F472179

General Info

Members Datasets Scaffolds Average Seq Length
646 302 1292 113

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10016236|Ga0070681_100162361
Length 128
Sequence MPKVLRLSAFPEREMELDLVRGTLDLLILKTLSWGPMHGLAVMRSIEQTTREQLQIEEGALYPALHRMEDKGWLDAEWGLTERNRKAKFYRVTAAGRKHLTTELTRWSRYTSAVGLVLNARSAAGAGK

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
186 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
187 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
211 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
212 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
250 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
251 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
252 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
253 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
272 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
273 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
274 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
275 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
276 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
277 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
278 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
279 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
280 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
281 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
285 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
286 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
287 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
302 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.39
Rhizosphere 97.83
Stem 0
Stem Tuber 0
Unclassified 34.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10016236 3300005458 Bacteria 7427
2 Ga0065714_10369941 3300005288 Unclassified 617
3 Ga0065712_10057801 3300005290 Bacteria 822
4 Ga0065715_10306963 3300005293 Bacteria 1029
5 Ga0065707_10100241 3300005295 Bacteria 2945
6 Ga0070658_10310446 3300005327 Unclassified 1345
7 Ga0070658_10493550 3300005327 Bacteria 1057
8 Ga0070676_10082302 3300005328 Unclassified 1955
9 Ga0070676_10258006 3300005328 Unclassified 1166
10 Ga0070676_10356590 3300005328 Bacteria 1007
11 Ga0070676_10439898 3300005328 Bacteria 915
12 Ga0070683_100031059 3300005329 Bacteria 4853
13 Ga0070683_100056610 3300005329 Bacteria 3641
14 Ga0070683_100059839 3300005329 Bacteria 3539
15 Ga0070683_100070691 3300005329 Bacteria 3256
16 Ga0070683_100952588 3300005329 Bacteria 824
17 Ga0070690_100013708 3300005330 Bacteria 4799
18 Ga0070690_100459131 3300005330 Bacteria 946
19 Ga0070670_100305781 3300005331 Bacteria 1391
20 Ga0070670_100353470 3300005331 Unclassified 1291
21 Ga0070670_100379730 3300005331 Bacteria 1245
22 Ga0070670_101107506 3300005331 Bacteria 722
23 Ga0068869_100197752 3300005334 Bacteria 1584
24 Ga0070666_10266570 3300005335 Bacteria 1215
25 Ga0070666_10477954 3300005335 Unclassified 902
26 Ga0070666_11381979 3300005335 Bacteria 526
27 Ga0070666_11433698 3300005335 Unclassified 516
28 Ga0070680_100000415 3300005336 Bacteria 29079
29 Ga0070680_100006790 3300005336 Bacteria 8719
30 Ga0070680_100086915 3300005336 Bacteria 2585
31 Ga0070680_100149819 3300005336 Bacteria 1958
32 Ga0070682_100155642 3300005337 Bacteria 1573
33 Ga0068868_101655622 3300005338 Bacteria 602
34 Ga0070689_100021572 3300005340 Bacteria 4799
35 Ga0070689_100031402 3300005340 Bacteria 4035
36 Ga0070689_100041615 3300005340 Bacteria 3527
37 Ga0070689_101598846 3300005340 Unclassified 592
38 Ga0070691_10160729 3300005341 Bacteria 1158
39 Ga0070687_100011154 3300005343 Bacteria 3920
40 Ga0070687_100332918 3300005343 Bacteria 974
41 Ga0070661_100423523 3300005344 Bacteria 1056
42 Ga0070668_100732984 3300005347 Unclassified 874
43 Ga0070669_100028721 3300005353 Bacteria 4005
44 Ga0070669_100153982 3300005353 Bacteria 1781
45 Ga0070669_101325725 3300005353 Unclassified 624
46 Ga0070675_100068942 3300005354 Bacteria 2929
47 Ga0070675_100128407 3300005354 Bacteria 2158
48 Ga0070674_100356990 3300005356 Unclassified 1182
49 Ga0070674_101016399 3300005356 Bacteria 728
50 Ga0070674_101744689 3300005356 Bacteria 564
51 Ga0070673_100052623 3300005364 Bacteria 3196
52 Ga0070673_100228244 3300005364 Bacteria 1614
53 Ga0070673_100577250 3300005364 Bacteria 1024
54 Ga0070673_100582251 3300005364 Bacteria 1019
55 Ga0070688_100002067 3300005365 Bacteria 10132
56 Ga0070688_100134814 3300005365 Bacteria 1670
57 Ga0070688_100642197 3300005365 Unclassified 816
58 Ga0070688_100762159 3300005365 Bacteria 754
59 Ga0070667_100357132 3300005367 Unclassified 1324
60 Ga0070667_100603178 3300005367 Unclassified 1012
61 Ga0070667_101135747 3300005367 Bacteria 731
62 Ga0070667_101400474 3300005367 Bacteria 656
63 Ga0070714_100271947 3300005435 Unclassified 1571
64 Ga0070713_100412667 3300005436 Unclassified 1263
65 Ga0070710_10665600 3300005437 Bacteria 731
66 Ga0070701_10408498 3300005438 Unclassified 862
67 Ga0070701_10755057 3300005438 Bacteria 659
68 Ga0070701_11011975 3300005438 Unclassified 580
69 Ga0070705_100481110 3300005440 Unclassified 938
70 Ga0070700_100093581 3300005441 Bacteria 1966
71 Ga0070700_100921326 3300005441 Unclassified 713
72 Ga0070694_100731260 3300005444 Unclassified 807
73 Ga0070708_101740941 3300005445 Unclassified 579
74 Ga0070678_100264901 3300005456 Bacteria 1447
75 Ga0070678_100359132 3300005456 Unclassified 1255
76 Ga0070678_100502596 3300005456 Bacteria 1070
77 Ga0070662_100916480 3300005457 Bacteria 748
78 Ga0070662_101414793 3300005457 Unclassified 599
79 Ga0070681_10002579 3300005458 Bacteria 16616
80 Ga0070681_10333627 3300005458 Bacteria 1426
81 Ga0070681_10662844 3300005458 Bacteria 958
82 Ga0070681_11840935 3300005458 Bacteria 532
83 Ga0068867_100108418 3300005459 Bacteria 2130
84 Ga0070685_10018134 3300005466 Bacteria 3779
85 Ga0070685_10231641 3300005466 Bacteria 1215
86 Ga0070707_101798124 3300005468 Unclassified 580
87 Ga0070698_100000102 3300005471 Bacteria 69797
88 Ga0070698_100052506 3300005471 Bacteria 4147
89 Ga0070698_100130481 3300005471 Bacteria 2469
90 Ga0070698_100283949 3300005471 Unclassified 1586
91 Ga0070698_100475443 3300005471 Unclassified 1186
92 Ga0070698_101588374 3300005471 Bacteria 606
93 Ga0070699_100391244 3300005518 Bacteria 1256
94 Ga0070699_100680130 3300005518 Unclassified 940
95 Ga0070679_100001620 3300005530 Bacteria 20259
96 Ga0070679_100007669 3300005530 Bacteria 10101
97 Ga0070679_100009868 3300005530 Bacteria 9034
98 Ga0070679_100034482 3300005530 Bacteria 5016
99 Ga0070679_100299267 3300005530 Bacteria 1559
100 Ga0070684_100004701 3300005535 Bacteria 10426
101 Ga0070684_100005038 3300005535 Bacteria 10089
102 Ga0070684_100304767 3300005535 Bacteria 1462
103 Ga0070684_100406601 3300005535 Bacteria 1255
104 Ga0070684_101720705 3300005535 Unclassified 592
105 Ga0070684_101985161 3300005535 Unclassified 549
106 Ga0068853_100237893 3300005539 Bacteria 1668
107 Ga0068853_100692624 3300005539 Unclassified 971
108 Ga0070672_100120584 3300005543 Unclassified 2146
109 Ga0070672_100434727 3300005543 Bacteria 1129
110 Ga0070686_100055047 3300005544 Bacteria 2547
111 Ga0070686_100522607 3300005544 Bacteria 924
112 Ga0070695_100680096 3300005545 Bacteria 815
113 Ga0070693_100521263 3300005547 Unclassified 846
114 Ga0070665_100026023 3300005548 Bacteria 5893
115 Ga0070665_100228867 3300005548 Bacteria 1859
116 Ga0070665_100699176 3300005548 Bacteria 1027
117 Ga0070704_100839755 3300005549 Bacteria 823
118 Ga0070704_101398185 3300005549 Unclassified 642
119 Ga0068855_100251767 3300005563 Bacteria 1970
120 Ga0068855_100344309 3300005563 Bacteria 1643
121 Ga0068855_100423708 3300005563 Bacteria 1455
122 Ga0068855_100519430 3300005563 Bacteria 1292
123 Ga0068855_100584326 3300005563 Bacteria 1206
124 Ga0070664_100131358 3300005564 Bacteria 2200
125 Ga0070664_100321139 3300005564 Unclassified 1403
126 Ga0070664_100461687 3300005564 Unclassified 1167
127 Ga0070664_100660789 3300005564 Bacteria 972
128 Ga0070664_101739539 3300005564 Unclassified 591
129 Ga0068857_100075391 3300005577 Bacteria 3007
130 Ga0068857_100537971 3300005577 Bacteria 1099
131 Ga0068857_100831045 3300005577 Unclassified 883
132 Ga0068854_100968337 3300005578 Bacteria 751
133 Ga0068856_100823816 3300005614 Unclassified 947
134 Ga0068856_101439796 3300005614 Bacteria 703
135 Ga0070702_100899743 3300005615 Unclassified 693
136 Ga0068859_100117965 3300005617 Bacteria 2719
137 Ga0068859_100221552 3300005617 Bacteria 1979
138 Ga0068859_100364809 3300005617 Unclassified 1539
139 Ga0068859_100421877 3300005617 Bacteria 1430
140 Ga0068859_100637365 3300005617 Bacteria 1158
141 Ga0068859_100691404 3300005617 Unclassified 1111
142 Ga0068859_100750012 3300005617 Bacteria 1065
143 Ga0068859_101169573 3300005617 Unclassified 847
144 Ga0068859_101223296 3300005617 Unclassified 827
145 Ga0068859_101916070 3300005617 Unclassified 654
146 Ga0068864_100289010 3300005618 Bacteria 1532
147 Ga0068864_100349137 3300005618 Unclassified 1395
148 Ga0068866_10227702 3300005718 Bacteria 1129
149 Ga0068866_11163819 3300005718 Unclassified 555
150 Ga0068861_100145721 3300005719 Bacteria 1938
151 Ga0068861_100200370 3300005719 Unclassified 1675
152 Ga0068870_10079263 3300005840 Unclassified 1811
153 Ga0068870_10203785 3300005840 Bacteria 1201
154 Ga0068863_101100945 3300005841 Unclassified 799
155 Ga0068858_101137617 3300005842 Bacteria 767
156 Ga0068858_101496573 3300005842 Bacteria 666
157 Ga0068860_100607751 3300005843 Bacteria 1099
158 Ga0068860_101771511 3300005843 Unclassified 639
159 Ga0068862_100030710 3300005844 Bacteria 4529
160 Ga0068862_100465034 3300005844 Unclassified 1195
161 Ga0068862_100637582 3300005844 Unclassified 1026
162 Ga0081455_10623644 3300005937 Unclassified 699
163 Ga0081539_10165929 3300005985 Unclassified 1048
164 Ga0070717_10316301 3300006028 Bacteria 1390
165 Ga0075432_10126253 3300006058 Unclassified 965
166 Ga0075432_10580917 3300006058 Unclassified 510
167 Ga0097621_100150299 3300006237 Unclassified 1997
168 Ga0097621_100232151 3300006237 Bacteria 1611
169 Ga0097621_100271499 3300006237 Bacteria 1490
170 Ga0068871_100217932 3300006358 Bacteria 1652
171 Ga0068871_100347926 3300006358 Bacteria 1310
172 Ga0075428_100035232 3300006844 Bacteria 5517
173 Ga0075428_100090404 3300006844 Bacteria 3339
174 Ga0075428_100097520 3300006844 Bacteria 3205
175 Ga0075428_100443270 3300006844 Unclassified 1391
176 Ga0075428_100544248 3300006844 Bacteria 1241
177 Ga0075430_100045571 3300006846 Bacteria 3704
178 Ga0075430_100492405 3300006846 Unclassified 1012
179 Ga0075430_100950875 3300006846 Bacteria 708
180 Ga0075431_100004708 3300006847 Bacteria 13398
181 Ga0075431_100007305 3300006847 Bacteria 11004
182 Ga0075431_100060821 3300006847 Bacteria 3898
183 Ga0075431_100220148 3300006847 Bacteria 1936
184 Ga0075431_100310858 3300006847 Bacteria 1591
185 Ga0075433_10951025 3300006852 Bacteria 749
186 Ga0075434_100054452 3300006871 Bacteria 3974
187 Ga0075434_100152211 3300006871 Bacteria 2333
188 Ga0075434_100184528 3300006871 Unclassified 2107
189 Ga0075434_100296518 3300006871 Unclassified 1637
190 Ga0075434_102253824 3300006871 Unclassified 548
191 Ga0075429_100007285 3300006880 Bacteria 9600
192 Ga0075429_100053562 3300006880 Bacteria 3510
193 Ga0075429_100270390 3300006880 Unclassified 1488
194 Ga0075429_100575554 3300006880 Bacteria 987
195 Ga0075429_101668062 3300006880 Unclassified 554
196 Ga0075429_101984432 3300006880 Bacteria 504
197 Ga0068865_100371940 3300006881 Unclassified 1163
198 Ga0097620_100117971 3300006931 Bacteria 2719
199 Ga0097620_100221546 3300006931 Bacteria 1979
200 Ga0097620_100364802 3300006931 Unclassified 1539
201 Ga0097620_100421871 3300006931 Bacteria 1430
202 Ga0097620_100637335 3300006931 Bacteria 1158
203 Ga0097620_100691398 3300006931 Unclassified 1111
204 Ga0097620_100749922 3300006931 Bacteria 1065
205 Ga0097620_101169433 3300006931 Unclassified 847
206 Ga0097620_101223589 3300006931 Unclassified 827
207 Ga0097620_101916108 3300006931 Unclassified 654
208 Ga0075435_100765820 3300007076 Unclassified 840
209 Ga0105240_10007516 3300009093 Bacteria 15813
210 Ga0105240_10043019 3300009093 Bacteria 5752
211 Ga0105240_10372722 3300009093 Bacteria 1614
212 Ga0111539_10001437 3300009094 Bacteria 31784
213 Ga0111539_10006692 3300009094 Bacteria 14840
214 Ga0111539_10041657 3300009094 Bacteria 5519
215 Ga0111539_10059388 3300009094 Bacteria 4535
216 Ga0111539_10154231 3300009094 Bacteria 2688
217 Ga0111539_11223786 3300009094 Unclassified 872
218 Ga0105245_10078151 3300009098 Unclassified 3019
219 Ga0105245_10093606 3300009098 Bacteria 2769
220 Ga0105245_11510044 3300009098 Unclassified 723
221 Ga0105245_12215851 3300009098 Unclassified 603
222 Ga0114129_10064361 3300009147 Bacteria 5117
223 Ga0114129_10305208 3300009147 Bacteria 2120
224 Ga0114129_10322464 3300009147 Bacteria 2053
225 Ga0114129_10499696 3300009147 Unclassified 1589
226 Ga0114129_11459679 3300009147 Bacteria 842
227 Ga0114129_12874943 3300009147 Bacteria 570
228 Ga0105243_10045346 3300009148 Bacteria 3455
229 Ga0105243_12690929 3300009148 Unclassified 538
230 Ga0105241_10223127 3300009174 Bacteria 1585
231 Ga0105241_10268179 3300009174 Unclassified 1453
232 Ga0105241_11456751 3300009174 Bacteria 657
233 Ga0105242_10095413 3300009176 Bacteria 2511
234 Ga0105242_10136669 3300009176 Unclassified 2122
235 Ga0105242_10249463 3300009176 Bacteria 1599
236 Ga0105242_10263534 3300009176 Bacteria 1558
237 Ga0105242_10435351 3300009176 Unclassified 1232
238 Ga0105242_10671576 3300009176 Bacteria 1010
239 Ga0105242_11018457 3300009176 Bacteria 837
240 Ga0105248_10086536 3300009177 Bacteria 3526
241 Ga0105248_10105583 3300009177 Unclassified 3176
242 Ga0105248_10255985 3300009177 Unclassified 1971
243 Ga0105248_10346513 3300009177 Bacteria 1672
244 Ga0105248_10404601 3300009177 Unclassified 1537
245 Ga0105248_10493939 3300009177 Bacteria 1380
246 Ga0105248_10953504 3300009177 Unclassified 969
247 Ga0105248_11715041 3300009177 Bacteria 712
248 Ga0105237_10470619 3300009545 Bacteria 1263
249 Ga0105237_12361171 3300009545 Bacteria 542
250 Ga0105237_12763495 3300009545 Unclassified 502
251 Ga0105238_10217244 3300009551 Bacteria 1888
252 Ga0105238_10242081 3300009551 Bacteria 1782
253 Ga0105238_10696230 3300009551 Bacteria 1028
254 Ga0105249_10007383 3300009553 Bacteria 9588
255 Ga0105249_10248886 3300009553 Bacteria 1761
256 Ga0105249_10861330 3300009553 Unclassified 972
257 Ga0105249_10900541 3300009553 Bacteria 952
258 Ga0105249_13444243 3300009553 Unclassified 509
259 Ga0105246_10718304 3300011119 Unclassified 878
260 Ga0105246_11110257 3300011119 Bacteria 723
261 Ga0157373_10043300 3300013100 Bacteria 3216
262 Ga0157373_10055541 3300013100 Bacteria 2813
263 Ga0157370_10022307 3300013104 Bacteria 6301
264 Ga0157370_10100317 3300013104 Bacteria 2712
265 Ga0157370_10434491 3300013104 Bacteria 1207
266 Ga0157370_11182983 3300013104 Unclassified 690
267 Ga0157370_11450301 3300013104 Bacteria 617
268 Ga0157370_11626042 3300013104 Bacteria 580
269 Ga0157369_10017666 3300013105 Bacteria 8014
270 Ga0157369_10052000 3300013105 Bacteria 4433
271 Ga0157369_10129307 3300013105 Bacteria 2677
272 Ga0157369_10440455 3300013105 Bacteria 1350
273 Ga0157369_10474654 3300013105 Bacteria 1294
274 Ga0157369_10500314 3300013105 Unclassified 1257
275 Ga0157369_10638215 3300013105 Unclassified 1099
276 Ga0157369_10728530 3300013105 Unclassified 1021
277 Ga0157369_11118961 3300013105 Unclassified 805
278 Ga0157374_10091983 3300013296 Bacteria 2893
279 Ga0157374_10818913 3300013296 Unclassified 947
280 Ga0157374_11008194 3300013296 Unclassified 852
281 Ga0157378_10093900 3300013297 Unclassified 2731
282 Ga0157378_10186508 3300013297 Unclassified 1954
283 Ga0157378_10472322 3300013297 Bacteria 1248
284 Ga0163162_10270339 3300013306 Unclassified 1831
285 Ga0163162_12899035 3300013306 Bacteria 552
286 Ga0157372_10004740 3300013307 Bacteria 14443
287 Ga0157372_10073290 3300013307 Bacteria 3860
288 Ga0157372_10102479 3300013307 Bacteria 3270
289 Ga0157372_10127129 3300013307 Bacteria 2931
290 Ga0157372_10503168 3300013307 Unclassified 1413
291 Ga0157372_10999951 3300013307 Unclassified 969
292 Ga0157372_11163705 3300013307 Bacteria 892
293 Ga0157372_12842839 3300013307 Unclassified 555
294 Ga0157375_10054644 3300013308 Bacteria 3934
295 Ga0157375_10474002 3300013308 Bacteria 1417
296 Ga0157375_10565132 3300013308 Unclassified 1298
297 Ga0157375_12482159 3300013308 Unclassified 619
298 Ga0163163_10036366 3300014325 Bacteria 4782
299 Ga0163163_10861567 3300014325 Bacteria 969
300 Ga0157380_10321113 3300014326 Bacteria 1435
301 Ga0157377_10067637 3300014745 Bacteria 2057
302 Ga0157377_10244787 3300014745 Bacteria 1159
303 Ga0157379_12125480 3300014968 Bacteria 557
304 Ga0157376_10324307 3300014969 Bacteria 1465
305 Ga0157376_10623173 3300014969 Unclassified 1076
306 Ga0163161_10637222 3300017792 Unclassified 882
307 Ga0197907_10500375 3300020069 Bacteria 1942
308 Ga0206356_10789269 3300020070 Bacteria 1974
309 Ga0206354_10690413 3300020081 Unclassified 1238
310 Ga0213876_10018752 3300021384 Bacteria 3654
311 Ga0207666_1010332 3300025271 Bacteria 1276
312 Ga0207697_10374140 3300025315 Unclassified 633
313 Ga0207642_10322187 3300025899 Unclassified 903
314 Ga0207642_10571181 3300025899 Unclassified 701
315 Ga0207688_10843212 3300025901 Bacteria 581
316 Ga0207645_10255799 3300025907 Bacteria 1159
317 Ga0207645_10360539 3300025907 Bacteria 974
318 Ga0207643_10178202 3300025908 Bacteria 1285
319 Ga0207705_10743026 3300025909 Bacteria 762
320 Ga0207654_10447744 3300025911 Bacteria 905
321 Ga0207707_10000871 3300025912 Bacteria 29492
322 Ga0207707_10026252 3300025912 Bacteria 5092
323 Ga0207707_10035433 3300025912 Unclassified 4365
324 Ga0207707_10100170 3300025912 Bacteria 2532
325 Ga0207707_10865799 3300025912 Bacteria 749
326 Ga0207695_10003588 3300025913 Bacteria 21709
327 Ga0207695_10009836 3300025913 Bacteria 11751
328 Ga0207695_10013339 3300025913 Bacteria 9807
329 Ga0207695_10037391 3300025913 Bacteria 5238
330 Ga0207671_10103322 3300025914 Bacteria 2161
331 Ga0207660_10116083 3300025917 Unclassified 2021
332 Ga0207660_10123169 3300025917 Bacteria 1966
333 Ga0207660_10348235 3300025917 Bacteria 1187
334 Ga0207660_11569452 3300025917 Bacteria 531
335 Ga0207662_10027130 3300025918 Bacteria 3306
336 Ga0207662_10028433 3300025918 Bacteria 3232
337 Ga0207662_10175893 3300025918 Bacteria 1375
338 Ga0207657_10475331 3300025919 Unclassified 980
339 Ga0207649_10172359 3300025920 Bacteria 1508
340 Ga0207652_10003451 3300025921 Bacteria 13038
341 Ga0207652_10011460 3300025921 Bacteria 7147
342 Ga0207652_10018884 3300025921 Bacteria 5659
343 Ga0207652_10041776 3300025921 Unclassified 3900
344 Ga0207652_10142502 3300025921 Bacteria 2144
345 Ga0207652_10199227 3300025921 Bacteria 1802
346 Ga0207681_10045529 3300025923 Unclassified 2946
347 Ga0207681_10202466 3300025923 Bacteria 1525
348 Ga0207681_10574048 3300025923 Unclassified 930
349 Ga0207694_10114449 3300025924 Bacteria 2148
350 Ga0207650_10273203 3300025925 Unclassified 1374
351 Ga0207650_10314075 3300025925 Bacteria 1282
352 Ga0207659_10088088 3300025926 Bacteria 2312
353 Ga0207687_10337842 3300025927 Bacteria 1224
354 Ga0207700_10295407 3300025928 Unclassified 1397
355 Ga0207700_10852667 3300025928 Unclassified 815
356 Ga0207664_10300313 3300025929 Unclassified 1412
357 Ga0207706_10541742 3300025933 Bacteria 1002
358 Ga0207686_10233256 3300025934 Unclassified 1335
359 Ga0207709_10691013 3300025935 Unclassified 816
360 Ga0207709_11615103 3300025935 Unclassified 539
361 Ga0207670_10184670 3300025936 Bacteria 1573
362 Ga0207670_10812921 3300025936 Unclassified 779
363 Ga0207704_10049386 3300025938 Bacteria 2531
364 Ga0207691_10071408 3300025940 Unclassified 3133
365 Ga0207691_10085513 3300025940 Bacteria 2830
366 Ga0207691_10132744 3300025940 Bacteria 2198
367 Ga0207691_10464672 3300025940 Bacteria 1076
368 Ga0207711_10222161 3300025941 Bacteria 1728
369 Ga0207711_10301795 3300025941 Unclassified 1477
370 Ga0207711_10425349 3300025941 Bacteria 1235
371 Ga0207711_10431295 3300025941 Unclassified 1226
372 Ga0207711_10593627 3300025941 Bacteria 1033
373 Ga0207689_10041368 3300025942 Bacteria 3813
374 Ga0207689_10506877 3300025942 Unclassified 1011
375 Ga0207661_10011556 3300025944 Bacteria 6403
376 Ga0207661_10021420 3300025944 Bacteria 4843
377 Ga0207661_10138446 3300025944 Bacteria 2093
378 Ga0207661_10413030 3300025944 Bacteria 1225
379 Ga0207679_10172403 3300025945 Bacteria 1782
380 Ga0207679_10307162 3300025945 Bacteria 1369
381 Ga0207679_10410467 3300025945 Unclassified 1193
382 Ga0207679_10518871 3300025945 Unclassified 1065
383 Ga0207679_10669423 3300025945 Unclassified 940
384 Ga0207679_10775662 3300025945 Bacteria 873
385 Ga0207679_11849303 3300025945 Bacteria 551
386 Ga0207667_10215272 3300025949 Bacteria 1969
387 Ga0207667_10272428 3300025949 Bacteria 1730
388 Ga0207667_10458674 3300025949 Bacteria 1295
389 Ga0207667_10519887 3300025949 Bacteria 1206
390 Ga0207667_10792798 3300025949 Bacteria 945
391 Ga0207651_10303134 3300025960 Bacteria 1329
392 Ga0207651_10525810 3300025960 Bacteria 1026
393 Ga0207712_10150304 3300025961 Unclassified 1798
394 Ga0207712_10364117 3300025961 Unclassified 1205
395 Ga0207668_10093670 3300025972 Unclassified 2214
396 Ga0207668_11816302 3300025972 Bacteria 550
397 Ga0207658_11167530 3300025986 Unclassified 704
398 Ga0207639_10165693 3300026041 Bacteria 1867
399 Ga0207708_10051829 3300026075 Bacteria 3125
400 Ga0207708_11293000 3300026075 Unclassified 639
401 Ga0207702_10495562 3300026078 Unclassified 1190
402 Ga0207702_10723512 3300026078 Bacteria 982
403 Ga0207702_10975233 3300026078 Bacteria 841
404 Ga0207648_10184059 3300026089 Bacteria 1849
405 Ga0207676_10167487 3300026095 Bacteria 1911
406 Ga0207676_10514292 3300026095 Bacteria 1139
407 Ga0207674_10076152 3300026116 Bacteria 3364
408 Ga0207674_10951914 3300026116 Unclassified 827
409 Ga0207674_11123499 3300026116 Bacteria 755
410 Ga0207675_100245453 3300026118 Bacteria 1731
411 Ga0207675_100250022 3300026118 Bacteria 1716
412 Ga0207683_10270923 3300026121 Bacteria 1551
413 Ga0207683_10291098 3300026121 Bacteria 1493
414 Ga0207698_10276127 3300026142 Bacteria 1552
415 Ga0209999_1074439 3300027543 Unclassified 652
416 Ga0209971_1074137 3300027682 Unclassified 827
417 Ga0209966_1067838 3300027695 Bacteria 778
418 Ga0207428_10063816 3300027907 Unclassified 2909
419 Ga0207428_10071215 3300027907 Unclassified 2731
420 Ga0207428_10220266 3300027907 Unclassified 1423
421 Ga0268266_10188620 3300028379 Bacteria 1881
422 Ga0268266_10355897 3300028379 Unclassified 1377
423 Ga0268266_10731035 3300028379 Bacteria 955
424 Ga0268265_10101360 3300028380 Bacteria 2326
425 Ga0268265_10114331 3300028380 Bacteria 2210
426 Ga0268265_10615687 3300028380 Unclassified 1039
427 Ga0268265_10760443 3300028380 Unclassified 941
428 Ga0268264_10650063 3300028381 Bacteria 1043
429 Ga0316178_1099776 3300030735 Unclassified 631
430 Ga0265325_10433590 3300031241 Unclassified 573
431 Ga0265339_10284770 3300031249 Unclassified 791
432 Ga0307408_100021263 3300031548 Bacteria 4389
433 Ga0307408_100055615 3300031548 Bacteria 2866
434 Ga0307408_100593519 3300031548 Bacteria 983
435 Ga0316579_10002413 3300031691 Bacteria 7050
436 Ga0265314_10045702 3300031711 Unclassified 3094
437 Ga0316576_10058284 3300031727 Unclassified 2825
438 Ga0316576_10209944 3300031727 Bacteria 1466
439 Ga0316576_10255839 3300031727 Unclassified 1314
440 Ga0316578_10000514 3300031728 Bacteria 13142
441 Ga0307405_10121332 3300031731 Bacteria 1789
442 Ga0307405_10253001 3300031731 Unclassified 1312
443 Ga0307405_11182659 3300031731 Bacteria 661
444 Ga0316577_10000004 3300031733 Bacteria 48694
445 Ga0316577_10000022 3300031733 Bacteria 34957
446 Ga0307413_10004141 3300031824 Bacteria 6255
447 Ga0307413_10488046 3300031824 Bacteria 986
448 Ga0307410_10168401 3300031852 Bacteria 1648
449 Ga0307410_10731653 3300031852 Bacteria 836
450 Ga0307406_10082523 3300031901 Unclassified 2141
451 Ga0307406_10354074 3300031901 Bacteria 1148
452 Ga0307407_10103388 3300031903 Unclassified 1773
453 Ga0307407_10228973 3300031903 Bacteria 1261
454 Ga0307407_10345574 3300031903 Bacteria 1052
455 Ga0307407_10374347 3300031903 Unclassified 1015
456 Ga0307407_10448320 3300031903 Unclassified 936
457 Ga0307412_10063171 3300031911 Bacteria 2497
458 Ga0307409_100037641 3300031995 Bacteria 3568
459 Ga0307409_100314723 3300031995 Bacteria 1462
460 Ga0307409_100552675 3300031995 Unclassified 1130
461 Ga0307409_102194375 3300031995 Bacteria 582
462 Ga0307416_100013348 3300032002 Bacteria 5579
463 Ga0307416_100676595 3300032002 Bacteria 1119
464 Ga0307416_100680201 3300032002 Bacteria 1116
465 Ga0307414_10098725 3300032004 Bacteria 2191
466 Ga0307414_11085158 3300032004 Bacteria 739
467 Ga0307414_12188507 3300032004 Unclassified 516
468 Ga0307411_10004091 3300032005 Bacteria 6914
469 Ga0307411_10057803 3300032005 Unclassified 2564
470 Ga0307411_10091473 3300032005 Unclassified 2125
471 Ga0307411_10147193 3300032005 Bacteria 1745
472 Ga0307411_10501547 3300032005 Bacteria 1026
473 Ga0307415_100195364 3300032126 Bacteria 1600
474 Ga0307415_100315351 3300032126 Bacteria 1301
475 Ga0307415_100651541 3300032126 Unclassified 944
476 Ga0316585_10222696 3300032137 Unclassified 624
477 Ga0373938_0121980 3300034957 Bacteria 673
478 Ga0373944_0203876 3300035089 Bacteria 717
479 Ga0373952_0097030 3300035092 Unclassified 773
480 Ga0373945_0409871 3300035116 Unclassified 595
481 Ga0373960_0162018 3300035121 Bacteria 771
482 Ga0373943_0034041 3300035170 Unclassified 2430
483 Ga0373946_0149056 3300035171 Unclassified 1090
484 Ga0316574_0563288 3300035398 Unclassified 706
485 Ga0373931_0022181 3300035691 Bacteria 3193
486 Ga0373935_0279591 3300035692 Unclassified 1175
487 Ga0373927_0008250 3300035695 Bacteria 7012
488 Ga0373947_0096505 3300035725 Bacteria 1851
489 Ga0316582_0956809 3300036647 Unclassified 585
490 Ga0316584_0006009 3300036712 Bacteria 8199
491 Ga0373925_0567988 3300037068 Bacteria 933
492 Ga0395899_0041297 3300037312 Bacteria 3447
493 Ga0395900_0111891 3300037418 Bacteria 2804
494 Ga0395898_0560285 3300037466 Bacteria 1085
495 Ga0395905_0192256 3300037471 Bacteria 1914
496 Ga0395901_0023774 3300038443 Bacteria 6283
497 Ga0436365_0301783 3300039437 Bacteria 10292
498 Ga0436365_1791692 3300039437 Bacteria 2181
499 Ga0436365_1827484 3300039437 Unclassified 548
500 Ga0436362_0771551 3300039453 Bacteria 1169
501 Ga0451806_207551 3300041462 Bacteria 793
502 Ga0451853_3605816 3300041512 Bacteria 563
503 Ga0439449_0083566 3300042007 Bacteria 1178
504 Ga0439462_0152257 3300042015 Bacteria 650
505 Ga0439435_0196465 3300042436 Bacteria 664
506 Ga0451577_0366314 3300042876 Bacteria 1307
507 Ga0466963_0736434 3300044694 Bacteria 695
508 Ga0466963_1334253 3300044694 Bacteria 503
509 Ga0453684_0364050 3300044712 Bacteria 1627
510 Ga0466957_0113082 3300044842 Bacteria 1724
511 Ga0466959_0690786 3300045049 Bacteria 684
512 Ga0451576_0225036 3300045051 Bacteria 1959
513 Ga0451576_1608037 3300045051 Unclassified 674
514 Ga0466958_1077659 3300045836 Bacteria 524
515 Ga0466967_1017623 3300045976 Unclassified 825
516 Ga0495629_0289511 3300046459 Bacteria 1123
517 Ga0495651_0173401 3300046462 Bacteria 1534
518 Ga0495653_0198950 3300046463 Bacteria 1361
519 Ga0495580_0453295 3300046472 Unclassified 860
520 Ga0495582_0551394 3300046473 Bacteria 667
521 Ga0495639_0158371 3300046475 Unclassified 1095
522 Ga0495639_0284242 3300046475 Bacteria 823
523 Ga0495594_0013342 3300046499 Unclassified 4289
524 Ga0495594_0063578 3300046499 Bacteria 2045
525 Ga0495594_0167053 3300046499 Bacteria 1251
526 Ga0495594_0506339 3300046499 Unclassified 686
527 Ga0495630_0527451 3300046517 Unclassified 905
528 Ga0495652_0394005 3300046529 Unclassified 982
529 Ga0495665_0051955 3300046531 Unclassified 2170
530 Ga0495665_0492019 3300046531 Bacteria 618
531 Ga0495640_0734580 3300046533 Bacteria 591
532 Ga0495586_0052403 3300046535 Bacteria 2209
533 Ga0495586_0126114 3300046535 Bacteria 1432
534 Ga0495587_0436662 3300046536 Unclassified 726
535 Ga0495645_0108759 3300046543 Bacteria 1963
536 Ga0495635_0186801 3300046663 Bacteria 1408
537 Ga0495659_0279854 3300046664 Bacteria 701
538 Ga0495588_0170819 3300046674 Bacteria 1150
539 Ga0495658_0292847 3300046683 Bacteria 1029
540 Ga0495613_0863938 3300046689 Unclassified 587
541 Ga0495604_0066404 3300047317 Bacteria 2744
542 Ga0495675_0696378 3300047444 Unclassified 569
543 Ga0495684_0136189 3300047471 Bacteria 1843
544 Ga0495593_0139833 3300047673 Unclassified 1227
545 Ga0496101_0666534 3300048904 Bacteria 822
546 Ga0496104_0316491 3300048907 Bacteria 1474
547 Ga0496109_0171201 3300048912 Bacteria 2037
548 Ga0496109_1320765 3300048912 Unclassified 657
549 Ga0496110_0114792 3300048913 Bacteria 2424
550 Ga0496110_0507224 3300048913 Bacteria 1098
551 Ga0496112_0001979 3300048915 Bacteria 16190
552 Ga0496112_0016024 3300048915 Bacteria 7008
553 Ga0501291_163274 3300049514 Unclassified 510
554 Ga0501292_068905 3300049515 Unclassified 655
555 Ga0501298_040242 3300049521 Unclassified 946
556 Ga0501299_002219 3300049522 Unclassified 2666
557 Ga0501299_003514 3300049522 Bacteria 2275
558 Ga0501299_027743 3300049522 Bacteria 1076
559 Ga0501299_109002 3300049522 Bacteria 653
560 Ga0501303_011061 3300049526 Bacteria 854
561 Ga0501031_0438388 3300049568 Unclassified 844
562 Ga0501033_0059379 3300049570 Bacteria 2824
563 Ga0501033_0100070 3300049570 Bacteria 2116
564 Ga0501033_0760248 3300049570 Unclassified 657
565 Ga0501034_0015110 3300049571 Bacteria 7935
566 Ga0501034_0445668 3300049571 Bacteria 1213
567 Ga0501036_0120910 3300049572 Bacteria 2212
568 Ga0501036_0287365 3300049572 Unclassified 1376
569 Ga0501037_0339776 3300049573 Bacteria 1037
570 Ga0501037_0565924 3300049573 Unclassified 766
571 Ga0501038_0017646 3300049574 Bacteria 6451
572 Ga0501039_0461282 3300049575 Unclassified 998
573 Ga0501040_1333048 3300049576 Unclassified 521
574 Ga0501042_1172402 3300049578 Unclassified 560
575 Ga0501043_0226759 3300049579 Bacteria 1444
576 Ga0501047_0160477 3300049581 Unclassified 2120
577 Ga0501068_0528433 3300049584 Unclassified 766
578 Ga0501070_0028787 3300049586 Bacteria 4658
579 Ga0501072_0123263 3300049588 Unclassified 2065
580 Ga0501073_0062440 3300049589 Bacteria 2599
581 Ga0501075_0012997 3300049591 Bacteria 5933
582 Ga0501075_0726640 3300049591 Unclassified 756
583 Ga0501076_0155906 3300049592 Bacteria 1859
584 Ga0501076_0343291 3300049592 Unclassified 1226
585 Ga0501076_1406431 3300049592 Bacteria 573
586 Ga0501201_035843 3300049651 Unclassified 581
587 Ga0501207_109568 3300049654 Unclassified 563
588 Ga0501209_096975 3300049656 Bacteria 862
589 Ga0501216_100489 3300049660 Unclassified 637
590 Ga0501217_077448 3300049661 Bacteria 915
591 Ga0501228_012116 3300049666 Bacteria 883
592 Ga0501249_072660 3300049679 Bacteria 804
593 Ga0501252_094641 3300049682 Unclassified 510
594 Ga0501257_222369 3300049686 Bacteria 551
595 Ga0501260_055977 3300049689 Unclassified 506
596 Ga0501225_0071895 3300049705 Bacteria 984
597 Ga0501079_0240915 3300049741 Unclassified 1413
598 Ga0501079_1485229 3300049741 Bacteria 533
599 Ga0501081_0152631 3300049743 Bacteria 1660
600 Ga0501268_018537 3300049765 Unclassified 1171
601 Ga0501268_094190 3300049765 Unclassified 634
602 Ga0501272_052089 3300049769 Unclassified 570
603 Ga0501273_068973 3300049770 Bacteria 570
604 Ga0501283_006309 3300049779 Unclassified 1657
605 Ga0501035_0734076 3300049822 Unclassified 794
606 Ga0501212_021163 3300049851 Bacteria 1007
607 Ga0501212_119814 3300049851 Bacteria 510
608 nmdc:mga05p37_291391_c1 3300050507 Unclassified 1943
609 nmdc:mga05p37_300308_c1 3300050507 Bacteria 1908
610 nmdc:mga05p37_380769_c1 3300050507 Bacteria 1653
611 nmdc:mga05p37_453922_c1 3300050507 Bacteria 1483
612 nmdc:mga05p37_791511_c1 3300050507 Bacteria 1039
613 nmdc:mga09592_151844_c1 3300050508 Bacteria 1998
614 nmdc:mga09592_1734143_c1 3300050508 Bacteria 503
615 nmdc:mga09592_21724_c1 3300050508 Bacteria 5291
616 nmdc:mga09592_634832_c1 3300050508 Bacteria 913
617 nmdc:mga09592_673_c1 3300050508 Bacteria 26125
618 nmdc:mga0qj67_2344_c1 3300050509 Bacteria 13478
619 nmdc:mga0qj67_43680_c1 3300050509 Bacteria 3530
620 nmdc:mga0qj67_453861_c1 3300050509 Unclassified 1032
621 nmdc:mga0qj67_57385_c1 3300050509 Bacteria 3086
622 nmdc:mga06r32_1340_c1 3300050510 Bacteria 22226
623 nmdc:mga06r32_447880_c1 3300050510 Bacteria 1271
624 nmdc:mga06r32_786083_c1 3300050510 Bacteria 913
625 nmdc:mga06r32_805114_c1 3300050510 Bacteria 900
626 nmdc:mga06r32_828937_c1 3300050510 Unclassified 884
627 nmdc:mga08y16_14947_c1 3300050511 Bacteria 8164
628 nmdc:mga08y16_151791_c1 3300050511 Bacteria 2407
629 nmdc:mga08y16_320165_c1 3300050511 Unclassified 1597
630 nmdc:mga08y16_44959_c1 3300050511 Bacteria 4627
631 nmdc:mga08y16_766337_c1 3300050511 Bacteria 960
632 nmdc:mga08y16_97666_c1 3300050511 Unclassified 3059
633 nmdc:mga0n895_1069579_c1 3300050512 Bacteria 785
634 nmdc:mga0n895_161642_c1 3300050512 Bacteria 2271
635 nmdc:mga0n895_174835_c1 3300050512 Unclassified 2178
636 nmdc:mga0n895_6017_c1 3300050512 Bacteria 10222
637 nmdc:mga0n895_82384_c1 3300050512 Unclassified 3207
638 nmdc:mga0rr50_576631_c1 3300050513 Bacteria 958
639 nmdc:mga0rr50_906695_c1 3300050513 Bacteria 751
640 nmdc:mga08x19_1496_c1 3300050514 Bacteria 14475
641 nmdc:mga08x19_444838_c1 3300050514 Bacteria 912
642 nmdc:mga0a205_690320_c1 3300050515 Bacteria 871
643 Ga0495601_0411899 3300053077 Unclassified 876
644 Ga0501084_1361146 3300054114 Bacteria 595
645 Ga0590075_151500 3300059424 Unclassified 611
646 Ga0590077_138908 3300059426 Unclassified 579
647 Ga0070681_10016236
648 Ga0065714_10369941
649 Ga0065712_10057801
650 Ga0065715_10306963
651 Ga0065707_10100241
652 Ga0070658_10310446
653 Ga0070658_10493550
654 Ga0070676_10082302
655 Ga0070676_10258006
656 Ga0070676_10356590
657 Ga0070676_10439898
658 Ga0070683_100031059
659 Ga0070683_100056610
660 Ga0070683_100059839
661 Ga0070683_100070691
662 Ga0070683_100952588
663 Ga0070690_100013708
664 Ga0070690_100459131
665 Ga0070670_100305781
666 Ga0070670_100353470
667 Ga0070670_100379730
668 Ga0070670_101107506
669 Ga0068869_100197752
670 Ga0070666_10266570
671 Ga0070666_10477954
672 Ga0070666_11381979
673 Ga0070666_11433698
674 Ga0070680_100000415
675 Ga0070680_100006790
676 Ga0070680_100086915
677 Ga0070680_100149819
678 Ga0070682_100155642
679 Ga0068868_101655622
680 Ga0070689_100021572
681 Ga0070689_100031402
682 Ga0070689_100041615
683 Ga0070689_101598846
684 Ga0070691_10160729
685 Ga0070687_100011154
686 Ga0070687_100332918
687 Ga0070661_100423523
688 Ga0070668_100732984
689 Ga0070669_100028721
690 Ga0070669_100153982
691 Ga0070669_101325725
692 Ga0070675_100068942
693 Ga0070675_100128407
694 Ga0070674_100356990
695 Ga0070674_101016399
696 Ga0070674_101744689
697 Ga0070673_100052623
698 Ga0070673_100228244
699 Ga0070673_100577250
700 Ga0070673_100582251
701 Ga0070688_100002067
702 Ga0070688_100134814
703 Ga0070688_100642197
704 Ga0070688_100762159
705 Ga0070667_100357132
706 Ga0070667_100603178
707 Ga0070667_101135747
708 Ga0070667_101400474
709 Ga0070714_100271947
710 Ga0070713_100412667
711 Ga0070710_10665600
712 Ga0070701_10408498
713 Ga0070701_10755057
714 Ga0070701_11011975
715 Ga0070705_100481110
716 Ga0070700_100093581
717 Ga0070700_100921326
718 Ga0070694_100731260
719 Ga0070708_101740941
720 Ga0070678_100264901
721 Ga0070678_100359132
722 Ga0070678_100502596
723 Ga0070662_100916480
724 Ga0070662_101414793
725 Ga0070681_10002579
726 Ga0070681_10333627
727 Ga0070681_10662844
728 Ga0070681_11840935
729 Ga0068867_100108418
730 Ga0070685_10018134
731 Ga0070685_10231641
732 Ga0070707_101798124
733 Ga0070698_100000102
734 Ga0070698_100052506
735 Ga0070698_100130481
736 Ga0070698_100283949
737 Ga0070698_100475443
738 Ga0070698_101588374
739 Ga0070699_100391244
740 Ga0070699_100680130
741 Ga0070679_100001620
742 Ga0070679_100007669
743 Ga0070679_100009868
744 Ga0070679_100034482
745 Ga0070679_100299267
746 Ga0070684_100004701
747 Ga0070684_100005038
748 Ga0070684_100304767
749 Ga0070684_100406601
750 Ga0070684_101720705
751 Ga0070684_101985161
752 Ga0068853_100237893
753 Ga0068853_100692624
754 Ga0070672_100120584
755 Ga0070672_100434727
756 Ga0070686_100055047
757 Ga0070686_100522607
758 Ga0070695_100680096
759 Ga0070693_100521263
760 Ga0070665_100026023
761 Ga0070665_100228867
762 Ga0070665_100699176
763 Ga0070704_100839755
764 Ga0070704_101398185
765 Ga0068855_100251767
766 Ga0068855_100344309
767 Ga0068855_100423708
768 Ga0068855_100519430
769 Ga0068855_100584326
770 Ga0070664_100131358
771 Ga0070664_100321139
772 Ga0070664_100461687
773 Ga0070664_100660789
774 Ga0070664_101739539
775 Ga0068857_100075391
776 Ga0068857_100537971
777 Ga0068857_100831045
778 Ga0068854_100968337
779 Ga0068856_100823816
780 Ga0068856_101439796
781 Ga0070702_100899743
782 Ga0068859_100117965
783 Ga0068859_100221552
784 Ga0068859_100364809
785 Ga0068859_100421877
786 Ga0068859_100637365
787 Ga0068859_100691404
788 Ga0068859_100750012
789 Ga0068859_101169573
790 Ga0068859_101223296
791 Ga0068859_101916070
792 Ga0068864_100289010
793 Ga0068864_100349137
794 Ga0068866_10227702
795 Ga0068866_11163819
796 Ga0068861_100145721
797 Ga0068861_100200370
798 Ga0068870_10079263
799 Ga0068870_10203785
800 Ga0068863_101100945
801 Ga0068858_101137617
802 Ga0068858_101496573
803 Ga0068860_100607751
804 Ga0068860_101771511
805 Ga0068862_100030710
806 Ga0068862_100465034
807 Ga0068862_100637582
808 Ga0081455_10623644
809 Ga0081539_10165929
810 Ga0070717_10316301
811 Ga0075432_10126253
812 Ga0075432_10580917
813 Ga0097621_100150299
814 Ga0097621_100232151
815 Ga0097621_100271499
816 Ga0068871_100217932
817 Ga0068871_100347926
818 Ga0075428_100035232
819 Ga0075428_100090404
820 Ga0075428_100097520
821 Ga0075428_100443270
822 Ga0075428_100544248
823 Ga0075430_100045571
824 Ga0075430_100492405
825 Ga0075430_100950875
826 Ga0075431_100004708
827 Ga0075431_100007305
828 Ga0075431_100060821
829 Ga0075431_100220148
830 Ga0075431_100310858
831 Ga0075433_10951025
832 Ga0075434_100054452
833 Ga0075434_100152211
834 Ga0075434_100184528
835 Ga0075434_100296518
836 Ga0075434_102253824
837 Ga0075429_100007285
838 Ga0075429_100053562
839 Ga0075429_100270390
840 Ga0075429_100575554
841 Ga0075429_101668062
842 Ga0075429_101984432
843 Ga0068865_100371940
844 Ga0097620_100117971
845 Ga0097620_100221546
846 Ga0097620_100364802
847 Ga0097620_100421871
848 Ga0097620_100637335
849 Ga0097620_100691398
850 Ga0097620_100749922
851 Ga0097620_101169433
852 Ga0097620_101223589
853 Ga0097620_101916108
854 Ga0075435_100765820
855 Ga0105240_10007516
856 Ga0105240_10043019
857 Ga0105240_10372722
858 Ga0111539_10001437
859 Ga0111539_10006692
860 Ga0111539_10041657
861 Ga0111539_10059388
862 Ga0111539_10154231
863 Ga0111539_11223786
864 Ga0105245_10078151
865 Ga0105245_10093606
866 Ga0105245_11510044
867 Ga0105245_12215851
868 Ga0114129_10064361
869 Ga0114129_10305208
870 Ga0114129_10322464
871 Ga0114129_10499696
872 Ga0114129_11459679
873 Ga0114129_12874943
874 Ga0105243_10045346
875 Ga0105243_12690929
876 Ga0105241_10223127
877 Ga0105241_10268179
878 Ga0105241_11456751
879 Ga0105242_10095413
880 Ga0105242_10136669
881 Ga0105242_10249463
882 Ga0105242_10263534
883 Ga0105242_10435351
884 Ga0105242_10671576
885 Ga0105242_11018457
886 Ga0105248_10086536
887 Ga0105248_10105583
888 Ga0105248_10255985
889 Ga0105248_10346513
890 Ga0105248_10404601
891 Ga0105248_10493939
892 Ga0105248_10953504
893 Ga0105248_11715041
894 Ga0105237_10470619
895 Ga0105237_12361171
896 Ga0105237_12763495
897 Ga0105238_10217244
898 Ga0105238_10242081
899 Ga0105238_10696230
900 Ga0105249_10007383
901 Ga0105249_10248886
902 Ga0105249_10861330
903 Ga0105249_10900541
904 Ga0105249_13444243
905 Ga0105246_10718304
906 Ga0105246_11110257
907 Ga0157373_10043300
908 Ga0157373_10055541
909 Ga0157370_10022307
910 Ga0157370_10100317
911 Ga0157370_10434491
912 Ga0157370_11182983
913 Ga0157370_11450301
914 Ga0157370_11626042
915 Ga0157369_10017666
916 Ga0157369_10052000
917 Ga0157369_10129307
918 Ga0157369_10440455
919 Ga0157369_10474654
920 Ga0157369_10500314
921 Ga0157369_10638215
922 Ga0157369_10728530
923 Ga0157369_11118961
924 Ga0157374_10091983
925 Ga0157374_10818913
926 Ga0157374_11008194
927 Ga0157378_10093900
928 Ga0157378_10186508
929 Ga0157378_10472322
930 Ga0163162_10270339
931 Ga0163162_12899035
932 Ga0157372_10004740
933 Ga0157372_10073290
934 Ga0157372_10102479
935 Ga0157372_10127129
936 Ga0157372_10503168
937 Ga0157372_10999951
938 Ga0157372_11163705
939 Ga0157372_12842839
940 Ga0157375_10054644
941 Ga0157375_10474002
942 Ga0157375_10565132
943 Ga0157375_12482159
944 Ga0163163_10036366
945 Ga0163163_10861567
946 Ga0157380_10321113
947 Ga0157377_10067637
948 Ga0157377_10244787
949 Ga0157379_12125480
950 Ga0157376_10324307
951 Ga0157376_10623173
952 Ga0163161_10637222
953 Ga0197907_10500375
954 Ga0206356_10789269
955 Ga0206354_10690413
956 Ga0213876_10018752
957 Ga0207666_1010332
958 Ga0207697_10374140
959 Ga0207642_10322187
960 Ga0207642_10571181
961 Ga0207688_10843212
962 Ga0207645_10255799
963 Ga0207645_10360539
964 Ga0207643_10178202
965 Ga0207705_10743026
966 Ga0207654_10447744
967 Ga0207707_10000871
968 Ga0207707_10026252
969 Ga0207707_10035433
970 Ga0207707_10100170
971 Ga0207707_10865799
972 Ga0207695_10003588
973 Ga0207695_10009836
974 Ga0207695_10013339
975 Ga0207695_10037391
976 Ga0207671_10103322
977 Ga0207660_10116083
978 Ga0207660_10123169
979 Ga0207660_10348235
980 Ga0207660_11569452
981 Ga0207662_10027130
982 Ga0207662_10028433
983 Ga0207662_10175893
984 Ga0207657_10475331
985 Ga0207649_10172359
986 Ga0207652_10003451
987 Ga0207652_10011460
988 Ga0207652_10018884
989 Ga0207652_10041776
990 Ga0207652_10142502
991 Ga0207652_10199227
992 Ga0207681_10045529
993 Ga0207681_10202466
994 Ga0207681_10574048
995 Ga0207694_10114449
996 Ga0207650_10273203
997 Ga0207650_10314075
998 Ga0207659_10088088
999 Ga0207687_10337842
1000 Ga0207700_10295407
1001 Ga0207700_10852667
1002 Ga0207664_10300313
1003 Ga0207706_10541742
1004 Ga0207686_10233256
1005 Ga0207709_10691013
1006 Ga0207709_11615103
1007 Ga0207670_10184670
1008 Ga0207670_10812921
1009 Ga0207704_10049386
1010 Ga0207691_10071408
1011 Ga0207691_10085513
1012 Ga0207691_10132744
1013 Ga0207691_10464672
1014 Ga0207711_10222161
1015 Ga0207711_10301795
1016 Ga0207711_10425349
1017 Ga0207711_10431295
1018 Ga0207711_10593627
1019 Ga0207689_10041368
1020 Ga0207689_10506877
1021 Ga0207661_10011556
1022 Ga0207661_10021420
1023 Ga0207661_10138446
1024 Ga0207661_10413030
1025 Ga0207679_10172403
1026 Ga0207679_10307162
1027 Ga0207679_10410467
1028 Ga0207679_10518871
1029 Ga0207679_10669423
1030 Ga0207679_10775662
1031 Ga0207679_11849303
1032 Ga0207667_10215272
1033 Ga0207667_10272428
1034 Ga0207667_10458674
1035 Ga0207667_10519887
1036 Ga0207667_10792798
1037 Ga0207651_10303134
1038 Ga0207651_10525810
1039 Ga0207712_10150304
1040 Ga0207712_10364117
1041 Ga0207668_10093670
1042 Ga0207668_11816302
1043 Ga0207658_11167530
1044 Ga0207639_10165693
1045 Ga0207708_10051829
1046 Ga0207708_11293000
1047 Ga0207702_10495562
1048 Ga0207702_10723512
1049 Ga0207702_10975233
1050 Ga0207648_10184059
1051 Ga0207676_10167487
1052 Ga0207676_10514292
1053 Ga0207674_10076152
1054 Ga0207674_10951914
1055 Ga0207674_11123499
1056 Ga0207675_100245453
1057 Ga0207675_100250022
1058 Ga0207683_10270923
1059 Ga0207683_10291098
1060 Ga0207698_10276127
1061 Ga0209999_1074439
1062 Ga0209971_1074137
1063 Ga0209966_1067838
1064 Ga0207428_10063816
1065 Ga0207428_10071215
1066 Ga0207428_10220266
1067 Ga0268266_10188620
1068 Ga0268266_10355897
1069 Ga0268266_10731035
1070 Ga0268265_10101360
1071 Ga0268265_10114331
1072 Ga0268265_10615687
1073 Ga0268265_10760443
1074 Ga0268264_10650063
1075 Ga0316178_1099776
1076 Ga0265325_10433590
1077 Ga0265339_10284770
1078 Ga0307408_100021263
1079 Ga0307408_100055615
1080 Ga0307408_100593519
1081 Ga0316579_10002413
1082 Ga0265314_10045702
1083 Ga0316576_10058284
1084 Ga0316576_10209944
1085 Ga0316576_10255839
1086 Ga0316578_10000514
1087 Ga0307405_10121332
1088 Ga0307405_10253001
1089 Ga0307405_11182659
1090 Ga0316577_10000004
1091 Ga0316577_10000022
1092 Ga0307413_10004141
1093 Ga0307413_10488046
1094 Ga0307410_10168401
1095 Ga0307410_10731653
1096 Ga0307406_10082523
1097 Ga0307406_10354074
1098 Ga0307407_10103388
1099 Ga0307407_10228973
1100 Ga0307407_10345574
1101 Ga0307407_10374347
1102 Ga0307407_10448320
1103 Ga0307412_10063171
1104 Ga0307409_100037641
1105 Ga0307409_100314723
1106 Ga0307409_100552675
1107 Ga0307409_102194375
1108 Ga0307416_100013348
1109 Ga0307416_100676595
1110 Ga0307416_100680201
1111 Ga0307414_10098725
1112 Ga0307414_11085158
1113 Ga0307414_12188507
1114 Ga0307411_10004091
1115 Ga0307411_10057803
1116 Ga0307411_10091473
1117 Ga0307411_10147193
1118 Ga0307411_10501547
1119 Ga0307415_100195364
1120 Ga0307415_100315351
1121 Ga0307415_100651541
1122 Ga0316585_10222696
1123 Ga0373938_0121980
1124 Ga0373944_0203876
1125 Ga0373952_0097030
1126 Ga0373945_0409871
1127 Ga0373960_0162018
1128 Ga0373943_0034041
1129 Ga0373946_0149056
1130 Ga0316574_0563288
1131 Ga0373931_0022181
1132 Ga0373935_0279591
1133 Ga0373927_0008250
1134 Ga0373947_0096505
1135 Ga0316582_0956809
1136 Ga0316584_0006009
1137 Ga0373925_0567988
1138 Ga0395899_0041297
1139 Ga0395900_0111891
1140 Ga0395898_0560285
1141 Ga0395905_0192256
1142 Ga0395901_0023774
1143 Ga0436365_0301783
1144 Ga0436365_1791692
1145 Ga0436365_1827484
1146 Ga0436362_0771551
1147 Ga0451806_207551
1148 Ga0451853_3605816
1149 Ga0439449_0083566
1150 Ga0439462_0152257
1151 Ga0439435_0196465
1152 Ga0451577_0366314
1153 Ga0466963_0736434
1154 Ga0466963_1334253
1155 Ga0453684_0364050
1156 Ga0466957_0113082
1157 Ga0466959_0690786
1158 Ga0451576_0225036
1159 Ga0451576_1608037
1160 Ga0466958_1077659
1161 Ga0466967_1017623
1162 Ga0495629_0289511
1163 Ga0495651_0173401
1164 Ga0495653_0198950
1165 Ga0495580_0453295
1166 Ga0495582_0551394
1167 Ga0495639_0158371
1168 Ga0495639_0284242
1169 Ga0495594_0013342
1170 Ga0495594_0063578
1171 Ga0495594_0167053
1172 Ga0495594_0506339
1173 Ga0495630_0527451
1174 Ga0495652_0394005
1175 Ga0495665_0051955
1176 Ga0495665_0492019
1177 Ga0495640_0734580
1178 Ga0495586_0052403
1179 Ga0495586_0126114
1180 Ga0495587_0436662
1181 Ga0495645_0108759
1182 Ga0495635_0186801
1183 Ga0495659_0279854
1184 Ga0495588_0170819
1185 Ga0495658_0292847
1186 Ga0495613_0863938
1187 Ga0495604_0066404
1188 Ga0495675_0696378
1189 Ga0495684_0136189
1190 Ga0495593_0139833
1191 Ga0496101_0666534
1192 Ga0496104_0316491
1193 Ga0496109_0171201
1194 Ga0496109_1320765
1195 Ga0496110_0114792
1196 Ga0496110_0507224
1197 Ga0496112_0001979
1198 Ga0496112_0016024
1199 Ga0501291_163274
1200 Ga0501292_068905
1201 Ga0501298_040242
1202 Ga0501299_002219
1203 Ga0501299_003514
1204 Ga0501299_027743
1205 Ga0501299_109002
1206 Ga0501303_011061
1207 Ga0501031_0438388
1208 Ga0501033_0059379
1209 Ga0501033_0100070
1210 Ga0501033_0760248
1211 Ga0501034_0015110
1212 Ga0501034_0445668
1213 Ga0501036_0120910
1214 Ga0501036_0287365
1215 Ga0501037_0339776
1216 Ga0501037_0565924
1217 Ga0501038_0017646
1218 Ga0501039_0461282
1219 Ga0501040_1333048
1220 Ga0501042_1172402
1221 Ga0501043_0226759
1222 Ga0501047_0160477
1223 Ga0501068_0528433
1224 Ga0501070_0028787
1225 Ga0501072_0123263
1226 Ga0501073_0062440
1227 Ga0501075_0012997
1228 Ga0501075_0726640
1229 Ga0501076_0155906
1230 Ga0501076_0343291
1231 Ga0501076_1406431
1232 Ga0501201_035843
1233 Ga0501207_109568
1234 Ga0501209_096975
1235 Ga0501216_100489
1236 Ga0501217_077448
1237 Ga0501228_012116
1238 Ga0501249_072660
1239 Ga0501252_094641
1240 Ga0501257_222369
1241 Ga0501260_055977
1242 Ga0501225_0071895
1243 Ga0501079_0240915
1244 Ga0501079_1485229
1245 Ga0501081_0152631
1246 Ga0501268_018537
1247 Ga0501268_094190
1248 Ga0501272_052089
1249 Ga0501273_068973
1250 Ga0501283_006309
1251 Ga0501035_0734076
1252 Ga0501212_021163
1253 Ga0501212_119814
1254 nmdc:mga05p37_291391_c1
1255 nmdc:mga05p37_300308_c1
1256 nmdc:mga05p37_380769_c1
1257 nmdc:mga05p37_453922_c1
1258 nmdc:mga05p37_791511_c1
1259 nmdc:mga09592_151844_c1
1260 nmdc:mga09592_1734143_c1
1261 nmdc:mga09592_21724_c1
1262 nmdc:mga09592_634832_c1
1263 nmdc:mga09592_673_c1
1264 nmdc:mga0qj67_2344_c1
1265 nmdc:mga0qj67_43680_c1
1266 nmdc:mga0qj67_453861_c1
1267 nmdc:mga0qj67_57385_c1
1268 nmdc:mga06r32_1340_c1
1269 nmdc:mga06r32_447880_c1
1270 nmdc:mga06r32_786083_c1
1271 nmdc:mga06r32_805114_c1
1272 nmdc:mga06r32_828937_c1
1273 nmdc:mga08y16_14947_c1
1274 nmdc:mga08y16_151791_c1
1275 nmdc:mga08y16_320165_c1
1276 nmdc:mga08y16_44959_c1
1277 nmdc:mga08y16_766337_c1
1278 nmdc:mga08y16_97666_c1
1279 nmdc:mga0n895_1069579_c1
1280 nmdc:mga0n895_161642_c1
1281 nmdc:mga0n895_174835_c1
1282 nmdc:mga0n895_6017_c1
1283 nmdc:mga0n895_82384_c1
1284 nmdc:mga0rr50_576631_c1
1285 nmdc:mga0rr50_906695_c1
1286 nmdc:mga08x19_1496_c1
1287 nmdc:mga08x19_444838_c1
1288 nmdc:mga0a205_690320_c1
1289 Ga0495601_0411899
1290 Ga0501084_1361146
1291 Ga0590075_151500
1292 Ga0590077_138908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

28

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.938 7 108
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9272 7 109
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9203 7 106
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9145 7 104
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9136 5 104
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9145 7 104 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9045 13 93 1.10.10.10
af_P64588_52_154_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8961 5 95 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8958 7 104 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8929 11 93 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N9MU15-F1-model_v4 Transcriptional regulator, PadR family 0.9964 16 107
AF-A0A2V9ASX9-F1-model_v4 PadR family transcriptional regulator 0.986 1 108
AF-A0A2E8E0J4-F1-model_v4 PadR family transcriptional regulator 0.9842 1 108
AF-A0A7S7NR82-F1-model_v4 PadR family transcriptional regulator 0.984 16 110
AF-E8V6A6-F1-model_v4 Transcriptional regulator, PadR-like family 0.9838 9 110

Map