga0207645_100006843 309
177 3300025909 Ga0207705_10001264 Ga0207705_1000126413 309
178 3300025909 Ga0207705_10054740 Ga0207705_100547401 309
179 3300025913 Ga0207695_10136620 Ga0207695_101366202 309
180 3300025927 Ga0207687_10171842 Ga0207687_101718421 309
181 3300025933 Ga0207706_10015286 Ga0207706_100152862 309
182 3300025935 Ga0207709_10042621 Ga0207709_100426212 309
183 3300025940 Ga0207691_10000076 Ga0207691_1000007639 309
184 3300025941 Ga0207711_10076878 Ga0207711_100768782 309
185 3300025949 Ga0207667_10041358 Ga0207667_100413583 309
186 3300025960 Ga0207651_10000830 Ga0207651_100008306 309
187 3300025961 Ga0207712_10088807 Ga0207712_100888072 309
188 3300025972 Ga0207668_10000318 Ga0207668_100003187 309
189 3300025986 Ga0207658_10000312 Ga0207658_1000031215 309
190 3300026023 Ga0207677_10000702 Ga0207677_1000070215 309
191 3300026035 Ga0207703_10001961 Ga0207703_100019618 309
192 3300026088 Ga0207641_10009426 Ga0207641_100094263 309
193 3300026089 Ga0207648_10073655 Ga0207648_100736552 309
194 3300026095 Ga0207676_10002091 Ga0207676_100020915 309
195 3300026118 Ga0207675_100008307 Ga0207675_1000083076 309
196 3300026142 Ga0207698_10016603 Ga0207698_100166035 309
197 3300028379 Ga0268266_10062798 Ga0268266_100627981 309
198 3300028381 Ga0268264_10003951 Ga0268264_1000395110 309
199 3300037418 Ga0395900_0050493 Ga0395900_0050493_1165_2094 309
200 3300053153 Ga0500616_0003892 Ga0500616_0003892_7816_8748 309
201 iso_pu_bacteria 2945977869 2945979598 309
202 iso_pu_bacteria 2946013367 2946014535 309
203 3300005328 Ga0070676_10067054 Ga0070676_100670542 310
204 3300005331 Ga0070670_100053760 Ga0070670_1000537602 310
205 3300005335 Ga0070666_10035896 Ga0070666_100358962 310
206 3300005338 Ga0068868_100020263 Ga0068868_1000202635 310
207 3300005347 Ga0070668_100056922 Ga0070668_1000569222 310
208 3300005364 Ga0070673_100130348 Ga0070673_1001303482 310
209 3300005456 Ga0070678_100094885 Ga0070678_1000948852 310
210 3300005457 Ga0070662_100070616 Ga0070662_1000706162 310
211 3300005459 Ga0068867_100163188 Ga0068867_1001631882 310
212 3300005543 Ga0070672_100103589 Ga0070672_1001035892 310
213 3300005578 Ga0068854_100082806 Ga0068854_1000828062 310
214 3300005617 Ga0068859_100037766 Ga0068859_1000377662 310
215 3300005718 Ga0068866_10019933 Ga0068866_100199332 310
216 3300005719 Ga0068861_100006965 Ga0068861_1000069656 310
217 3300005840 Ga0068870_10031522 Ga0068870_100315222 310
218 3300005843 Ga0068860_100022032 Ga0068860_1000220324 310
219 3300005844 Ga0068862_100016242 Ga0068862_1000162422 310
220 3300006237 Ga0097621_100043426 Ga0097621_1000434262 310
221 3300006931 Ga0097620_100037766 Ga0097620_1000377662 310
222 3300009176 Ga0105242_10039987 Ga0105242_100399872 310
223 3300009176 Ga0105242_10170597 Ga0105242_101705972 310
224 3300011119 Ga0105246_10004104 Ga0105246_100041044 310
225 3300013102 Ga0157371_10029211 Ga0157371_100292112 310
226 3300013296 Ga0157374_10271886 Ga0157374_102718862 310
227 3300013297 Ga0157378_10021864 Ga0157378_100218642 310
228 3300013307 Ga0157372_10035550 Ga0157372_100355501 310
229 3300025901 Ga0207688_10050873 Ga0207688_100508732 310
230 3300025903 Ga0207680_10073630 Ga0207680_100736302 310
231 3300025907 Ga0207645_10000578 Ga0207645_1000057816 310
232 3300025907 Ga0207645_10132195 Ga0207645_101321952 310
233 3300025908 Ga0207643_10019150 Ga0207643_100191502 310
234 3300025925 Ga0207650_10280723 Ga0207650_102807231 310
235 3300025926 Ga0207659_10136471 Ga0207659_101364711 310
236 3300025933 Ga0207706_10048273 Ga0207706_100482732 310
237 3300025934 Ga0207686_10047551 Ga0207686_100475512 310
238 3300025938 Ga0207704_10247792 Ga0207704_102477922 310
239 3300025940 Ga0207691_10063039 Ga0207691_100630392 310
240 3300025942 Ga0207689_10004854 Ga0207689_100048548 310
241 3300025942 Ga0207689_10012364 Ga0207689_100123642 310
242 3300025972 Ga0207668_10216698 Ga0207668_102166982 310
243 3300025986 Ga0207658_10059938 Ga0207658_100599382 310
244 3300026041 Ga0207639_10129821 Ga0207639_101298212 310
245 3300026121 Ga0207683_10002642 Ga0207683_100026427 310
246 3300031548 Ga0307408_100199546 Ga0307408_1001995461 310
247 3300031852 Ga0307410_10092335 Ga0307410_100923352 310
248 3300032002 Ga0307416_100035256 Ga0307416_1000352562 310
249 3300032005 Ga0307411_10032001 Ga0307411_100320012 310
250 3300032126 Ga0307415_100015213 Ga0307415_1000152132 310
251 3300044658 Ga0466972_0000245 Ga0466972_0000245_16386_17399 310
252 3300044765 Ga0466970_0001574 Ga0466970_0001574_5774_6787 310
253 3300044901 Ga0466960_0073983 Ga0466960_0073983_153_1166 310
254 3300046460 Ga0495638_0037080 Ga0495638_0037080_1318_2250 310
255 3300049568 Ga0501031_0001894 Ga0501031_0001894_6919_7851 310
256 3300049571 Ga0501034_0097566 Ga0501034_0097566_408_1340 310
257 3300049573 Ga0501037_0006836 Ga0501037_0006836_5784_6716 310
258 3300049574 Ga0501038_0032513 Ga0501038_0032513_1105_2037 310
259 3300049575 Ga0501039_0015549 Ga0501039_0015549_1685_2617 310
260 3300049579 Ga0501043_0009348 Ga0501043_0009348_5763_6695 310
261 3300049580 Ga0501046_0006163 Ga0501046_0006163_5790_6722 310
262 3300049654 Ga0501207_009118 Ga0501207_009118_416_1348 310
263 3300049663 Ga0501223_004698 Ga0501223_004698_1717_2649 310
264 3300049707 Ga0501234_010185 Ga0501234_010185_389_1321 310
265 3300049742 Ga0501080_0244590 Ga0501080_0244590_560_1492 310
266 3300049822 Ga0501035_0063573 Ga0501035_0063573_120_1052 310
267 3300049823 Ga0501044_0025969 Ga0501044_0025969_4308_5240 310
268 3300003323 rootH1_10010982 rootH1_100109824 311
269 3300005334 Ga0068869_100265593 Ga0068869_1002655932 311
270 3300005335 Ga0070666_10000086 Ga0070666_1000008619 311
271 3300005338 Ga0068868_100113568 Ga0068868_1001135682 311
272 3300005347 Ga0070668_100144573 Ga0070668_1001445732 311
273 3300005355 Ga0070671_100080979 Ga0070671_1000809792 311
274 3300005548 Ga0070665_100232132 Ga0070665_1002321322 311
275 3300005564 Ga0070664_100320942 Ga0070664_1003209422 311
276 3300005616 Ga0068852_100014267 Ga0068852_1000142672 311
277 3300005617 Ga0068859_100001806 Ga0068859_10000180613 311
278 3300005618 Ga0068864_100017290 Ga0068864_1000172906 311
279 3300005841 Ga0068863_100018735 Ga0068863_1000187352 311
280 3300005842 Ga0068858_100006622 Ga0068858_1000066227 311
281 3300005843 Ga0068860_100003164 Ga0068860_10000316412 311
282 3300006237 Ga0097621_100009909 Ga0097621_1000099092 311
283 3300006237 Ga0097621_100128955 Ga0097621_1001289552 311
284 3300006358 Ga0068871_100002350 Ga0068871_10000235011 311
285 3300006931 Ga0097620_100001806 Ga0097620_10000180611 311
286 3300009101 Ga0105247_10011054 Ga0105247_100110542 311
287 3300009174 Ga0105241_10003599 Ga0105241_100035993 311
288 3300009176 Ga0105242_10024446 Ga0105242_100244465 311
289 3300009177 Ga0105248_10748386 Ga0105248_107483861 311
290 3300009545 Ga0105237_10001446 Ga0105237_1000144611 311
291 3300009553 Ga0105249_10001076 Ga0105249_1000107610 311
292 3300013297 Ga0157378_10580684 Ga0157378_105806842 311
293 3300013306 Ga0163162_10004364 Ga0163162_100043642 311
294 3300014325 Ga0163163_10023394 Ga0163163_100233942 311
295 3300014968 Ga0157379_10119943 Ga0157379_101199431 311
296 3300014969 Ga0157376_10035160 Ga0157376_100351602 311
297 3300025900 Ga0207710_10016230 Ga0207710_100162302 311
298 3300025903 Ga0207680_10000199 Ga0207680_100001992 311
299 3300025914 Ga0207671_10005837 Ga0207671_100058372 311
300 3300025925 Ga0207650_10002058 Ga0207650_100020585 311
301 3300025931 Ga0207644_10032153 Ga0207644_100321531 311
302 3300025934 Ga0207686_10140125 Ga0207686_101401252 311
303 3300025942 Ga0207689_10004465 Ga0207689_100044658 311
304 3300025942 Ga0207689_10251237 Ga0207689_102512372 311
305 3300025960 Ga0207651_10132813 Ga0207651_101328131 311
306 3300025961 Ga0207712_10002438 Ga0207712_100024389 311
307 3300025972 Ga0207668_10013054 Ga0207668_100130543 311
308 3300026023 Ga0207677_10018682 Ga0207677_100186822 311
309 3300026035 Ga0207703_10007439 Ga0207703_100074392 311
310 3300026088 Ga0207641_10000132 Ga0207641_1000013289 311
311 3300026095 Ga0207676_10053353 Ga0207676_100533532 311
312 3300026142 Ga0207698_10010232 Ga0207698_100102322 311
313 3300028381 Ga0268264_10008108 Ga0268264_100081085 311
314 3300049574 Ga0501038_0140655 Ga0501038_0140655_293_1231 311
315 3300049581 Ga0501047_0179875 Ga0501047_0179875_458_1396 311
316 3300049654 Ga0501207_001878 Ga0501207_001878_1484_2419 311
317 3300049663 Ga0501223_012995 Ga0501223_012995_515_1450 311
318 3300049668 Ga0501233_002227 Ga0501233_002227_175_1110 311
319 3300049688 Ga0501259_000498 Ga0501259_000498_211_1146 311
320 3300049704 Ga0501221_004362 Ga0501221_004362_895_1830 311
321 3300049705 Ga0501225_0003182 Ga0501225_0003182_1735_2670 311
322 3300049708 Ga0501245_003961 Ga0501245_003961_1011_1946 311
323 iso_pu_bacteria 2840677318 2840679202 311
324 iso_pu_bacteria 2896085136 2896087013 311
325 iso_pu_bacteria 2929921140 2929921289 311
326 3300005459 Ga0068867_100014419 Ga0068867_1000144192 312
327 3300005539 Ga0068853_100015100 Ga0068853_1000151002 312
328 3300005539 Ga0068853_100047310 Ga0068853_1000473102 312
329 3300005539 Ga0068853_100114367 Ga0068853_1001143672 312
330 3300005563 Ga0068855_100338288 Ga0068855_1003382882 312
331 3300005618 Ga0068864_100039932 Ga0068864_1000399322 312
332 3300009174 Ga0105241_10121232 Ga0105241_101212322 312
333 3300009176 Ga0105242_10234110 Ga0105242_102341103 312
334 3300009545 Ga0105237_10354019 Ga0105237_103540192 312
335 3300009551 Ga0105238_10015007 Ga0105238_100150072 312
336 3300010375 Ga0105239_10000662 Ga0105239_100006627 312
337 3300013307 Ga0157372_10019773 Ga0157372_100197733 312
338 3300025913 Ga0207695_10101150 Ga0207695_101011502 312
339 3300025949 Ga0207667_10049304 Ga0207667_100493043 312
340 3300026041 Ga0207639_10103255 Ga0207639_101032552 312
341 3300026041 Ga0207639_10159261 Ga0207639_101592612 312
342 3300026089 Ga0207648_10098867 Ga0207648_100988672 312
343 3300026095 Ga0207676_10145376 Ga0207676_101453762 312
344 3300044842 Ga0466957_0015617 Ga0466957_0015617_3323_4291 312
345 3300049674 Ga0501242_012527 Ga0501242_012527_41_982 312
346 3300049679 Ga0501249_023428 Ga0501249_023428_103_1044 312
347 3300049680 Ga0501250_001665 Ga0501250_001665_799_1740 312
348 3300049686 Ga0501257_001706 Ga0501257_001706_167_1108 312
349 3300049765 Ga0501268_005840 Ga0501268_005840_301_1242 312
350 iso_pu_bacteria 2883068021 2883070021 312
351 iso_pu_bacteria 2929154850 2929158527 312
352 3300005331 Ga0070670_100267197 Ga0070670_1002671971 313
353 3300005340 Ga0070689_100226633 Ga0070689_1002266331 313
354 3300005466 Ga0070685_10160657 Ga0070685_101606571 313
355 3300005468 Ga0070707_100096798 Ga0070707_1000967981 313
356 3300005577 Ga0068857_100306803 Ga0068857_1003068032 313
357 3300005843 Ga0068860_100139759 Ga0068860_1001397592 313
358 3300009176 Ga0105242_10289359 Ga0105242_102893591 313
359 3300013297 Ga0157378_10296378 Ga0157378_102963782 313
360 3300025917 Ga0207660_10030634 Ga0207660_100306343 313
361 3300025923 Ga0207681_10084374 Ga0207681_100843743 313
362 3300025936 Ga0207670_10225231 Ga0207670_102252312 313
363 3300026035 Ga0207703_10372197 Ga0207703_103721971 313
364 3300033179 Ga0307507_10139813 Ga0307507_101398132 313
365 3300049673 Ga0501240_005953 Ga0501240_005953_399_1340 313
366 3300053146 Ga0500588_0002526 Ga0500588_0002526_1939_2880 313
367 iso_pu_bacteria 2738541278 2738724623 313
368 3300005329 Ga0070683_100390700 Ga0070683_1003907002 314
369 3300005331 Ga0070670_100086672 Ga0070670_1000866722 314
370 3300005331 Ga0070670_100107920 Ga0070670_1001079202 314
371 3300005331 Ga0070670_100499590 Ga0070670_1004995901 314
372 3300005333 Ga0070677_10004564 Ga0070677_100045642 314
373 3300005334 Ga0068869_100048915 Ga0068869_1000489153 314
374 3300005334 Ga0068869_100319700 Ga0068869_1003197002 314
375 3300005337 Ga0070682_100000005 Ga0070682_10000000584 314
376 3300005347 Ga0070668_100068418 Ga0070668_1000684182 314
377 3300005353 Ga0070669_100001129 Ga0070669_1000011295 314
378 3300005364 Ga0070673_100050843 Ga0070673_1000508432 314
379 3300005364 Ga0070673_100052930 Ga0070673_1000529302 314
380 3300005365 Ga0070688_100000319 Ga0070688_1000003192 314
381 3300005459 Ga0068867_100014407 Ga0068867_1000144072 314
382 3300005459 Ga0068867_100014598 Ga0068867_1000145981 314
383 3300005466 Ga0070685_10211595 Ga0070685_102115952 314
384 3300005543 Ga0070672_100013723 Ga0070672_1000137235 314
385 3300005577 Ga0068857_100026239 Ga0068857_1000262391 314
386 3300005617 Ga0068859_100012515 Ga0068859_1000125156 314
387 3300005618 Ga0068864_100529904 Ga0068864_1005299042 314
388 3300005719 Ga0068861_100001569 Ga0068861_1000015694 314
389 3300005840 Ga0068870_10022092 Ga0068870_100220922 314
390 3300005842 Ga0068858_100522497 Ga0068858_1005224971 314
391 3300005843 Ga0068860_100000443 Ga0068860_10000044315 314
392 3300005844 Ga0068862_100008675 Ga0068862_1000086756 314
393 3300006881 Ga0068865_100249980 Ga0068865_1002499802 314
394 3300006931 Ga0097620_100012515 Ga0097620_1000125156 314
395 3300009094 Ga0111539_10002979 Ga0111539_100029797 314
396 3300009553 Ga0105249_10218796 Ga0105249_102187961 314
397 3300013104 Ga0157370_10307079 Ga0157370_103070791 314
398 3300013296 Ga0157374_10045856 Ga0157374_100458561 314
399 3300013296 Ga0157374_10053711 Ga0157374_100537112 314
400 3300013296 Ga0157374_10197113 Ga0157374_101971132 314
401 3300013297 Ga0157378_10010375 Ga0157378_100103756 314
402 3300013306 Ga0163162_10711524 Ga0163162_107115242 314
403 3300014325 Ga0163163_10424956 Ga0163163_104249562 314
404 3300014326 Ga0157380_10014499 Ga0157380_100144995 314
405 3300021384 Ga0213876_10039570 Ga0213876_100395702 314
406 3300025315 Ga0207697_10034016 Ga0207697_100340162 314
407 3300025893 Ga0207682_10010611 Ga0207682_100106112 314
408 3300025923 Ga0207681_10040003 Ga0207681_100400031 314
409 3300025925 Ga0207650_10127925 Ga0207650_101279252 314
410 3300025925 Ga0207650_10191276 Ga0207650_101912762 314
411 3300025931 Ga0207644_10390962 Ga0207644_103909621 314
412 3300025933 Ga0207706_10100520 Ga0207706_101005203 314
413 3300025940 Ga0207691_10003044 Ga0207691_100030442 314
414 3300025944 Ga0207661_10141040 Ga0207661_101410402 314
415 3300025944 Ga0207661_10351407 Ga0207661_103514071 314
416 3300025945 Ga0207679_10295241 Ga0207679_102952412 314
417 3300025960 Ga0207651_10401734 Ga0207651_104017342 314
418 3300025972 Ga0207668_10153259 Ga0207668_101532592 314
419 3300026023 Ga0207677_10008575 Ga0207677_100085752 314
420 3300026088 Ga0207641_10033323 Ga0207641_100333233 314
421 3300026089 Ga0207648_10033411 Ga0207648_100334112 314
422 3300026116 Ga0207674_10027910 Ga0207674_100279104 314
423 3300026118 Ga0207675_100005539 Ga0207675_10000553910 314
424 3300027907 Ga0207428_10012331 Ga0207428_100123315 314
425 3300028380 Ga0268265_10006021 Ga0268265_100060212 314
426 3300028381 Ga0268264_10000507 Ga0268264_1000050712 314
427 3300039437 Ga0436365_1864275 Ga0436365_1864275_11795_12748 314
428 3300050511 nmdc:mga08y16_2620_c1 nmdc:mga08y16_2620_c1_13477_14457 314
429 3300002741 JGI25157J39369_1005145 JGI25157J39369_10051452 315
430 3300003215 JGI25153J46596_10007702 JGI25153J46596_100077023 315
431 3300003354 JGI25160J50197_1002656 JGI25160J50197_10026564 315
432 3300005289 Ga0065704_10077623 Ga0065704_100776232 315
433 3300005841 Ga0068863_100024361 Ga0068863_1000243614 315
434 3300014325 Ga0163163_10002634 Ga0163163_1000263413 315
435 3300025245 Ga0207425_1012182 Ga0207425_10121822 315
436 3300025246 Ga0209646_1000005 Ga0209646_100000530 315
437 3300025250 Ga0209026_1000344 Ga0209026_10003443 315
438 3300025297 Ga0209758_1000346 Ga0209758_10003464 315
439 3300025302 Ga0207426_1000536 Ga0207426_100053628 315
440 3300042876 Ga0451577_0190107 Ga0451577_0190107_595_1572 315
441 3300044712 Ga0453684_0285294 Ga0453684_0285294_434_1411 315
442 3300003354 JGI25160J50197_1001338 JGI25160J50197_10013382 316
443 3300005329 Ga0070683_100002538 Ga0070683_1000025388 316
444 3300005331 Ga0070670_100126707 Ga0070670_1001267072 316
445 3300005354 Ga0070675_100173314 Ga0070675_1001733142 316
446 3300005355 Ga0070671_100005468 Ga0070671_1000054683 316
447 3300005367 Ga0070667_100016907 Ga0070667_1000169073 316
448 3300005535 Ga0070684_100007926 Ga0070684_1000079267 316
449 3300005543 Ga0070672_100346714 Ga0070672_1003467142 316
450 3300005564 Ga0070664_100036917 Ga0070664_1000369172 316
451 3300005616 Ga0068852_100590231 Ga0068852_1005902311 316
452 3300006237 Ga0097621_100000869 Ga0097621_1000008696 316
453 3300006358 Ga0068871_100000042 Ga0068871_10000004239 316
454 3300009176 Ga0105242_10167527 Ga0105242_101675272 316
455 3300009177 Ga0105248_10027116 Ga0105248_100271164 316
456 3300013100 Ga0157373_10021504 Ga0157373_100215043 316
457 3300013100 Ga0157373_10030380 Ga0157373_100303803 316
458 3300013102 Ga0157371_10016005 Ga0157371_100160054 316
459 3300013296 Ga0157374_10087860 Ga0157374_100878602 316
460 3300013297 Ga0157378_10005625 Ga0157378_100056258 316
461 3300013306 Ga0163162_10003276 Ga0163162_100032765 316
462 3300013307 Ga0157372_10005711 Ga0157372_100057115 316
463 3300013308 Ga0157375_10000182 Ga0157375_1000018227 316
464 3300013308 Ga0157375_10600134 Ga0157375_106001342 316
465 3300014968 Ga0157379_10038307 Ga0157379_100383072 316
466 3300014969 Ga0157376_10001263 Ga0157376_100012637 316
467 3300025302 Ga0207426_1000026 Ga0207426_1000026388 316
468 3300025925 Ga0207650_10085012 Ga0207650_100850122 316
469 3300025926 Ga0207659_10229483 Ga0207659_102294832 316
470 3300025931 Ga0207644_10007784 Ga0207644_100077845 316
471 3300025940 Ga0207691_10079293 Ga0207691_100792932 316
472 3300025941 Ga0207711_10034397 Ga0207711_100343972 316
473 3300025944 Ga0207661_10003918 Ga0207661_100039188 316
474 3300025945 Ga0207679_10010918 Ga0207679_100109182 316
475 3300026035 Ga0207703_10450682 Ga0207703_104506821 316
476 3300026041 Ga0207639_10497874 Ga0207639_104978741 316
477 3300026121 Ga0207683_10291410 Ga0207683_102914102 316
478 3300026142 Ga0207698_10488108 Ga0207698_104881082 316
479 3300027471 Ga0209995_1002026 Ga0209995_10020262 316
480 3300031251 Ga0265327_10002557 Ga0265327_100025574 316
481 3300042007 Ga0439449_0001616 Ga0439449_0001616_6390_7352 316
482 3300042014 Ga0439457_004522 Ga0439457_004522_111_1073 316
483 3300053108 Ga0500562_000051 Ga0500562_000051_10343_11323 316
484 3300053156 Ga0500622_0018705 Ga0500622_0018705_91_1071 316
485 3300003316 rootH1_10020270 rootH1_100202702 317
486 3300003323 rootH1_10009137 rootH1_100091375 317
487 3300005328 Ga0070676_10089796 Ga0070676_100897962 317
488 3300005539 Ga0068853_100012242 Ga0068853_1000122423 317
489 3300005577 Ga0068857_100042021 Ga0068857_1000420213 317
490 3300005577 Ga0068857_100121074 Ga0068857_1001210742 317
491 3300005614 Ga0068856_100023003 Ga0068856_1000230038 317
492 3300005616 Ga0068852_100048871 Ga0068852_1000488712 317
493 3300005618 Ga0068864_100094598 Ga0068864_1000945981 317
494 3300006237 Ga0097621_100141112 Ga0097621_1001411122 317
495 3300006358 Ga0068871_100041031 Ga0068871_1000410312 317
496 3300009093 Ga0105240_10169983 Ga0105240_101699832 317
497 3300013306 Ga0163162_10035903 Ga0163162_100359032 317
498 3300013308 Ga0157375_10170388 Ga0157375_101703882 317
499 3300025908 Ga0207643_10062316 Ga0207643_100623162 317
500 3300025949 Ga0207667_10008349 Ga0207667_100083499 317
501 3300026041 Ga0207639_10089258 Ga0207639_100892582 317
502 3300026078 Ga0207702_10054670 Ga0207702_100546702 317
503 3300026095 Ga0207676_10237674 Ga0207676_102376742 317
504 3300031507 Ga0307509_10041068 Ga0307509_100410683 317
505 3300042007 Ga0439449_0065096 Ga0439449_0065096_221_1174 317
506 3300044658 Ga0466972_0000212 Ga0466972_0000212_10201_11172 317
507 3300046539 Ga0495621_0057818 Ga0495621_0057818_90_1052 317
508 3300049581 Ga0501047_0125833 Ga0501047_0125833_27_992 317
509 3300050507 nmdc:mga05p37_21738_c1 nmdc:mga05p37_21738_c1_2340_3305 317
510 3300053088 Ga0500644_0005448 Ga0500644_0005448_1096_2061 317
511 3300053092 Ga0500583_0000124 Ga0500583_0000124_29818_30783 317
512 3300053134 Ga0500658_0020247 Ga0500658_0020247_1316_2281 317
513 3300005441 Ga0070700_100137211 Ga0070700_1001372111 318
514 3300005459 Ga0068867_100045818 Ga0068867_1000458182 318
515 3300013307 Ga0157372_10052832 Ga0157372_100528323 318
516 3300026075 Ga0207708_10078068 Ga0207708_100780682 318
517 3300026089 Ga0207648_10064664 Ga0207648_100646642 318
518 3300032004 Ga0307414_10319340 Ga0307414_103193402 318
519 3300049581 Ga0501047_0017978 Ga0501047_0017978_2723_3691 318
520 3300049582 Ga0501048_0267322 Ga0501048_0267322_100_1068 318
521 3300005329 Ga0070683_100149174 Ga0070683_1001491743 319
522 3300005354 Ga0070675_100030928 Ga0070675_1000309282 319
523 3300005549 Ga0070704_100327149 Ga0070704_1003271492 319
524 3300009094 Ga0111539_10016538 Ga0111539_100165385 319
525 3300013102 Ga0157371_10108072 Ga0157371_101080722 319
526 3300013307 Ga0157372_10030147 Ga0157372_100301472 319
527 3300025925 Ga0207650_10037197 Ga0207650_100371972 319
528 3300026142 Ga0207698_10167043 Ga0207698_101670431 319
529 3300044673 Ga0453683_0036277 Ga0453683_0036277_315_1316 319
530 3300044712 Ga0453684_0299020 Ga0453684_0299020_199_1161 319
531 3300049570 Ga0501033_0025776 Ga0501033_0025776_1755_2834 319
532 3300050511 nmdc:mga08y16_127877_c1 nmdc:mga08y16_127877_c1_335_1297 319
533 3300005337 Ga0070682_100078608 Ga0070682_1000786081 320
534 3300005353 Ga0070669_100011286 Ga0070669_1000112864 320
535 3300005617 Ga0068859_100098433 Ga0068859_1000984332 320
536 3300005719 Ga0068861_100020474 Ga0068861_1000204743 320
537 3300006931 Ga0097620_100098435 Ga0097620_1000984352 320
538 3300009176 Ga0105242_10013830 Ga0105242_100138301 320
539 3300025893 Ga0207682_10046787 Ga0207682_100467872 320
540 3300025923 Ga0207681_10071169 Ga0207681_100711692 320
541 3300026118 Ga0207675_100004244 Ga0207675_1000042442 320
542 3300005290 Ga0065712_10003121 Ga0065712_100031212 321
543 3300005290 Ga0065712_10003730 Ga0065712_100037301 321
544 3300005293 Ga0065715_10009105 Ga0065715_100091052 321
545 3300005331 Ga0070670_100050471 Ga0070670_1000504712 321
546 3300005340 Ga0070689_100082569 Ga0070689_1000825692 321
547 3300005354 Ga0070675_100042509 Ga0070675_1000425091 321
548 3300005364 Ga0070673_100072573 Ga0070673_1000725732 321
549 3300005365 Ga0070688_100012919 Ga0070688_1000129192 321
550 3300005365 Ga0070688_100022392 Ga0070688_1000223922 321
551 3300005466 Ga0070685_10004932 Ga0070685_100049323 321
552 3300005466 Ga0070685_10009255 Ga0070685_100092551 321
553 3300005617 Ga0068859_100107698 Ga0068859_1001076982 321
554 3300005844 Ga0068862_100127986 Ga0068862_1001279861 321
555 3300006194 Ga0075427_10009478 Ga0075427_100094782 321
556 3300006237 Ga0097621_100211907 Ga0097621_1002119072 321
557 3300006358 Ga0068871_100073298 Ga0068871_1000732981 321
558 3300006844 Ga0075428_100001033 Ga0075428_10000103317 321
559 3300006847 Ga0075431_100005685 Ga0075431_1000056853 321
560 3300006931 Ga0097620_100107696 Ga0097620_1001076962 321
561 3300009147 Ga0114129_10066106 Ga0114129_100661062 321
562 3300009177 Ga0105248_10057349 Ga0105248_100573492 321
563 3300013306 Ga0163162_10517536 Ga0163162_105175362 321
564 3300013308 Ga0157375_10112721 Ga0157375_101127212 321
565 3300013308 Ga0157375_10451212 Ga0157375_104512121 321
566 3300014325 Ga0163163_10121316 Ga0163163_101213162 321
567 3300014326 Ga0157380_10567323 Ga0157380_105673231 321
568 3300014969 Ga0157376_10186326 Ga0157376_101863262 321
569 3300021384 Ga0213876_10008947 Ga0213876_100089476 321
570 3300025905 Ga0207685_10009490 Ga0207685_100094902 321
571 3300025908 Ga0207643_10010404 Ga0207643_100104042 321
572 3300025918 Ga0207662_10019646 Ga0207662_100196463 321
573 3300025925 Ga0207650_10193635 Ga0207650_101936352 321
574 3300025934 Ga0207686_10003016 Ga0207686_100030167 321
575 3300025940 Ga0207691_10011209 Ga0207691_100112096 321
576 3300025942 Ga0207689_10069800 Ga0207689_100698002 321
577 3300025961 Ga0207712_10001244 Ga0207712_1000124411 321
578 3300026035 Ga0207703_10052493 Ga0207703_100524932 321
579 3300026088 Ga0207641_10124778 Ga0207641_101247782 321
580 3300026088 Ga0207641_10141716 Ga0207641_101417162 321
581 3300026089 Ga0207648_10051868 Ga0207648_100518682 321
582 3300026095 Ga0207676_10134838 Ga0207676_101348382 321
583 3300026118 Ga0207675_100025080 Ga0207675_1000250802 321
584 3300026121 Ga0207683_10037817 Ga0207683_100378172 321
585 3300031251 Ga0265327_10036444 Ga0265327_100364442 321
586 3300039437 Ga0436365_1251897 Ga0436365_1251897_1786_2802 321
587 3300046499 Ga0495594_0115413 Ga0495594_0115413_463_1455 321
588 3300046537 Ga0495598_0029290 Ga0495598_0029290_146_1138 321
589 3300050507 nmdc:mga05p37_153393_c1 nmdc:mga05p37_153393_c1_1641_2633 321
590 3300050510 nmdc:mga06r32_6846_c1 nmdc:mga06r32_6846_c1_6434_7426 321
591 3300050511 nmdc:mga08y16_285304_c1 nmdc:mga08y16_285304_c1_480_1472 321
592 3300003203 JGI25406J46586_10007164 JGI25406J46586_100071645 322
593 3300005353 Ga0070669_100081853 Ga0070669_1000818532 322
594 3300005356 Ga0070674_100057786 Ga0070674_1000577862 322
595 3300005459 Ga0068867_100023345 Ga0068867_1000233452 322
596 3300005471 Ga0070698_100011419 Ga0070698_1000114192 322
597 3300005617 Ga0068859_100010703 Ga0068859_10001070310 322
598 3300005618 Ga0068864_100014460 Ga0068864_1000144607 322
599 3300005718 Ga0068866_10008983 Ga0068866_100089832 322
600 3300005834 Ga0068851_10000328 Ga0068851_1000032819 322
601 3300005985 Ga0081539_10000337 Ga0081539_1000033759 322
602 3300006844 Ga0075428_100003670 Ga0075428_1000036706 322
603 3300006846 Ga0075430_100016499 Ga0075430_1000164992 322
604 3300006931 Ga0097620_100010702 Ga0097620_10001070210 322
605 3300009101 Ga0105247_10017140 Ga0105247_100171402 322
606 3300009147 Ga0114129_10065323 Ga0114129_100653232 322
607 3300009176 Ga0105242_10015972 Ga0105242_100159724 322
608 3300009553 Ga0105249_10008792 Ga0105249_100087922 322
609 3300014326 Ga0157380_10001098 Ga0157380_1000109815 322
610 3300014326 Ga0157380_10007851 Ga0157380_100078515 322
611 3300014968 Ga0157379_10320028 Ga0157379_103200281 322
612 3300025321 Ga0207656_10000482 Ga0207656_1000048213 322
613 3300025900 Ga0207710_10003281 Ga0207710_100032815 322
614 3300025923 Ga0207681_10090781 Ga0207681_100907811 322
615 3300025934 Ga0207686_10094101 Ga0207686_100941012 322
616 3300025937 Ga0207669_10048974 Ga0207669_100489742 322
617 3300025961 Ga0207712_10014691 Ga0207712_100146914 322
618 3300025972 Ga0207668_10054430 Ga0207668_100544302 322
619 3300026089 Ga0207648_10036512 Ga0207648_100365122 322
620 3300044712 Ga0453684_0088274 Ga0453684_0088274_2214_3182 322
621 3300045976 Ga0466967_0132534 Ga0466967_0132534_1039_2007 322
622 3300047320 Ga0495672_0009173 Ga0495672_0009173_3554_4522 322
623 3300050493 nmdc:mga0k408_9266_c1 nmdc:mga0k408_9266_c1_3729_4697 322
624 3300050507 nmdc:mga05p37_429063_c1 nmdc:mga05p37_429063_c1_98_1093 322
625 3300050508 nmdc:mga09592_1410_c1 nmdc:mga09592_1410_c1_5393_6388 322
626 3300050509 nmdc:mga0qj67_17807_c1 nmdc:mga0qj67_17807_c1_822_1817 322
627 3300053096 Ga0500641_0033993 Ga0500641_0033993_867_1835 322
628 3300053139 Ga0500568_0001401 Ga0500568_0001401_10004_10975 322
629 3300005617 Ga0068859_100036219 Ga0068859_1000362195 323
630 3300006195 Ga0075366_10004422 Ga0075366_100044222 323
631 3300006931 Ga0097620_100036219 Ga0097620_1000362195 323
632 3300009553 Ga0105249_10001887 Ga0105249_1000188716 323
633 3300014325 Ga0163163_10120377 Ga0163163_101203772 323
634 3300014326 Ga0157380_10000534 Ga0157380_1000053413 323
635 3300045051 Ga0451576_0202924 Ga0451576_0202924_785_1801 323
636 3300047472 Ga0495686_0004775 Ga0495686_0004775_1450_2421 323
637 3300053727 Ga0500611_000004 Ga0500611_000004_126169_127155 323
638 3300002459 JGI24751J29686_10001840 JGI24751J29686_100018404 324
639 3300005331 Ga0070670_100037082 Ga0070670_1000370822 324
640 3300005618 Ga0068864_100012370 Ga0068864_1000123706 324
641 3300005843 Ga0068860_100227991 Ga0068860_1002279912 324
642 3300005844 Ga0068862_100129422 Ga0068862_1001294221 324
643 3300009553 Ga0105249_10003374 Ga0105249_100033748 324
644 3300025925 Ga0207650_10022827 Ga0207650_100228273 324
645 3300025961 Ga0207712_10035521 Ga0207712_100355212 324
646 3300026095 Ga0207676_10005940 Ga0207676_100059407 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

125

330

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.4351 64 278
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.4263 62 278
8t6b-assembly1.cif.gz_A human vmat2 in complex with serotonin 0.4251 60 270
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.3862 63 289
4ikw-assembly1.cif.gz_A crystal structure of peptide transporter pot in complex with sulfate 0.3674 4 286
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.536 71 273 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5256 71 273 1.20.1250.20
af_Q9VCJ5_372_573_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4625 63 278 1.20.1250.20
af_Q8CFZ5_122_533_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4571 64 271 1.20.1250.20
af_Q9VCJ5_372_573_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.45 63 278 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4Q5YCX7-F1-model_v4 TerC/Alx family metal homeostasis membrane protein 0.9843 80 310 GO:0016020
AF-A0A6J4QC66-F1-model_v4 Integral membrane protein TerC 0.9569 8 235 GO:0016020
AF-A0A4Y7KTA9-F1-model_v4 Uncharacterized protein 0.9563 35 309 GO:0016020
AF-A0A811RT46-F1-model_v4 Thylakoid membrane protein TERC, chloroplastic 0.9558 35 310 GO:0016020
AF-A0A6I9U331-F1-model_v4 Thylakoid membrane protein TERC, chloroplastic isoform X2 0.9533 35 309 GO:0016020

Feature Viewer

pLDDT pTM Quality
85.49 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map