F472090

General Info

Members Datasets Scaffolds Average Seq Length
645 205 1290 205

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10042919|JGI24737J22298_100429192
Length 225
Sequence VQPNRRPAVCLLVDMCQKGTAVIGWLLARMIMACSLVSVSMAAAAQAPLSVPPSATVSGTPYRINPGDELEILVWGDERLQRGVLVLPDGTFAFPLVGQVNAAGRLPSEIERVITAGLQPQYKGPVPQVTVSVKKASGYQFSVVGKVRNPGTFTPGRYVNALEALAIAGGPAEFANPGGARVIRKAGDQLFVVPVRLQDALRGDTARLGPNDIPRIESGDTLVVP

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
202 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
203 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
204 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.41
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 28.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10042919 3300001990 Bacteria 1385
2 MBSR1b_contig_1297016 2162886012 Bacteria 930
3 MBSR1b_contig_13888460 2162886012 Bacteria 911
4 JGI24740J21852_10002403 3300001979 Bacteria 8507
5 JGI24739J22299_10006905 3300001989 Bacteria 4276
6 JGI24739J22299_10012766 3300001989 Bacteria 3079
7 JGI24739J22299_10026558 3300001989 Unclassified 2031
8 JGI24739J22299_10044347 3300001989 Unclassified 1465
9 JGI24735J21928_10002010 3300002067 Bacteria 7153
10 JGI24735J21928_10005193 3300002067 Bacteria 4331
11 JGI24735J21928_10034511 3300002067 Bacteria 1491
12 JGI24745J21846_1001583 3300002073 Bacteria 2226
13 JGI24738J21930_10014491 3300002075 Unclassified 1691
14 JGI24744J21845_10000630 3300002077 Bacteria 6428
15 rootH2_10261940 3300003320 Unclassified 1350
16 rootL2_10140962 3300003322 Unclassified 1945
17 rootH1_10175824 3300003323 Unclassified 1803
18 Ga0070658_10014874 3300005327 Bacteria 6234
19 Ga0070658_10110147 3300005327 Bacteria 2280
20 Ga0070658_10133547 3300005327 Bacteria 2069
21 Ga0070658_10210057 3300005327 Unclassified 1644
22 Ga0070658_10228672 3300005327 Bacteria 1574
23 Ga0070676_10146680 3300005328 Unclassified 1507
24 Ga0070676_10395315 3300005328 Unclassified 960
25 Ga0070683_100002629 3300005329 Bacteria 14360
26 Ga0070683_100030858 3300005329 Bacteria 4869
27 Ga0070690_100005322 3300005330 Bacteria 7222
28 Ga0070690_100012753 3300005330 Bacteria 4950
29 Ga0070690_100223973 3300005330 Unclassified 1319
30 Ga0070670_100005192 3300005331 Bacteria 10964
31 Ga0070670_100053449 3300005331 Unclassified 3468
32 Ga0070677_10096595 3300005333 Bacteria 1295
33 Ga0070677_10249946 3300005333 Unclassified 880
34 Ga0070666_10001302 3300005335 Bacteria 15102
35 Ga0070666_10026568 3300005335 Unclassified 3784
36 Ga0070666_10141152 3300005335 Unclassified 1678
37 Ga0070680_100006378 3300005336 Bacteria 8960
38 Ga0070680_100015094 3300005336 Bacteria 6048
39 Ga0070680_100045029 3300005336 Unclassified 3586
40 Ga0070680_100525080 3300005336 Bacteria 1014
41 Ga0070680_100526074 3300005336 Unclassified 1013
42 Ga0070682_100134841 3300005337 Unclassified 1676
43 Ga0068868_100003463 3300005338 Bacteria 10990
44 Ga0068868_100054250 3300005338 Unclassified 3158
45 Ga0068868_100912969 3300005338 Bacteria 799
46 Ga0068868_101090935 3300005338 Unclassified 734
47 Ga0070660_100003869 3300005339 Bacteria 10336
48 Ga0070660_100007812 3300005339 Bacteria 7459
49 Ga0070660_100025386 3300005339 Bacteria 4405
50 Ga0070660_100037950 3300005339 Bacteria 3654
51 Ga0070660_100070204 3300005339 Bacteria 2733
52 Ga0070660_100081511 3300005339 Unclassified 2540
53 Ga0070660_100174043 3300005339 Bacteria 1740
54 Ga0070660_100226464 3300005339 Unclassified 1520
55 Ga0070660_100273824 3300005339 Bacteria 1380
56 Ga0070660_100282701 3300005339 Unclassified 1358
57 Ga0070661_100002823 3300005344 Bacteria 11943
58 Ga0070661_100005291 3300005344 Bacteria 8893
59 Ga0070661_100006530 3300005344 Bacteria 8047
60 Ga0070661_100013143 3300005344 Bacteria 5809
61 Ga0070661_100045009 3300005344 Bacteria 3225
62 Ga0070661_100050041 3300005344 Bacteria 3058
63 Ga0070661_100062736 3300005344 Bacteria 2728
64 Ga0070661_100113973 3300005344 Unclassified 2020
65 Ga0070661_100292560 3300005344 Unclassified 1266
66 Ga0070668_100344277 3300005347 Bacteria 1260
67 Ga0070669_100335419 3300005353 Bacteria 1224
68 Ga0070675_100002093 3300005354 Bacteria 14774
69 Ga0070675_100173112 3300005354 Unclassified 1863
70 Ga0070671_100000585 3300005355 Bacteria 25984
71 Ga0070671_100001443 3300005355 Bacteria 17754
72 Ga0070671_100022690 3300005355 Bacteria 5127
73 Ga0070671_100044584 3300005355 Bacteria 3685
74 Ga0070671_100057513 3300005355 Plasmid 3236
75 Ga0070671_100111029 3300005355 Bacteria 2303
76 Ga0070671_100117386 3300005355 Unclassified 2237
77 Ga0070671_100316553 3300005355 Unclassified 1329
78 Ga0070671_100949568 3300005355 Bacteria 752
79 Ga0070674_100006154 3300005356 Bacteria 6976
80 Ga0070674_100453527 3300005356 Unclassified 1059
81 Ga0070673_100000518 3300005364 Bacteria 20675
82 Ga0070673_100001113 3300005364 Bacteria 15429
83 Ga0070673_100719846 3300005364 Bacteria 917
84 Ga0070659_100005596 3300005366 Bacteria 9030
85 Ga0070659_100017205 3300005366 Bacteria 5435
86 Ga0070659_100019036 3300005366 Bacteria 5192
87 Ga0070659_100021733 3300005366 Bacteria 4892
88 Ga0070659_100024954 3300005366 Bacteria 4587
89 Ga0070659_100042674 3300005366 Bacteria 3546
90 Ga0070659_100250631 3300005366 Unclassified 1467
91 Ga0070659_100326022 3300005366 Bacteria 1284
92 Ga0070667_100012961 3300005367 Bacteria 6894
93 Ga0070667_100112420 3300005367 Bacteria 2362
94 Ga0070667_100452927 3300005367 Unclassified 1173
95 Ga0070714_100002190 3300005435 Bacteria 14377
96 Ga0070714_100023812 3300005435 Bacteria 5035
97 Ga0070713_100064565 3300005436 Bacteria 3073
98 Ga0070713_100264901 3300005436 Unclassified 1572
99 Ga0070663_100009807 3300005455 Bacteria 5949
100 Ga0070663_100025456 3300005455 Bacteria 3996
101 Ga0070663_100115539 3300005455 Bacteria 2022
102 Ga0070663_100538293 3300005455 Bacteria 974
103 Ga0070678_100003931 3300005456 Bacteria 8357
104 Ga0070678_100020631 3300005456 Unclassified 4327
105 Ga0070678_100150888 3300005456 Unclassified 1872
106 Ga0070678_100653416 3300005456 Unclassified 943
107 Ga0070662_100005816 3300005457 Bacteria 7909
108 Ga0070662_100008179 3300005457 Bacteria 6812
109 Ga0070662_100025353 3300005457 Unclassified 4094
110 Ga0070662_100043033 3300005457 Bacteria 3229
111 Ga0070662_100059180 3300005457 Unclassified 2790
112 Ga0070662_100103293 3300005457 Bacteria 2161
113 Ga0070662_100108640 3300005457 Bacteria 2110
114 Ga0070662_100137131 3300005457 Unclassified 1893
115 Ga0070662_101066491 3300005457 Bacteria 693
116 Ga0070681_10026188 3300005458 Bacteria 5863
117 Ga0070681_10186571 3300005458 Bacteria 1994
118 Ga0070681_10489535 3300005458 Bacteria 1143
119 Ga0068867_100005952 3300005459 Bacteria 8650
120 Ga0068867_100355309 3300005459 Bacteria 1224
121 Ga0070679_100126514 3300005530 Bacteria 2538
122 Ga0070679_100129843 3300005530 Unclassified 2501
123 Ga0070679_100280316 3300005530 Bacteria 1619
124 Ga0070679_100478373 3300005530 Bacteria 1190
125 Ga0070684_100004092 3300005535 Bacteria 11038
126 Ga0070684_100043342 3300005535 Bacteria 3885
127 Ga0068853_100031367 3300005539 Bacteria 4495
128 Ga0068853_100100044 3300005539 Bacteria 2562
129 Ga0068853_100117230 3300005539 Bacteria 2371
130 Ga0068853_100229315 3300005539 Bacteria 1698
131 Ga0068853_100383372 3300005539 Bacteria 1313
132 Ga0068853_100421992 3300005539 Unclassified 1251
133 Ga0070672_100008152 3300005543 Bacteria 7161
134 Ga0070672_100139790 3300005543 Bacteria 1997
135 Ga0070672_100289410 3300005543 Unclassified 1387
136 Ga0070686_100016416 3300005544 Bacteria 4309
137 Ga0070686_100089690 3300005544 Bacteria 2054
138 Ga0070665_100001865 3300005548 Bacteria 23913
139 Ga0070665_100632653 3300005548 Bacteria 1083
140 Ga0068855_100005824 3300005563 Bacteria 15041
141 Ga0068855_100006659 3300005563 Bacteria 14033
142 Ga0068855_100014977 3300005563 Bacteria 9340
143 Ga0068855_100017060 3300005563 Bacteria 8734
144 Ga0068855_100133125 3300005563 Unclassified 2838
145 Ga0068855_100802386 3300005563 Bacteria 1000
146 Ga0070664_100003503 3300005564 Bacteria 12676
147 Ga0070664_100004995 3300005564 Bacteria 10628
148 Ga0070664_100020715 3300005564 Bacteria 5415
149 Ga0070664_100021899 3300005564 Bacteria 5269
150 Ga0070664_100088628 3300005564 Bacteria 2675
151 Ga0070664_100539447 3300005564 Unclassified 1078
152 Ga0068857_100005367 3300005577 Bacteria 10928
153 Ga0068857_100008638 3300005577 Bacteria 8815
154 Ga0068857_100342573 3300005577 Bacteria 1383
155 Ga0068857_100524603 3300005577 Unclassified 1113
156 Ga0068854_100005714 3300005578 Bacteria 7860
157 Ga0068854_100011868 3300005578 Bacteria 5690
158 Ga0068854_100013435 3300005578 Bacteria 5375
159 Ga0068854_100043575 3300005578 Bacteria 3181
160 Ga0068854_100282391 3300005578 Bacteria 1337
161 Ga0068854_100345931 3300005578 Unclassified 1215
162 Ga0068856_100092419 3300005614 Unclassified 3011
163 Ga0068856_100095480 3300005614 Bacteria 2961
164 Ga0068856_100663484 3300005614 Bacteria 1063
165 Ga0068852_100007810 3300005616 Bacteria 7833
166 Ga0068852_100008650 3300005616 Bacteria 7522
167 Ga0068852_100062081 3300005616 Bacteria 3249
168 Ga0068852_100067621 3300005616 Bacteria 3124
169 Ga0068852_100100758 3300005616 Bacteria 2607
170 Ga0068852_100108071 3300005616 Unclassified 2525
171 Ga0068852_100262170 3300005616 Unclassified 1660
172 Ga0068852_100378225 3300005616 Unclassified 1389
173 Ga0068852_100578630 3300005616 Bacteria 1125
174 Ga0068852_100807244 3300005616 Unclassified 952
175 Ga0068859_100004211 3300005617 Bacteria 14677
176 Ga0068859_100114502 3300005617 Unclassified 2761
177 Ga0068864_100002449 3300005618 Bacteria 15334
178 Ga0068864_100124984 3300005618 Bacteria 2304
179 Ga0068864_100545710 3300005618 Bacteria 1120
180 Ga0068864_100695511 3300005618 Unclassified 993
181 Ga0068866_10004286 3300005718 Bacteria 5859
182 Ga0068866_10005540 3300005718 Bacteria 5216
183 Ga0068866_10153176 3300005718 Unclassified 1337
184 Ga0068861_100317559 3300005719 Bacteria 1356
185 Ga0068851_10023519 3300005834 Bacteria 3012
186 Ga0068851_10030910 3300005834 Bacteria 2657
187 Ga0068851_10298309 3300005834 Bacteria 926
188 Ga0068863_100004949 3300005841 Bacteria 13136
189 Ga0068863_100118766 3300005841 Unclassified 2520
190 Ga0068863_100324651 3300005841 Bacteria 1495
191 Ga0068858_100016957 3300005842 Bacteria 6838
192 Ga0068858_100050121 3300005842 Unclassified 3864
193 Ga0068858_100131372 3300005842 Unclassified 2348
194 Ga0068860_100046428 3300005843 Unclassified 4141
195 Ga0068860_100422061 3300005843 Bacteria 1322
196 Ga0081539_10012110 3300005985 Bacteria 6702
197 Ga0097621_100054597 3300006237 Bacteria 3259
198 Ga0097621_100421824 3300006237 Bacteria 1198
199 Ga0068871_100081679 3300006358 Unclassified 2678
200 Ga0068871_100155028 3300006358 Bacteria 1955
201 Ga0068871_100462434 3300006358 Bacteria 1139
202 Ga0097620_100004211 3300006931 Bacteria 14677
203 Ga0097620_100114501 3300006931 Unclassified 2761
204 Ga0105251_10106287 3300009011 Unclassified 1281
205 Ga0105240_10045600 3300009093 Bacteria 5560
206 Ga0105240_10098372 3300009093 Unclassified 3563
207 Ga0105240_10160539 3300009093 Bacteria 2670
208 Ga0105245_10006582 3300009098 Bacteria 10199
209 Ga0105245_10044171 3300009098 Bacteria 3976
210 Ga0105245_10065173 3300009098 Bacteria 3294
211 Ga0105243_10167559 3300009148 Bacteria 1900
212 Ga0105243_10205041 3300009148 Unclassified 1732
213 Ga0105241_10592309 3300009174 Unclassified 1001
214 Ga0105242_10002916 3300009176 Bacteria 13365
215 Ga0105248_10000864 3300009177 Bacteria 34121
216 Ga0105248_10013935 3300009177 Bacteria 8846
217 Ga0105248_10037356 3300009177 Bacteria 5434
218 Ga0105248_10329159 3300009177 Bacteria 1720
219 Ga0105237_10049349 3300009545 Bacteria 4231
220 Ga0105238_10002340 3300009551 Bacteria 19060
221 Ga0105238_10013299 3300009551 Bacteria 8304
222 Ga0105238_10096370 3300009551 Bacteria 2944
223 Ga0105239_10068875 3300010375 Plasmid 3889
224 Ga0105239_11327088 3300010375 Bacteria 830
225 Ga0105239_11483585 3300010375 Bacteria 783
226 Ga0105246_10805378 3300011119 Unclassified 834
227 Ga0157373_10004072 3300013100 Bacteria 11014
228 Ga0157373_10008312 3300013100 Bacteria 7711
229 Ga0157373_10008647 3300013100 Bacteria 7554
230 Ga0157373_10069909 3300013100 Unclassified 2481
231 Ga0157373_10086467 3300013100 Bacteria 2209
232 Ga0157373_10487288 3300013100 Bacteria 890
233 Ga0157373_10531554 3300013100 Bacteria 851
234 Ga0157371_10008598 3300013102 Bacteria 8109
235 Ga0157371_10018990 3300013102 Bacteria 5074
236 Ga0157371_10024427 3300013102 Bacteria 4413
237 Ga0157371_10035385 3300013102 Bacteria 3578
238 Ga0157371_10039072 3300013102 Unclassified 3395
239 Ga0157371_10172622 3300013102 Bacteria 1545
240 Ga0157371_10561715 3300013102 Bacteria 846
241 Ga0157370_10008977 3300013104 Bacteria 10729
242 Ga0157370_10015649 3300013104 Bacteria 7704
243 Ga0157370_10016993 3300013104 Bacteria 7353
244 Ga0157370_10022730 3300013104 Bacteria 6240
245 Ga0157370_10072735 3300013104 Bacteria 3243
246 Ga0157370_10116084 3300013104 Bacteria 2501
247 Ga0157369_10002126 3300013105 Bacteria 23887
248 Ga0157369_10014353 3300013105 Bacteria 8945
249 Ga0157369_10056672 3300013105 Bacteria 4228
250 Ga0157369_10060324 3300013105 Bacteria 4090
251 Ga0157369_10343321 3300013105 Bacteria 1551
252 Ga0157369_10589894 3300013105 Bacteria 1147
253 Ga0157369_11140891 3300013105 Bacteria 796
254 Ga0157369_11146045 3300013105 Bacteria 794
255 Ga0157369_11307932 3300013105 Bacteria 739
256 Ga0157374_10002280 3300013296 Bacteria 16143
257 Ga0157374_10123330 3300013296 Bacteria 2503
258 Ga0157374_10240917 3300013296 Unclassified 1779
259 Ga0157374_10372727 3300013296 Unclassified 1421
260 Ga0157378_10007867 3300013297 Bacteria 9302
261 Ga0157378_10007999 3300013297 Bacteria 9230
262 Ga0157378_10034100 3300013297 Bacteria 4502
263 Ga0157378_10282423 3300013297 Unclassified 1601
264 Ga0163162_10030131 3300013306 Bacteria 5375
265 Ga0163162_10038669 3300013306 Unclassified 4761
266 Ga0163162_10064407 3300013306 Bacteria 3711
267 Ga0163162_10147070 3300013306 Bacteria 2473
268 Ga0163162_10318788 3300013306 Unclassified 1687
269 Ga0163162_10353316 3300013306 Bacteria 1602
270 Ga0157372_10001798 3300013307 Bacteria 23289
271 Ga0157372_10012759 3300013307 Bacteria 8952
272 Ga0157372_10040118 3300013307 Bacteria 5169
273 Ga0157372_10165822 3300013307 Unclassified 2555
274 Ga0157375_10012218 3300013308 Bacteria 7613
275 Ga0157375_10294531 3300013308 Unclassified 1786
276 Ga0157375_10400064 3300013308 Bacteria 1540
277 Ga0163163_10013953 3300014325 Bacteria 7373
278 Ga0157380_10365206 3300014326 Bacteria 1356
279 Ga0157377_10013653 3300014745 Bacteria 4116
280 Ga0157379_10068937 3300014968 Unclassified 3162
281 Ga0157376_10003176 3300014969 Bacteria 11290
282 Ga0157376_10424354 3300014969 Unclassified 1291
283 Ga0163161_10013190 3300017792 Bacteria 5744
284 Ga0206356_11305088 3300020070 Bacteria 1603
285 Ga0206353_11863051 3300020082 Bacteria 1388
286 Ga0207697_10090735 3300025315 Unclassified 1295
287 Ga0207656_10185259 3300025321 Unclassified 1001
288 Ga0207682_10005198 3300025893 Bacteria 5327
289 Ga0207682_10036190 3300025893 Unclassified 1997
290 Ga0207642_10012037 3300025899 Unclassified 3110
291 Ga0207642_10072320 3300025899 Bacteria 1645
292 Ga0207688_10002725 3300025901 Bacteria 9558
293 Ga0207688_10080895 3300025901 Unclassified 1855
294 Ga0207680_10000843 3300025903 Bacteria 14479
295 Ga0207680_10132329 3300025903 Unclassified 1645
296 Ga0207647_10000652 3300025904 Bacteria 27131
297 Ga0207647_10000953 3300025904 Bacteria 22378
298 Ga0207647_10003821 3300025904 Bacteria 11264
299 Ga0207647_10017333 3300025904 Bacteria 4897
300 Ga0207647_10018812 3300025904 Bacteria 4659
301 Ga0207647_10025396 3300025904 Unclassified 3894
302 Ga0207647_10234379 3300025904 Unclassified 1055
303 Ga0207647_10282552 3300025904 Bacteria 947
304 Ga0207699_10248099 3300025906 Bacteria 1226
305 Ga0207645_10148415 3300025907 Bacteria 1530
306 Ga0207643_10021040 3300025908 Unclassified 3582
307 Ga0207643_10044622 3300025908 Unclassified 2503
308 Ga0207705_10002376 3300025909 Bacteria 14545
309 Ga0207705_10004357 3300025909 Bacteria 10702
310 Ga0207705_10015198 3300025909 Bacteria 5531
311 Ga0207705_10016676 3300025909 Bacteria 5261
312 Ga0207705_10047562 3300025909 Unclassified 3085
313 Ga0207705_10051935 3300025909 Bacteria 2950
314 Ga0207705_10108859 3300025909 Bacteria 2045
315 Ga0207705_10112190 3300025909 Unclassified 2015
316 Ga0207705_10131338 3300025909 Bacteria 1864
317 Ga0207705_10232015 3300025909 Bacteria 1404
318 Ga0207705_10265687 3300025909 Bacteria 1311
319 Ga0207654_10015469 3300025911 Bacteria 3961
320 Ga0207707_10049788 3300025912 Bacteria 3650
321 Ga0207707_10072538 3300025912 Bacteria 3001
322 Ga0207695_10255392 3300025913 Bacteria 1652
323 Ga0207695_10437388 3300025913 Unclassified 1192
324 Ga0207671_10039479 3300025914 Unclassified 3495
325 Ga0207693_10069915 3300025915 Bacteria 2747
326 Ga0207660_10065754 3300025917 Bacteria 2621
327 Ga0207660_10249031 3300025917 Bacteria 1402
328 Ga0207660_10701695 3300025917 Unclassified 825
329 Ga0207662_10006219 3300025918 Bacteria 6429
330 Ga0207657_10004145 3300025919 Bacteria 15365
331 Ga0207657_10007353 3300025919 Bacteria 11299
332 Ga0207657_10014910 3300025919 Bacteria 7557
333 Ga0207657_10015203 3300025919 Bacteria 7468
334 Ga0207657_10017538 3300025919 Bacteria 6860
335 Ga0207657_10019117 3300025919 Bacteria 6516
336 Ga0207657_10034185 3300025919 Unclassified 4574
337 Ga0207657_10087508 3300025919 Bacteria 2606
338 Ga0207657_10103551 3300025919 Bacteria 2359
339 Ga0207657_10105640 3300025919 Bacteria 2331
340 Ga0207657_10112714 3300025919 Bacteria 2244
341 Ga0207657_10499690 3300025919 Bacteria 953
342 Ga0207649_10019824 3300025920 Bacteria 3849
343 Ga0207649_10033103 3300025920 Unclassified 3086
344 Ga0207649_10034491 3300025920 Bacteria 3032
345 Ga0207649_10049691 3300025920 Bacteria 2591
346 Ga0207649_10071710 3300025920 Bacteria 2213
347 Ga0207649_10120981 3300025920 Unclassified 1765
348 Ga0207649_10129138 3300025920 Bacteria 1714
349 Ga0207649_10251820 3300025920 Bacteria 1272
350 Ga0207649_10403100 3300025920 Bacteria 1024
351 Ga0207652_10010377 3300025921 Bacteria 7500
352 Ga0207652_10019231 3300025921 Bacteria 5613
353 Ga0207652_10248124 3300025921 Unclassified 1605
354 Ga0207652_10648343 3300025921 Unclassified 944
355 Ga0207650_10009857 3300025925 Bacteria 6535
356 Ga0207650_10018530 3300025925 Unclassified 4885
357 Ga0207650_10728501 3300025925 Unclassified 838
358 Ga0207650_10858499 3300025925 Unclassified 770
359 Ga0207659_10049306 3300025926 Bacteria 2986
360 Ga0207687_10030895 3300025927 Bacteria 3616
361 Ga0207700_10023556 3300025928 Bacteria 4248
362 Ga0207664_10017766 3300025929 Bacteria 5224
363 Ga0207664_10060049 3300025929 Bacteria 3030
364 Ga0207644_10000110 3300025931 Bacteria 60867
365 Ga0207644_10002394 3300025931 Bacteria 12090
366 Ga0207644_10002765 3300025931 Bacteria 11299
367 Ga0207644_10022898 3300025931 Unclassified 4272
368 Ga0207644_10116021 3300025931 Bacteria 2031
369 Ga0207644_10126324 3300025931 Bacteria 1952
370 Ga0207644_10131711 3300025931 Bacteria 1915
371 Ga0207644_10218257 3300025931 Bacteria 1510
372 Ga0207644_10409776 3300025931 Unclassified 1109
373 Ga0207690_10002722 3300025932 Bacteria 10672
374 Ga0207690_10003887 3300025932 Bacteria 8831
375 Ga0207690_10052271 3300025932 Unclassified 2736
376 Ga0207690_10134744 3300025932 Bacteria 1812
377 Ga0207690_10232934 3300025932 Unclassified 1415
378 Ga0207706_10005674 3300025933 Bacteria 11630
379 Ga0207706_10027754 3300025933 Bacteria 5060
380 Ga0207706_10086196 3300025933 Bacteria 2760
381 Ga0207706_10139498 3300025933 Bacteria 2132
382 Ga0207706_10143644 3300025933 Unclassified 2099
383 Ga0207706_10170088 3300025933 Bacteria 1915
384 Ga0207706_10198767 3300025933 Unclassified 1758
385 Ga0207706_10250631 3300025933 Bacteria 1547
386 Ga0207686_10052215 3300025934 Unclassified 2550
387 Ga0207669_10029521 3300025937 Bacteria 3034
388 Ga0207669_10066421 3300025937 Bacteria 2242
389 Ga0207669_10663310 3300025937 Unclassified 854
390 Ga0207704_10099953 3300025938 Unclassified 1931
391 Ga0207665_10110000 3300025939 Unclassified 1935
392 Ga0207691_10022908 3300025940 Bacteria 5886
393 Ga0207691_10027006 3300025940 Bacteria 5386
394 Ga0207691_10027220 3300025940 Bacteria 5363
395 Ga0207691_10097130 3300025940 Unclassified 2633
396 Ga0207691_10142614 3300025940 Bacteria 2110
397 Ga0207711_10001548 3300025941 Bacteria 21289
398 Ga0207711_10001690 3300025941 Bacteria 20318
399 Ga0207711_10001939 3300025941 Bacteria 18783
400 Ga0207711_10003618 3300025941 Bacteria 13372
401 Ga0207711_10006835 3300025941 Bacteria 9589
402 Ga0207689_10061878 3300025942 Bacteria 3079
403 Ga0207661_10001486 3300025944 Bacteria 15865
404 Ga0207661_10038561 3300025944 Bacteria 3746
405 Ga0207679_10051391 3300025945 Bacteria 3017
406 Ga0207679_10052316 3300025945 Unclassified 2994
407 Ga0207679_10071392 3300025945 Bacteria 2619
408 Ga0207679_10178808 3300025945 Bacteria 1753
409 Ga0207679_10517518 3300025945 Unclassified 1067
410 Ga0207667_10004629 3300025949 Bacteria 16877
411 Ga0207667_10005521 3300025949 Bacteria 15429
412 Ga0207667_10012704 3300025949 Bacteria 9677
413 Ga0207667_10030071 3300025949 Bacteria 5880
414 Ga0207667_10046947 3300025949 Bacteria 4573
415 Ga0207667_10286408 3300025949 Bacteria 1683
416 Ga0207667_10428971 3300025949 Bacteria 1345
417 Ga0207651_10010963 3300025960 Bacteria 5048
418 Ga0207651_10029727 3300025960 Unclassified 3467
419 Ga0207640_10011846 3300025981 Bacteria 4950
420 Ga0207640_10020089 3300025981 Bacteria 3960
421 Ga0207640_10064446 3300025981 Unclassified 2440
422 Ga0207640_10235621 3300025981 Bacteria 1411
423 Ga0207640_10281278 3300025981 Unclassified 1307
424 Ga0207640_10424413 3300025981 Unclassified 1089
425 Ga0207658_10002182 3300025986 Bacteria 14559
426 Ga0207658_10085750 3300025986 Bacteria 2426
427 Ga0207658_10154442 3300025986 Unclassified 1874
428 Ga0207677_10003094 3300026023 Bacteria 8774
429 Ga0207677_10105748 3300026023 Unclassified 2083
430 Ga0207677_10402301 3300026023 Bacteria 1161
431 Ga0207703_10011174 3300026035 Bacteria 6987
432 Ga0207703_10266045 3300026035 Bacteria 1551
433 Ga0207703_11501286 3300026035 Unclassified 648
434 Ga0207639_10027601 3300026041 Bacteria 4137
435 Ga0207639_10048394 3300026041 Bacteria 3218
436 Ga0207639_10234842 3300026041 Bacteria 1591
437 Ga0207639_10362176 3300026041 Unclassified 1298
438 Ga0207639_11004287 3300026041 Bacteria 781
439 Ga0207678_10003264 3300026067 Bacteria 14641
440 Ga0207678_10007049 3300026067 Bacteria 9982
441 Ga0207678_10007874 3300026067 Bacteria 9399
442 Ga0207678_10021167 3300026067 Bacteria 5700
443 Ga0207678_10021916 3300026067 Bacteria 5600
444 Ga0207678_10033391 3300026067 Bacteria 4483
445 Ga0207678_10586382 3300026067 Unclassified 977
446 Ga0207702_10005931 3300026078 Bacteria 10614
447 Ga0207702_10018054 3300026078 Bacteria 5837
448 Ga0207702_10749481 3300026078 Bacteria 964
449 Ga0207641_10115912 3300026088 Bacteria 2383
450 Ga0207641_10316134 3300026088 Unclassified 1479
451 Ga0207641_10807694 3300026088 Bacteria 928
452 Ga0207648_10003640 3300026089 Bacteria 16124
453 Ga0207648_10037185 3300026089 Plasmid 4287
454 Ga0207676_10007387 3300026095 Bacteria 7794
455 Ga0207676_10130076 3300026095 Unclassified 2139
456 Ga0207676_10461405 3300026095 Bacteria 1199
457 Ga0207674_10002992 3300026116 Bacteria 20959
458 Ga0207674_10007460 3300026116 Bacteria 12748
459 Ga0207674_10078538 3300026116 Unclassified 3305
460 Ga0207674_10243247 3300026116 Bacteria 1746
461 Ga0207674_10532959 3300026116 Bacteria 1134
462 Ga0207675_100035806 3300026118 Unclassified 4630
463 Ga0207683_10001954 3300026121 Bacteria 18251
464 Ga0207683_10007409 3300026121 Bacteria 9410
465 Ga0207683_10014754 3300026121 Bacteria 6651
466 Ga0207683_10146387 3300026121 Unclassified 2130
467 Ga0207698_10004870 3300026142 Bacteria 8229
468 Ga0207698_10007906 3300026142 Bacteria 6697
469 Ga0207698_10036417 3300026142 Bacteria 3611
470 Ga0207698_10083077 3300026142 Bacteria 2591
471 Ga0207698_10105969 3300026142 Unclassified 2343
472 Ga0207698_10283411 3300026142 Bacteria 1534
473 Ga0207698_10360435 3300026142 Bacteria 1377
474 Ga0207698_10432017 3300026142 Bacteria 1267
475 Ga0207698_10604218 3300026142 Unclassified 1082
476 Ga0207698_10699788 3300026142 Unclassified 1008
477 Ga0207698_11281133 3300026142 Bacteria 747
478 Ga0268266_10561392 3300028379 Bacteria 1094
479 Ga0268264_10126419 3300028381 Unclassified 2260
480 Ga0268264_10126555 3300028381 Bacteria 2259
481 Ga0307408_100008775 3300031548 Bacteria 6673
482 Ga0307405_10006643 3300031731 Bacteria 5708
483 Ga0307405_10102577 3300031731 Bacteria 1922
484 Ga0307413_10013570 3300031824 Bacteria 4100
485 Ga0307413_10120075 3300031824 Bacteria 1779
486 Ga0307413_10481807 3300031824 Unclassified 992
487 Ga0307410_10005503 3300031852 Bacteria 6711
488 Ga0307410_10092286 3300031852 Bacteria 2152
489 Ga0307410_10326677 3300031852 Bacteria 1219
490 Ga0307406_10030120 3300031901 Unclassified 3291
491 Ga0307406_10052865 3300031901 Bacteria 2585
492 Ga0307407_10060432 3300031903 Bacteria 2211
493 Ga0307412_10013895 3300031911 Bacteria 4733
494 Ga0307412_10154569 3300031911 Bacteria 1697
495 Ga0307409_100005694 3300031995 Bacteria 7219
496 Ga0307409_100226076 3300031995 Bacteria 1693
497 Ga0307416_100016023 3300032002 Bacteria 5195
498 Ga0307416_100019565 3300032002 Unclassified 4804
499 Ga0307416_100122851 3300032002 Unclassified 2319
500 Ga0307414_10035268 3300032004 Bacteria 3328
501 Ga0307414_10868799 3300032004 Unclassified 825
502 Ga0307411_10024827 3300032005 Bacteria 3580
503 Ga0307411_10232881 3300032005 Unclassified 1437
504 Ga0307415_100008308 3300032126 Bacteria 5746
505 Ga0307415_100009449 3300032126 Bacteria 5467
506 Ga0307415_100223658 3300032126 Bacteria 1511
507 Ga0373946_0030460 3300035171 Bacteria 2154
508 Ga0373931_0048019 3300035691 Unclassified 2261
509 Ga0373935_0014000 3300035692 Unclassified 4844
510 Ga0373947_0021896 3300035725 Bacteria 3704
511 Ga0373925_0399294 3300037068 Bacteria 1121
512 Ga0395899_0000274 3300037312 Bacteria 67210
513 Ga0395899_0013744 3300037312 Bacteria 6189
514 Ga0395899_0018865 3300037312 Bacteria 5242
515 Ga0395899_0022022 3300037312 Bacteria 4833
516 Ga0395899_0038774 3300037312 Unclassified 3567
517 Ga0395899_0043264 3300037312 Bacteria 3360
518 Ga0395899_0056578 3300037312 Bacteria 2898
519 Ga0395899_0070897 3300037312 Bacteria 2551
520 Ga0395899_0085878 3300037312 Unclassified 2286
521 Ga0395899_0115094 3300037312 Bacteria 1930
522 Ga0395899_0125702 3300037312 Unclassified 1834
523 Ga0395899_0179765 3300037312 Bacteria 1486
524 Ga0395900_0000595 3300037418 Bacteria 49632
525 Ga0395900_0004150 3300037418 Bacteria 15419
526 Ga0395900_0018303 3300037418 Bacteria 7146
527 Ga0395900_0021697 3300037418 Bacteria 6566
528 Ga0395900_0046219 3300037418 Unclassified 4483
529 Ga0395900_0065619 3300037418 Bacteria 3729
530 Ga0395900_0075993 3300037418 Bacteria 3452
531 Ga0395900_0076541 3300037418 Bacteria 3439
532 Ga0395900_0128536 3300037418 Bacteria 2597
533 Ga0395900_0131492 3300037418 Unclassified 2565
534 Ga0395900_0190363 3300037418 Bacteria 2081
535 Ga0395900_0295802 3300037418 Unclassified 1606
536 Ga0395900_0313818 3300037418 Unclassified 1550
537 Ga0395900_0363748 3300037418 Bacteria 1417
538 Ga0395900_0474290 3300037418 Unclassified 1204
539 Ga0395900_1152973 3300037418 Unclassified 691
540 Ga0395898_0005114 3300037466 Bacteria 14209
541 Ga0395898_0006829 3300037466 Bacteria 12138
542 Ga0395898_0017203 3300037466 Bacteria 7384
543 Ga0395898_0017744 3300037466 Bacteria 7263
544 Ga0395898_0049227 3300037466 Unclassified 4129
545 Ga0395898_0050768 3300037466 Bacteria 4058
546 Ga0395898_0061040 3300037466 Bacteria 3663
547 Ga0395898_0106111 3300037466 Bacteria 2694
548 Ga0395898_0113466 3300037466 Unclassified 2597
549 Ga0395898_0114951 3300037466 Unclassified 2578
550 Ga0395898_0184567 3300037466 Bacteria 1993
551 Ga0395898_0200060 3300037466 Bacteria 1907
552 Ga0395898_0403965 3300037466 Bacteria 1302
553 Ga0395898_0951202 3300037466 Unclassified 796
554 Ga0395905_0002328 3300037471 Bacteria 21216
555 Ga0395905_0003746 3300037471 Bacteria 16115
556 Ga0395905_0010952 3300037471 Bacteria 8777
557 Ga0395905_0011179 3300037471 Bacteria 8679
558 Ga0395905_0017132 3300037471 Bacteria 6881
559 Ga0395905_0021701 3300037471 Bacteria 6074
560 Ga0395905_0030485 3300037471 Bacteria 5082
561 Ga0395905_0050891 3300037471 Bacteria 3880
562 Ga0395905_0052491 3300037471 Bacteria 3816
563 Ga0395905_0119707 3300037471 Bacteria 2474
564 Ga0395905_0141293 3300037471 Bacteria 2265
565 Ga0395905_0160654 3300037471 Unclassified 2112
566 Ga0395905_0246702 3300037471 Bacteria 1668
567 Ga0395905_0278549 3300037471 Bacteria 1558
568 Ga0395905_0290204 3300037471 Unclassified 1522
569 Ga0395905_0429134 3300037471 Bacteria 1218
570 Ga0395905_0912460 3300037471 Unclassified 781
571 Ga0395901_0001391 3300038443 Bacteria 25281
572 Ga0395901_0005012 3300038443 Bacteria 13368
573 Ga0395901_0005682 3300038443 Bacteria 12622
574 Ga0395901_0007094 3300038443 Bacteria 11329
575 Ga0395901_0012920 3300038443 Bacteria 8471
576 Ga0395901_0039018 3300038443 Unclassified 4913
577 Ga0395901_0080083 3300038443 Bacteria 3409
578 Ga0395901_0080413 3300038443 Unclassified 3403
579 Ga0395901_0082438 3300038443 Unclassified 3360
580 Ga0395901_0118824 3300038443 Bacteria 2777
581 Ga0395901_0291162 3300038443 Unclassified 1694
582 Ga0395901_0301711 3300038443 Bacteria 1660
583 Ga0395901_0658451 3300038443 Unclassified 1049
584 Ga0395901_0680966 3300038443 Unclassified 1028
585 Ga0395901_1139394 3300038443 Bacteria 749
586 Ga0436365_0736792 3300039437 Bacteria 14837
587 Ga0439448_0002283 3300042005 Bacteria 5186
588 Ga0439458_0001082 3300042157 Bacteria 6944
589 Ga0466965_0020932 3300044683 Unclassified 3147
590 Ga0466966_0038977 3300044684 Bacteria 3060
591 Ga0466966_0230991 3300044684 Unclassified 1116
592 Ga0466961_0054393 3300044693 Bacteria 2553
593 Ga0466961_0169047 3300044693 Bacteria 1360
594 Ga0466961_0198862 3300044693 Bacteria 1240
595 Ga0466963_0207185 3300044694 Bacteria 1372
596 Ga0466963_0359408 3300044694 Unclassified 1026
597 Ga0466963_0572762 3300044694 Bacteria 797
598 Ga0466964_0012707 3300044706 Unclassified 3187
599 Ga0466971_0069518 3300044719 Unclassified 1598
600 Ga0466970_0005408 3300044765 Bacteria 6335
601 Ga0466970_0193586 3300044765 Unclassified 1130
602 Ga0466970_0226551 3300044765 Bacteria 1044
603 Ga0466970_0280565 3300044765 Unclassified 937
604 Ga0466957_0087909 3300044842 Unclassified 1944
605 Ga0466957_0435089 3300044842 Unclassified 902
606 Ga0466960_0399578 3300044901 Unclassified 791
607 Ga0466959_0031093 3300045049 Unclassified 3951
608 Ga0466959_0038450 3300045049 Bacteria 3536
609 Ga0466958_0011871 3300045836 Unclassified 4919
610 Ga0466958_0034898 3300045836 Bacteria 3003
611 Ga0466958_0155321 3300045836 Bacteria 1444
612 Ga0466967_0176085 3300045976 Unclassified 2015
613 Ga0466967_0775343 3300045976 Unclassified 951
614 Ga0495669_0070262 3300046684 Bacteria 1594
615 Ga0495669_0091710 3300046684 Unclassified 1403
616 Ga0495677_0036977 3300047445 Unclassified 1783
617 Ga0495677_0040249 3300047445 Bacteria 1709
618 Ga0496100_0001297 3300048903 Bacteria 12196
619 Ga0496101_0001820 3300048904 Bacteria 12844
620 Ga0496102_0013872 3300048905 Bacteria 6992
621 Ga0496103_0082086 3300048906 Unclassified 2028
622 Ga0496105_0391590 3300048908 Unclassified 1104
623 Ga0496106_0020047 3300048909 Bacteria 4959
624 Ga0496107_0000488 3300048910 Bacteria 21814
625 Ga0496107_0129165 3300048910 Bacteria 1865
626 Ga0496108_0004915 3300048911 Bacteria 10796
627 Ga0496108_0028497 3300048911 Unclassified 4621
628 Ga0496109_0011392 3300048912 Bacteria 7642
629 Ga0496109_0075799 3300048912 Unclassified 3092
630 Ga0496109_0279831 3300048912 Bacteria 1572
631 Ga0496109_0349630 3300048912 Bacteria 1396
632 Ga0496109_0656373 3300048912 Unclassified 986
633 Ga0496110_0001671 3300048913 Bacteria 16272
634 Ga0496111_0011249 3300048914 Bacteria 6023
635 Ga0496111_0094524 3300048914 Bacteria 2192
636 Ga0496112_0261408 3300048915 Unclassified 1680
637 Ga0496113_0116134 3300048916 Unclassified 2088
638 Ga0496113_0325872 3300048916 Unclassified 1231
639 Ga0496114_0000006 3300048917 Bacteria 472921
640 Ga0501069_0157337 3300049585 Bacteria 1308
641 Ga0501201_012335 3300049651 Bacteria 851
642 Ga0501223_025215 3300049663 Unclassified 1157
643 Ga0501227_043720 3300049665 Bacteria 1114
644 Ga0501225_0010778 3300049705 Bacteria 2582
645 Ga0466962_0188118 3300061719 Unclassified 1007
646 JGI24737J22298_10042919
647 MBSR1b_contig_1297016
648 MBSR1b_contig_13888460
649 JGI24740J21852_10002403
650 JGI24739J22299_10006905
651 JGI24739J22299_10012766
652 JGI24739J22299_10026558
653 JGI24739J22299_10044347
654 JGI24735J21928_10002010
655 JGI24735J21928_10005193
656 JGI24735J21928_10034511
657 JGI24745J21846_1001583
658 JGI24738J21930_10014491
659 JGI24744J21845_10000630
660 rootH2_10261940
661 rootL2_10140962
662 rootH1_10175824
663 Ga0070658_10014874
664 Ga0070658_10110147
665 Ga0070658_10133547
666 Ga0070658_10210057
667 Ga0070658_10228672
668 Ga0070676_10146680
669 Ga0070676_10395315
670 Ga0070683_100002629
671 Ga0070683_100030858
672 Ga0070690_100005322
673 Ga0070690_100012753
674 Ga0070690_100223973
675 Ga0070670_100005192
676 Ga0070670_100053449
677 Ga0070677_10096595
678 Ga0070677_10249946
679 Ga0070666_10001302
680 Ga0070666_10026568
681 Ga0070666_10141152
682 Ga0070680_100006378
683 Ga0070680_100015094
684 Ga0070680_100045029
685 Ga0070680_100525080
686 Ga0070680_100526074
687 Ga0070682_100134841
688 Ga0068868_100003463
689 Ga0068868_100054250
690 Ga0068868_100912969
691 Ga0068868_101090935
692 Ga0070660_100003869
693 Ga0070660_100007812
694 Ga0070660_100025386
695 Ga0070660_100037950
696 Ga0070660_100070204
697 Ga0070660_100081511
698 Ga0070660_100174043
699 Ga0070660_100226464
700 Ga0070660_100273824
701 Ga0070660_100282701
702 Ga0070661_100002823
703 Ga0070661_100005291
704 Ga0070661_100006530
705 Ga0070661_100013143
706 Ga0070661_100045009
707 Ga0070661_100050041
708 Ga0070661_100062736
709 Ga0070661_100113973
710 Ga0070661_100292560
711 Ga0070668_100344277
712 Ga0070669_100335419
713 Ga0070675_100002093
714 Ga0070675_100173112
715 Ga0070671_100000585
716 Ga0070671_100001443
717 Ga0070671_100022690
718 Ga0070671_100044584
719 Ga0070671_100057513
720 Ga0070671_100111029
721 Ga0070671_100117386
722 Ga0070671_100316553
723 Ga0070671_100949568
724 Ga0070674_100006154
725 Ga0070674_100453527
726 Ga0070673_100000518
727 Ga0070673_100001113
728 Ga0070673_100719846
729 Ga0070659_100005596
730 Ga0070659_100017205
731 Ga0070659_100019036
732 Ga0070659_100021733
733 Ga0070659_100024954
734 Ga0070659_100042674
735 Ga0070659_100250631
736 Ga0070659_100326022
737 Ga0070667_100012961
738 Ga0070667_100112420
739 Ga0070667_100452927
740 Ga0070714_100002190
741 Ga0070714_100023812
742 Ga0070713_100064565
743 Ga0070713_100264901
744 Ga0070663_100009807
745 Ga0070663_100025456
746 Ga0070663_100115539
747 Ga0070663_100538293
748 Ga0070678_100003931
749 Ga0070678_100020631
750 Ga0070678_100150888
751 Ga0070678_100653416
752 Ga0070662_100005816
753 Ga0070662_100008179
754 Ga0070662_100025353
755 Ga0070662_100043033
756 Ga0070662_100059180
757 Ga0070662_100103293
758 Ga0070662_100108640
759 Ga0070662_100137131
760 Ga0070662_101066491
761 Ga0070681_10026188
762 Ga0070681_10186571
763 Ga0070681_10489535
764 Ga0068867_100005952
765 Ga0068867_100355309
766 Ga0070679_100126514
767 Ga0070679_100129843
768 Ga0070679_100280316
769 Ga0070679_100478373
770 Ga0070684_100004092
771 Ga0070684_100043342
772 Ga0068853_100031367
773 Ga0068853_100100044
774 Ga0068853_100117230
775 Ga0068853_100229315
776 Ga0068853_100383372
777 Ga0068853_100421992
778 Ga0070672_100008152
779 Ga0070672_100139790
780 Ga0070672_100289410
781 Ga0070686_100016416
782 Ga0070686_100089690
783 Ga0070665_100001865
784 Ga0070665_100632653
785 Ga0068855_100005824
786 Ga0068855_100006659
787 Ga0068855_100014977
788 Ga0068855_100017060
789 Ga0068855_100133125
790 Ga0068855_100802386
791 Ga0070664_100003503
792 Ga0070664_100004995
793 Ga0070664_100020715
794 Ga0070664_100021899
795 Ga0070664_100088628
796 Ga0070664_100539447
797 Ga0068857_100005367
798 Ga0068857_100008638
799 Ga0068857_100342573
800 Ga0068857_100524603
801 Ga0068854_100005714
802 Ga0068854_100011868
803 Ga0068854_100013435
804 Ga0068854_100043575
805 Ga0068854_100282391
806 Ga0068854_100345931
807 Ga0068856_100092419
808 Ga0068856_100095480
809 Ga0068856_100663484
810 Ga0068852_100007810
811 Ga0068852_100008650
812 Ga0068852_100062081
813 Ga0068852_100067621
814 Ga0068852_100100758
815 Ga0068852_100108071
816 Ga0068852_100262170
817 Ga0068852_100378225
818 Ga0068852_100578630
819 Ga0068852_100807244
820 Ga0068859_100004211
821 Ga0068859_100114502
822 Ga0068864_100002449
823 Ga0068864_100124984
824 Ga0068864_100545710
825 Ga0068864_100695511
826 Ga0068866_10004286
827 Ga0068866_10005540
828 Ga0068866_10153176
829 Ga0068861_100317559
830 Ga0068851_10023519
831 Ga0068851_10030910
832 Ga0068851_10298309
833 Ga0068863_100004949
834 Ga0068863_100118766
835 Ga0068863_100324651
836 Ga0068858_100016957
837 Ga0068858_100050121
838 Ga0068858_100131372
839 Ga0068860_100046428
840 Ga0068860_100422061
841 Ga0081539_10012110
842 Ga0097621_100054597
843 Ga0097621_100421824
844 Ga0068871_100081679
845 Ga0068871_100155028
846 Ga0068871_100462434
847 Ga0097620_100004211
848 Ga0097620_100114501
849 Ga0105251_10106287
850 Ga0105240_10045600
851 Ga0105240_10098372
852 Ga0105240_10160539
853 Ga0105245_10006582
854 Ga0105245_10044171
855 Ga0105245_10065173
856 Ga0105243_10167559
857 Ga0105243_10205041
858 Ga0105241_10592309
859 Ga0105242_10002916
860 Ga0105248_10000864
861 Ga0105248_10013935
862 Ga0105248_10037356
863 Ga0105248_10329159
864 Ga0105237_10049349
865 Ga0105238_10002340
866 Ga0105238_10013299
867 Ga0105238_10096370
868 Ga0105239_10068875
869 Ga0105239_11327088
870 Ga0105239_11483585
871 Ga0105246_10805378
872 Ga0157373_10004072
873 Ga0157373_10008312
874 Ga0157373_10008647
875 Ga0157373_10069909
876 Ga0157373_10086467
877 Ga0157373_10487288
878 Ga0157373_10531554
879 Ga0157371_10008598
880 Ga0157371_10018990
881 Ga0157371_10024427
882 Ga0157371_10035385
883 Ga0157371_10039072
884 Ga0157371_10172622
885 Ga0157371_10561715
886 Ga0157370_10008977
887 Ga0157370_10015649
888 Ga0157370_10016993
889 Ga0157370_10022730
890 Ga0157370_10072735
891 Ga0157370_10116084
892 Ga0157369_10002126
893 Ga0157369_10014353
894 Ga0157369_10056672
895 Ga0157369_10060324
896 Ga0157369_10343321
897 Ga0157369_10589894
898 Ga0157369_11140891
899 Ga0157369_11146045
900 Ga0157369_11307932
901 Ga0157374_10002280
902 Ga0157374_10123330
903 Ga0157374_10240917
904 Ga0157374_10372727
905 Ga0157378_10007867
906 Ga0157378_10007999
907 Ga0157378_10034100
908 Ga0157378_10282423
909 Ga0163162_10030131
910 Ga0163162_10038669
911 Ga0163162_10064407
912 Ga0163162_10147070
913 Ga0163162_10318788
914 Ga0163162_10353316
915 Ga0157372_10001798
916 Ga0157372_10012759
917 Ga0157372_10040118
918 Ga0157372_10165822
919 Ga0157375_10012218
920 Ga0157375_10294531
921 Ga0157375_10400064
922 Ga0163163_10013953
923 Ga0157380_10365206
924 Ga0157377_10013653
925 Ga0157379_10068937
926 Ga0157376_10003176
927 Ga0157376_10424354
928 Ga0163161_10013190
929 Ga0206356_11305088
930 Ga0206353_11863051
931 Ga0207697_10090735
932 Ga0207656_10185259
933 Ga0207682_10005198
934 Ga0207682_10036190
935 Ga0207642_10012037
936 Ga0207642_10072320
937 Ga0207688_10002725
938 Ga0207688_10080895
939 Ga0207680_10000843
940 Ga0207680_10132329
941 Ga0207647_10000652
942 Ga0207647_10000953
943 Ga0207647_10003821
944 Ga0207647_10017333
945 Ga0207647_10018812
946 Ga0207647_10025396
947 Ga0207647_10234379
948 Ga0207647_10282552
949 Ga0207699_10248099
950 Ga0207645_10148415
951 Ga0207643_10021040
952 Ga0207643_10044622
953 Ga0207705_10002376
954 Ga0207705_10004357
955 Ga0207705_10015198
956 Ga0207705_10016676
957 Ga0207705_10047562
958 Ga0207705_10051935
959 Ga0207705_10108859
960 Ga0207705_10112190
961 Ga0207705_10131338
962 Ga0207705_10232015
963 Ga0207705_10265687
964 Ga0207654_10015469
965 Ga0207707_10049788
966 Ga0207707_10072538
967 Ga0207695_10255392
968 Ga0207695_10437388
969 Ga0207671_10039479
970 Ga0207693_10069915
971 Ga0207660_10065754
972 Ga0207660_10249031
973 Ga0207660_10701695
974 Ga0207662_10006219
975 Ga0207657_10004145
976 Ga0207657_10007353
977 Ga0207657_10014910
978 Ga0207657_10015203
979 Ga0207657_10017538
980 Ga0207657_10019117
981 Ga0207657_10034185
982 Ga0207657_10087508
983 Ga0207657_10103551
984 Ga0207657_10105640
985 Ga0207657_10112714
986 Ga0207657_10499690
987 Ga0207649_10019824
988 Ga0207649_10033103
989 Ga0207649_10034491
990 Ga0207649_10049691
991 Ga0207649_10071710
992 Ga0207649_10120981
993 Ga0207649_10129138
994 Ga0207649_10251820
995 Ga0207649_10403100
996 Ga0207652_10010377
997 Ga0207652_10019231
998 Ga0207652_10248124
999 Ga0207652_10648343
1000 Ga0207650_10009857
1001 Ga0207650_10018530
1002 Ga0207650_10728501
1003 Ga0207650_10858499
1004 Ga0207659_10049306
1005 Ga0207687_10030895
1006 Ga0207700_10023556
1007 Ga0207664_10017766
1008 Ga0207664_10060049
1009 Ga0207644_10000110
1010 Ga0207644_10002394
1011 Ga0207644_10002765
1012 Ga0207644_10022898
1013 Ga0207644_10116021
1014 Ga0207644_10126324
1015 Ga0207644_10131711
1016 Ga0207644_10218257
1017 Ga0207644_10409776
1018 Ga0207690_10002722
1019 Ga0207690_10003887
1020 Ga0207690_10052271
1021 Ga0207690_10134744
1022 Ga0207690_10232934
1023 Ga0207706_10005674
1024 Ga0207706_10027754
1025 Ga0207706_10086196
1026 Ga0207706_10139498
1027 Ga0207706_10143644
1028 Ga0207706_10170088
1029 Ga0207706_10198767
1030 Ga0207706_10250631
1031 Ga0207686_10052215
1032 Ga0207669_10029521
1033 Ga0207669_10066421
1034 Ga0207669_10663310
1035 Ga0207704_10099953
1036 Ga0207665_10110000
1037 Ga0207691_10022908
1038 Ga0207691_10027006
1039 Ga0207691_10027220
1040 Ga0207691_10097130
1041 Ga0207691_10142614
1042 Ga0207711_10001548
1043 Ga0207711_10001690
1044 Ga0207711_10001939
1045 Ga0207711_10003618
1046 Ga0207711_10006835
1047 Ga0207689_10061878
1048 Ga0207661_10001486
1049 Ga0207661_10038561
1050 Ga0207679_10051391
1051 Ga0207679_10052316
1052 Ga0207679_10071392
1053 Ga0207679_10178808
1054 Ga0207679_10517518
1055 Ga0207667_10004629
1056 Ga0207667_10005521
1057 Ga0207667_10012704
1058 Ga0207667_10030071
1059 Ga0207667_10046947
1060 Ga0207667_10286408
1061 Ga0207667_10428971
1062 Ga0207651_10010963
1063 Ga0207651_10029727
1064 Ga0207640_10011846
1065 Ga0207640_10020089
1066 Ga0207640_10064446
1067 Ga0207640_10235621
1068 Ga0207640_10281278
1069 Ga0207640_10424413
1070 Ga0207658_10002182
1071 Ga0207658_10085750
1072 Ga0207658_10154442
1073 Ga0207677_10003094
1074 Ga0207677_10105748
1075 Ga0207677_10402301
1076 Ga0207703_10011174
1077 Ga0207703_10266045
1078 Ga0207703_11501286
1079 Ga0207639_10027601
1080 Ga0207639_10048394
1081 Ga0207639_10234842
1082 Ga0207639_10362176
1083 Ga0207639_11004287
1084 Ga0207678_10003264
1085 Ga0207678_10007049
1086 Ga0207678_10007874
1087 Ga0207678_10021167
1088 Ga0207678_10021916
1089 Ga0207678_10033391
1090 Ga0207678_10586382
1091 Ga0207702_10005931
1092 Ga0207702_10018054
1093 Ga0207702_10749481
1094 Ga0207641_10115912
1095 Ga0207641_10316134
1096 Ga0207641_10807694
1097 Ga0207648_10003640
1098 Ga0207648_10037185
1099 Ga0207676_10007387
1100 Ga0207676_10130076
1101 Ga0207676_10461405
1102 Ga0207674_10002992
1103 Ga0207674_10007460
1104 Ga0207674_10078538
1105 Ga0207674_10243247
1106 Ga0207674_10532959
1107 Ga0207675_100035806
1108 Ga0207683_10001954
1109 Ga0207683_10007409
1110 Ga0207683_10014754
1111 Ga0207683_10146387
1112 Ga0207698_10004870
1113 Ga0207698_10007906
1114 Ga0207698_10036417
1115 Ga0207698_10083077
1116 Ga0207698_10105969
1117 Ga0207698_10283411
1118 Ga0207698_10360435
1119 Ga0207698_10432017
1120 Ga0207698_10604218
1121 Ga0207698_10699788
1122 Ga0207698_11281133
1123 Ga0268266_10561392
1124 Ga0268264_10126419
1125 Ga0268264_10126555
1126 Ga0307408_100008775
1127 Ga0307405_10006643
1128 Ga0307405_10102577
1129 Ga0307413_10013570
1130 Ga0307413_10120075
1131 Ga0307413_10481807
1132 Ga0307410_10005503
1133 Ga0307410_10092286
1134 Ga0307410_10326677
1135 Ga0307406_10030120
1136 Ga0307406_10052865
1137 Ga0307407_10060432
1138 Ga0307412_10013895
1139 Ga0307412_10154569
1140 Ga0307409_100005694
1141 Ga0307409_100226076
1142 Ga0307416_100016023
1143 Ga0307416_100019565
1144 Ga0307416_100122851
1145 Ga0307414_10035268
1146 Ga0307414_10868799
1147 Ga0307411_10024827
1148 Ga0307411_10232881
1149 Ga0307415_100008308
1150 Ga0307415_100009449
1151 Ga0307415_100223658
1152 Ga0373946_0030460
1153 Ga0373931_0048019
1154 Ga0373935_0014000
1155 Ga0373947_0021896
1156 Ga0373925_0399294
1157 Ga0395899_0000274
1158 Ga0395899_0013744
1159 Ga0395899_0018865
1160 Ga0395899_0022022
1161 Ga0395899_0038774
1162 Ga0395899_0043264
1163 Ga0395899_0056578
1164 Ga0395899_0070897
1165 Ga0395899_0085878
1166 Ga0395899_0115094
1167 Ga0395899_0125702
1168 Ga0395899_0179765
1169 Ga0395900_0000595
1170 Ga0395900_0004150
1171 Ga0395900_0018303
1172 Ga0395900_0021697
1173 Ga0395900_0046219
1174 Ga0395900_0065619
1175 Ga0395900_0075993
1176 Ga0395900_0076541
1177 Ga0395900_0128536
1178 Ga0395900_0131492
1179 Ga0395900_0190363
1180 Ga0395900_0295802
1181 Ga0395900_0313818
1182 Ga0395900_0363748
1183 Ga0395900_0474290
1184 Ga0395900_1152973
1185 Ga0395898_0005114
1186 Ga0395898_0006829
1187 Ga0395898_0017203
1188 Ga0395898_0017744
1189 Ga0395898_0049227
1190 Ga0395898_0050768
1191 Ga0395898_0061040
1192 Ga0395898_0106111
1193 Ga0395898_0113466
1194 Ga0395898_0114951
1195 Ga0395898_0184567
1196 Ga0395898_0200060
1197 Ga0395898_0403965
1198 Ga0395898_0951202
1199 Ga0395905_0002328
1200 Ga0395905_0003746
1201 Ga0395905_0010952
1202 Ga0395905_0011179
1203 Ga0395905_0017132
1204 Ga0395905_0021701
1205 Ga0395905_0030485
1206 Ga0395905_0050891
1207 Ga0395905_0052491
1208 Ga0395905_0119707
1209 Ga0395905_0141293
1210 Ga0395905_0160654
1211 Ga0395905_0246702
1212 Ga0395905_0278549
1213 Ga0395905_0290204
1214 Ga0395905_0429134
1215 Ga0395905_0912460
1216 Ga0395901_0001391
1217 Ga0395901_0005012
1218 Ga0395901_0005682
1219 Ga0395901_0007094
1220 Ga0395901_0012920
1221 Ga0395901_0039018
1222 Ga0395901_0080083
1223 Ga0395901_0080413
1224 Ga0395901_0082438
1225 Ga0395901_0118824
1226 Ga0395901_0291162
1227 Ga0395901_0301711
1228 Ga0395901_0658451
1229 Ga0395901_0680966
1230 Ga0395901_1139394
1231 Ga0436365_0736792
1232 Ga0439448_0002283
1233 Ga0439458_0001082
1234 Ga0466965_0020932
1235 Ga0466966_0038977
1236 Ga0466966_0230991
1237 Ga0466961_0054393
1238 Ga0466961_0169047
1239 Ga0466961_0198862
1240 Ga0466963_0207185
1241 Ga0466963_0359408
1242 Ga0466963_0572762
1243 Ga0466964_0012707
1244 Ga0466971_0069518
1245 Ga0466970_0005408
1246 Ga0466970_0193586
1247 Ga0466970_0226551
1248 Ga0466970_0280565
1249 Ga0466957_0087909
1250 Ga0466957_0435089
1251 Ga0466960_0399578
1252 Ga0466959_0031093
1253 Ga0466959_0038450
1254 Ga0466958_0011871
1255 Ga0466958_0034898
1256 Ga0466958_0155321
1257 Ga0466967_0176085
1258 Ga0466967_0775343
1259 Ga0495669_0070262
1260 Ga0495669_0091710
1261 Ga0495677_0036977
1262 Ga0495677_0040249
1263 Ga0496100_0001297
1264 Ga0496101_0001820
1265 Ga0496102_0013872
1266 Ga0496103_0082086
1267 Ga0496105_0391590
1268 Ga0496106_0020047
1269 Ga0496107_0000488
1270 Ga0496107_0129165
1271 Ga0496108_0004915
1272 Ga0496108_0028497
1273 Ga0496109_0011392
1274 Ga0496109_0075799
1275 Ga0496109_0279831
1276 Ga0496109_0349630
1277 Ga0496109_0656373
1278 Ga0496110_0001671
1279 Ga0496111_0011249
1280 Ga0496111_0094524
1281 Ga0496112_0261408
1282 Ga0496113_0116134
1283 Ga0496113_0325872
1284 Ga0496114_0000006
1285 Ga0501069_0157337
1286 Ga0501201_012335
1287 Ga0501223_025215
1288 Ga0501227_043720
1289 Ga0501225_0010778
1290 Ga0466962_0188118

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02563

Poly_export

Polysaccharide biosynthesis/export protein

56

134

0.91

Map