F472090
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 645 | 205 | 1290 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300001990|JGI24737J22298_10042919|JGI24737J22298_100429192 |
| Length | 225 |
| Sequence | VQPNRRPAVCLLVDMCQKGTAVIGWLLARMIMACSLVSVSMAAAAQAPLSVPPSATVSGTPYRINPGDELEILVWGDERLQRGVLVLPDGTFAFPLVGQVNAAGRLPSEIERVITAGLQPQYKGPVPQVTVSVKKASGYQFSVVGKVRNPGTFTPGRYVNALEALAIAGGPAEFANPGGARVIRKAGDQLFVVPVRLQDALRGDTARLGPNDIPRIESGDTLVVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 171 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 172 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 175 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 176 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 177 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 178 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 192 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 193 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 199 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 200 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 202 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 203 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 204 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 205 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.41 |
| Rhizosphere | 95.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 28.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10042919 | 3300001990 | Bacteria | 1385 |
| 2 | MBSR1b_contig_1297016 | 2162886012 | Bacteria | 930 |
| 3 | MBSR1b_contig_13888460 | 2162886012 | Bacteria | 911 |
| 4 | JGI24740J21852_10002403 | 3300001979 | Bacteria | 8507 |
| 5 | JGI24739J22299_10006905 | 3300001989 | Bacteria | 4276 |
| 6 | JGI24739J22299_10012766 | 3300001989 | Bacteria | 3079 |
| 7 | JGI24739J22299_10026558 | 3300001989 | Unclassified | 2031 |
| 8 | JGI24739J22299_10044347 | 3300001989 | Unclassified | 1465 |
| 9 | JGI24735J21928_10002010 | 3300002067 | Bacteria | 7153 |
| 10 | JGI24735J21928_10005193 | 3300002067 | Bacteria | 4331 |
| 11 | JGI24735J21928_10034511 | 3300002067 | Bacteria | 1491 |
| 12 | JGI24745J21846_1001583 | 3300002073 | Bacteria | 2226 |
| 13 | JGI24738J21930_10014491 | 3300002075 | Unclassified | 1691 |
| 14 | JGI24744J21845_10000630 | 3300002077 | Bacteria | 6428 |
| 15 | rootH2_10261940 | 3300003320 | Unclassified | 1350 |
| 16 | rootL2_10140962 | 3300003322 | Unclassified | 1945 |
| 17 | rootH1_10175824 | 3300003323 | Unclassified | 1803 |
| 18 | Ga0070658_10014874 | 3300005327 | Bacteria | 6234 |
| 19 | Ga0070658_10110147 | 3300005327 | Bacteria | 2280 |
| 20 | Ga0070658_10133547 | 3300005327 | Bacteria | 2069 |
| 21 | Ga0070658_10210057 | 3300005327 | Unclassified | 1644 |
| 22 | Ga0070658_10228672 | 3300005327 | Bacteria | 1574 |
| 23 | Ga0070676_10146680 | 3300005328 | Unclassified | 1507 |
| 24 | Ga0070676_10395315 | 3300005328 | Unclassified | 960 |
| 25 | Ga0070683_100002629 | 3300005329 | Bacteria | 14360 |
| 26 | Ga0070683_100030858 | 3300005329 | Bacteria | 4869 |
| 27 | Ga0070690_100005322 | 3300005330 | Bacteria | 7222 |
| 28 | Ga0070690_100012753 | 3300005330 | Bacteria | 4950 |
| 29 | Ga0070690_100223973 | 3300005330 | Unclassified | 1319 |
| 30 | Ga0070670_100005192 | 3300005331 | Bacteria | 10964 |
| 31 | Ga0070670_100053449 | 3300005331 | Unclassified | 3468 |
| 32 | Ga0070677_10096595 | 3300005333 | Bacteria | 1295 |
| 33 | Ga0070677_10249946 | 3300005333 | Unclassified | 880 |
| 34 | Ga0070666_10001302 | 3300005335 | Bacteria | 15102 |
| 35 | Ga0070666_10026568 | 3300005335 | Unclassified | 3784 |
| 36 | Ga0070666_10141152 | 3300005335 | Unclassified | 1678 |
| 37 | Ga0070680_100006378 | 3300005336 | Bacteria | 8960 |
| 38 | Ga0070680_100015094 | 3300005336 | Bacteria | 6048 |
| 39 | Ga0070680_100045029 | 3300005336 | Unclassified | 3586 |
| 40 | Ga0070680_100525080 | 3300005336 | Bacteria | 1014 |
| 41 | Ga0070680_100526074 | 3300005336 | Unclassified | 1013 |
| 42 | Ga0070682_100134841 | 3300005337 | Unclassified | 1676 |
| 43 | Ga0068868_100003463 | 3300005338 | Bacteria | 10990 |
| 44 | Ga0068868_100054250 | 3300005338 | Unclassified | 3158 |
| 45 | Ga0068868_100912969 | 3300005338 | Bacteria | 799 |
| 46 | Ga0068868_101090935 | 3300005338 | Unclassified | 734 |
| 47 | Ga0070660_100003869 | 3300005339 | Bacteria | 10336 |
| 48 | Ga0070660_100007812 | 3300005339 | Bacteria | 7459 |
| 49 | Ga0070660_100025386 | 3300005339 | Bacteria | 4405 |
| 50 | Ga0070660_100037950 | 3300005339 | Bacteria | 3654 |
| 51 | Ga0070660_100070204 | 3300005339 | Bacteria | 2733 |
| 52 | Ga0070660_100081511 | 3300005339 | Unclassified | 2540 |
| 53 | Ga0070660_100174043 | 3300005339 | Bacteria | 1740 |
| 54 | Ga0070660_100226464 | 3300005339 | Unclassified | 1520 |
| 55 | Ga0070660_100273824 | 3300005339 | Bacteria | 1380 |
| 56 | Ga0070660_100282701 | 3300005339 | Unclassified | 1358 |
| 57 | Ga0070661_100002823 | 3300005344 | Bacteria | 11943 |
| 58 | Ga0070661_100005291 | 3300005344 | Bacteria | 8893 |
| 59 | Ga0070661_100006530 | 3300005344 | Bacteria | 8047 |
| 60 | Ga0070661_100013143 | 3300005344 | Bacteria | 5809 |
| 61 | Ga0070661_100045009 | 3300005344 | Bacteria | 3225 |
| 62 | Ga0070661_100050041 | 3300005344 | Bacteria | 3058 |
| 63 | Ga0070661_100062736 | 3300005344 | Bacteria | 2728 |
| 64 | Ga0070661_100113973 | 3300005344 | Unclassified | 2020 |
| 65 | Ga0070661_100292560 | 3300005344 | Unclassified | 1266 |
| 66 | Ga0070668_100344277 | 3300005347 | Bacteria | 1260 |
| 67 | Ga0070669_100335419 | 3300005353 | Bacteria | 1224 |
| 68 | Ga0070675_100002093 | 3300005354 | Bacteria | 14774 |
| 69 | Ga0070675_100173112 | 3300005354 | Unclassified | 1863 |
| 70 | Ga0070671_100000585 | 3300005355 | Bacteria | 25984 |
| 71 | Ga0070671_100001443 | 3300005355 | Bacteria | 17754 |
| 72 | Ga0070671_100022690 | 3300005355 | Bacteria | 5127 |
| 73 | Ga0070671_100044584 | 3300005355 | Bacteria | 3685 |
| 74 | Ga0070671_100057513 | 3300005355 | Plasmid | 3236 |
| 75 | Ga0070671_100111029 | 3300005355 | Bacteria | 2303 |
| 76 | Ga0070671_100117386 | 3300005355 | Unclassified | 2237 |
| 77 | Ga0070671_100316553 | 3300005355 | Unclassified | 1329 |
| 78 | Ga0070671_100949568 | 3300005355 | Bacteria | 752 |
| 79 | Ga0070674_100006154 | 3300005356 | Bacteria | 6976 |
| 80 | Ga0070674_100453527 | 3300005356 | Unclassified | 1059 |
| 81 | Ga0070673_100000518 | 3300005364 | Bacteria | 20675 |
| 82 | Ga0070673_100001113 | 3300005364 | Bacteria | 15429 |
| 83 | Ga0070673_100719846 | 3300005364 | Bacteria | 917 |
| 84 | Ga0070659_100005596 | 3300005366 | Bacteria | 9030 |
| 85 | Ga0070659_100017205 | 3300005366 | Bacteria | 5435 |
| 86 | Ga0070659_100019036 | 3300005366 | Bacteria | 5192 |
| 87 | Ga0070659_100021733 | 3300005366 | Bacteria | 4892 |
| 88 | Ga0070659_100024954 | 3300005366 | Bacteria | 4587 |
| 89 | Ga0070659_100042674 | 3300005366 | Bacteria | 3546 |
| 90 | Ga0070659_100250631 | 3300005366 | Unclassified | 1467 |
| 91 | Ga0070659_100326022 | 3300005366 | Bacteria | 1284 |
| 92 | Ga0070667_100012961 | 3300005367 | Bacteria | 6894 |
| 93 | Ga0070667_100112420 | 3300005367 | Bacteria | 2362 |
| 94 | Ga0070667_100452927 | 3300005367 | Unclassified | 1173 |
| 95 | Ga0070714_100002190 | 3300005435 | Bacteria | 14377 |
| 96 | Ga0070714_100023812 | 3300005435 | Bacteria | 5035 |
| 97 | Ga0070713_100064565 | 3300005436 | Bacteria | 3073 |
| 98 | Ga0070713_100264901 | 3300005436 | Unclassified | 1572 |
| 99 | Ga0070663_100009807 | 3300005455 | Bacteria | 5949 |
| 100 | Ga0070663_100025456 | 3300005455 | Bacteria | 3996 |
| 101 | Ga0070663_100115539 | 3300005455 | Bacteria | 2022 |
| 102 | Ga0070663_100538293 | 3300005455 | Bacteria | 974 |
| 103 | Ga0070678_100003931 | 3300005456 | Bacteria | 8357 |
| 104 | Ga0070678_100020631 | 3300005456 | Unclassified | 4327 |
| 105 | Ga0070678_100150888 | 3300005456 | Unclassified | 1872 |
| 106 | Ga0070678_100653416 | 3300005456 | Unclassified | 943 |
| 107 | Ga0070662_100005816 | 3300005457 | Bacteria | 7909 |
| 108 | Ga0070662_100008179 | 3300005457 | Bacteria | 6812 |
| 109 | Ga0070662_100025353 | 3300005457 | Unclassified | 4094 |
| 110 | Ga0070662_100043033 | 3300005457 | Bacteria | 3229 |
| 111 | Ga0070662_100059180 | 3300005457 | Unclassified | 2790 |
| 112 | Ga0070662_100103293 | 3300005457 | Bacteria | 2161 |
| 113 | Ga0070662_100108640 | 3300005457 | Bacteria | 2110 |
| 114 | Ga0070662_100137131 | 3300005457 | Unclassified | 1893 |
| 115 | Ga0070662_101066491 | 3300005457 | Bacteria | 693 |
| 116 | Ga0070681_10026188 | 3300005458 | Bacteria | 5863 |
| 117 | Ga0070681_10186571 | 3300005458 | Bacteria | 1994 |
| 118 | Ga0070681_10489535 | 3300005458 | Bacteria | 1143 |
| 119 | Ga0068867_100005952 | 3300005459 | Bacteria | 8650 |
| 120 | Ga0068867_100355309 | 3300005459 | Bacteria | 1224 |
| 121 | Ga0070679_100126514 | 3300005530 | Bacteria | 2538 |
| 122 | Ga0070679_100129843 | 3300005530 | Unclassified | 2501 |
| 123 | Ga0070679_100280316 | 3300005530 | Bacteria | 1619 |
| 124 | Ga0070679_100478373 | 3300005530 | Bacteria | 1190 |
| 125 | Ga0070684_100004092 | 3300005535 | Bacteria | 11038 |
| 126 | Ga0070684_100043342 | 3300005535 | Bacteria | 3885 |
| 127 | Ga0068853_100031367 | 3300005539 | Bacteria | 4495 |
| 128 | Ga0068853_100100044 | 3300005539 | Bacteria | 2562 |
| 129 | Ga0068853_100117230 | 3300005539 | Bacteria | 2371 |
| 130 | Ga0068853_100229315 | 3300005539 | Bacteria | 1698 |
| 131 | Ga0068853_100383372 | 3300005539 | Bacteria | 1313 |
| 132 | Ga0068853_100421992 | 3300005539 | Unclassified | 1251 |
| 133 | Ga0070672_100008152 | 3300005543 | Bacteria | 7161 |
| 134 | Ga0070672_100139790 | 3300005543 | Bacteria | 1997 |
| 135 | Ga0070672_100289410 | 3300005543 | Unclassified | 1387 |
| 136 | Ga0070686_100016416 | 3300005544 | Bacteria | 4309 |
| 137 | Ga0070686_100089690 | 3300005544 | Bacteria | 2054 |
| 138 | Ga0070665_100001865 | 3300005548 | Bacteria | 23913 |
| 139 | Ga0070665_100632653 | 3300005548 | Bacteria | 1083 |
| 140 | Ga0068855_100005824 | 3300005563 | Bacteria | 15041 |
| 141 | Ga0068855_100006659 | 3300005563 | Bacteria | 14033 |
| 142 | Ga0068855_100014977 | 3300005563 | Bacteria | 9340 |
| 143 | Ga0068855_100017060 | 3300005563 | Bacteria | 8734 |
| 144 | Ga0068855_100133125 | 3300005563 | Unclassified | 2838 |
| 145 | Ga0068855_100802386 | 3300005563 | Bacteria | 1000 |
| 146 | Ga0070664_100003503 | 3300005564 | Bacteria | 12676 |
| 147 | Ga0070664_100004995 | 3300005564 | Bacteria | 10628 |
| 148 | Ga0070664_100020715 | 3300005564 | Bacteria | 5415 |
| 149 | Ga0070664_100021899 | 3300005564 | Bacteria | 5269 |
| 150 | Ga0070664_100088628 | 3300005564 | Bacteria | 2675 |
| 151 | Ga0070664_100539447 | 3300005564 | Unclassified | 1078 |
| 152 | Ga0068857_100005367 | 3300005577 | Bacteria | 10928 |
| 153 | Ga0068857_100008638 | 3300005577 | Bacteria | 8815 |
| 154 | Ga0068857_100342573 | 3300005577 | Bacteria | 1383 |
| 155 | Ga0068857_100524603 | 3300005577 | Unclassified | 1113 |
| 156 | Ga0068854_100005714 | 3300005578 | Bacteria | 7860 |
| 157 | Ga0068854_100011868 | 3300005578 | Bacteria | 5690 |
| 158 | Ga0068854_100013435 | 3300005578 | Bacteria | 5375 |
| 159 | Ga0068854_100043575 | 3300005578 | Bacteria | 3181 |
| 160 | Ga0068854_100282391 | 3300005578 | Bacteria | 1337 |
| 161 | Ga0068854_100345931 | 3300005578 | Unclassified | 1215 |
| 162 | Ga0068856_100092419 | 3300005614 | Unclassified | 3011 |
| 163 | Ga0068856_100095480 | 3300005614 | Bacteria | 2961 |
| 164 | Ga0068856_100663484 | 3300005614 | Bacteria | 1063 |
| 165 | Ga0068852_100007810 | 3300005616 | Bacteria | 7833 |
| 166 | Ga0068852_100008650 | 3300005616 | Bacteria | 7522 |
| 167 | Ga0068852_100062081 | 3300005616 | Bacteria | 3249 |
| 168 | Ga0068852_100067621 | 3300005616 | Bacteria | 3124 |
| 169 | Ga0068852_100100758 | 3300005616 | Bacteria | 2607 |
| 170 | Ga0068852_100108071 | 3300005616 | Unclassified | 2525 |
| 171 | Ga0068852_100262170 | 3300005616 | Unclassified | 1660 |
| 172 | Ga0068852_100378225 | 3300005616 | Unclassified | 1389 |
| 173 | Ga0068852_100578630 | 3300005616 | Bacteria | 1125 |
| 174 | Ga0068852_100807244 | 3300005616 | Unclassified | 952 |
| 175 | Ga0068859_100004211 | 3300005617 | Bacteria | 14677 |
| 176 | Ga0068859_100114502 | 3300005617 | Unclassified | 2761 |
| 177 | Ga0068864_100002449 | 3300005618 | Bacteria | 15334 |
| 178 | Ga0068864_100124984 | 3300005618 | Bacteria | 2304 |
| 179 | Ga0068864_100545710 | 3300005618 | Bacteria | 1120 |
| 180 | Ga0068864_100695511 | 3300005618 | Unclassified | 993 |
| 181 | Ga0068866_10004286 | 3300005718 | Bacteria | 5859 |
| 182 | Ga0068866_10005540 | 3300005718 | Bacteria | 5216 |
| 183 | Ga0068866_10153176 | 3300005718 | Unclassified | 1337 |
| 184 | Ga0068861_100317559 | 3300005719 | Bacteria | 1356 |
| 185 | Ga0068851_10023519 | 3300005834 | Bacteria | 3012 |
| 186 | Ga0068851_10030910 | 3300005834 | Bacteria | 2657 |
| 187 | Ga0068851_10298309 | 3300005834 | Bacteria | 926 |
| 188 | Ga0068863_100004949 | 3300005841 | Bacteria | 13136 |
| 189 | Ga0068863_100118766 | 3300005841 | Unclassified | 2520 |
| 190 | Ga0068863_100324651 | 3300005841 | Bacteria | 1495 |
| 191 | Ga0068858_100016957 | 3300005842 | Bacteria | 6838 |
| 192 | Ga0068858_100050121 | 3300005842 | Unclassified | 3864 |
| 193 | Ga0068858_100131372 | 3300005842 | Unclassified | 2348 |
| 194 | Ga0068860_100046428 | 3300005843 | Unclassified | 4141 |
| 195 | Ga0068860_100422061 | 3300005843 | Bacteria | 1322 |
| 196 | Ga0081539_10012110 | 3300005985 | Bacteria | 6702 |
| 197 | Ga0097621_100054597 | 3300006237 | Bacteria | 3259 |
| 198 | Ga0097621_100421824 | 3300006237 | Bacteria | 1198 |
| 199 | Ga0068871_100081679 | 3300006358 | Unclassified | 2678 |
| 200 | Ga0068871_100155028 | 3300006358 | Bacteria | 1955 |
| 201 | Ga0068871_100462434 | 3300006358 | Bacteria | 1139 |
| 202 | Ga0097620_100004211 | 3300006931 | Bacteria | 14677 |
| 203 | Ga0097620_100114501 | 3300006931 | Unclassified | 2761 |
| 204 | Ga0105251_10106287 | 3300009011 | Unclassified | 1281 |
| 205 | Ga0105240_10045600 | 3300009093 | Bacteria | 5560 |
| 206 | Ga0105240_10098372 | 3300009093 | Unclassified | 3563 |
| 207 | Ga0105240_10160539 | 3300009093 | Bacteria | 2670 |
| 208 | Ga0105245_10006582 | 3300009098 | Bacteria | 10199 |
| 209 | Ga0105245_10044171 | 3300009098 | Bacteria | 3976 |
| 210 | Ga0105245_10065173 | 3300009098 | Bacteria | 3294 |
| 211 | Ga0105243_10167559 | 3300009148 | Bacteria | 1900 |
| 212 | Ga0105243_10205041 | 3300009148 | Unclassified | 1732 |
| 213 | Ga0105241_10592309 | 3300009174 | Unclassified | 1001 |
| 214 | Ga0105242_10002916 | 3300009176 | Bacteria | 13365 |
| 215 | Ga0105248_10000864 | 3300009177 | Bacteria | 34121 |
| 216 | Ga0105248_10013935 | 3300009177 | Bacteria | 8846 |
| 217 | Ga0105248_10037356 | 3300009177 | Bacteria | 5434 |
| 218 | Ga0105248_10329159 | 3300009177 | Bacteria | 1720 |
| 219 | Ga0105237_10049349 | 3300009545 | Bacteria | 4231 |
| 220 | Ga0105238_10002340 | 3300009551 | Bacteria | 19060 |
| 221 | Ga0105238_10013299 | 3300009551 | Bacteria | 8304 |
| 222 | Ga0105238_10096370 | 3300009551 | Bacteria | 2944 |
| 223 | Ga0105239_10068875 | 3300010375 | Plasmid | 3889 |
| 224 | Ga0105239_11327088 | 3300010375 | Bacteria | 830 |
| 225 | Ga0105239_11483585 | 3300010375 | Bacteria | 783 |
| 226 | Ga0105246_10805378 | 3300011119 | Unclassified | 834 |
| 227 | Ga0157373_10004072 | 3300013100 | Bacteria | 11014 |
| 228 | Ga0157373_10008312 | 3300013100 | Bacteria | 7711 |
| 229 | Ga0157373_10008647 | 3300013100 | Bacteria | 7554 |
| 230 | Ga0157373_10069909 | 3300013100 | Unclassified | 2481 |
| 231 | Ga0157373_10086467 | 3300013100 | Bacteria | 2209 |
| 232 | Ga0157373_10487288 | 3300013100 | Bacteria | 890 |
| 233 | Ga0157373_10531554 | 3300013100 | Bacteria | 851 |
| 234 | Ga0157371_10008598 | 3300013102 | Bacteria | 8109 |
| 235 | Ga0157371_10018990 | 3300013102 | Bacteria | 5074 |
| 236 | Ga0157371_10024427 | 3300013102 | Bacteria | 4413 |
| 237 | Ga0157371_10035385 | 3300013102 | Bacteria | 3578 |
| 238 | Ga0157371_10039072 | 3300013102 | Unclassified | 3395 |
| 239 | Ga0157371_10172622 | 3300013102 | Bacteria | 1545 |
| 240 | Ga0157371_10561715 | 3300013102 | Bacteria | 846 |
| 241 | Ga0157370_10008977 | 3300013104 | Bacteria | 10729 |
| 242 | Ga0157370_10015649 | 3300013104 | Bacteria | 7704 |
| 243 | Ga0157370_10016993 | 3300013104 | Bacteria | 7353 |
| 244 | Ga0157370_10022730 | 3300013104 | Bacteria | 6240 |
| 245 | Ga0157370_10072735 | 3300013104 | Bacteria | 3243 |
| 246 | Ga0157370_10116084 | 3300013104 | Bacteria | 2501 |
| 247 | Ga0157369_10002126 | 3300013105 | Bacteria | 23887 |
| 248 | Ga0157369_10014353 | 3300013105 | Bacteria | 8945 |
| 249 | Ga0157369_10056672 | 3300013105 | Bacteria | 4228 |
| 250 | Ga0157369_10060324 | 3300013105 | Bacteria | 4090 |
| 251 | Ga0157369_10343321 | 3300013105 | Bacteria | 1551 |
| 252 | Ga0157369_10589894 | 3300013105 | Bacteria | 1147 |
| 253 | Ga0157369_11140891 | 3300013105 | Bacteria | 796 |
| 254 | Ga0157369_11146045 | 3300013105 | Bacteria | 794 |
| 255 | Ga0157369_11307932 | 3300013105 | Bacteria | 739 |
| 256 | Ga0157374_10002280 | 3300013296 | Bacteria | 16143 |
| 257 | Ga0157374_10123330 | 3300013296 | Bacteria | 2503 |
| 258 | Ga0157374_10240917 | 3300013296 | Unclassified | 1779 |
| 259 | Ga0157374_10372727 | 3300013296 | Unclassified | 1421 |
| 260 | Ga0157378_10007867 | 3300013297 | Bacteria | 9302 |
| 261 | Ga0157378_10007999 | 3300013297 | Bacteria | 9230 |
| 262 | Ga0157378_10034100 | 3300013297 | Bacteria | 4502 |
| 263 | Ga0157378_10282423 | 3300013297 | Unclassified | 1601 |
| 264 | Ga0163162_10030131 | 3300013306 | Bacteria | 5375 |
| 265 | Ga0163162_10038669 | 3300013306 | Unclassified | 4761 |
| 266 | Ga0163162_10064407 | 3300013306 | Bacteria | 3711 |
| 267 | Ga0163162_10147070 | 3300013306 | Bacteria | 2473 |
| 268 | Ga0163162_10318788 | 3300013306 | Unclassified | 1687 |
| 269 | Ga0163162_10353316 | 3300013306 | Bacteria | 1602 |
| 270 | Ga0157372_10001798 | 3300013307 | Bacteria | 23289 |
| 271 | Ga0157372_10012759 | 3300013307 | Bacteria | 8952 |
| 272 | Ga0157372_10040118 | 3300013307 | Bacteria | 5169 |
| 273 | Ga0157372_10165822 | 3300013307 | Unclassified | 2555 |
| 274 | Ga0157375_10012218 | 3300013308 | Bacteria | 7613 |
| 275 | Ga0157375_10294531 | 3300013308 | Unclassified | 1786 |
| 276 | Ga0157375_10400064 | 3300013308 | Bacteria | 1540 |
| 277 | Ga0163163_10013953 | 3300014325 | Bacteria | 7373 |
| 278 | Ga0157380_10365206 | 3300014326 | Bacteria | 1356 |
| 279 | Ga0157377_10013653 | 3300014745 | Bacteria | 4116 |
| 280 | Ga0157379_10068937 | 3300014968 | Unclassified | 3162 |
| 281 | Ga0157376_10003176 | 3300014969 | Bacteria | 11290 |
| 282 | Ga0157376_10424354 | 3300014969 | Unclassified | 1291 |
| 283 | Ga0163161_10013190 | 3300017792 | Bacteria | 5744 |
| 284 | Ga0206356_11305088 | 3300020070 | Bacteria | 1603 |
| 285 | Ga0206353_11863051 | 3300020082 | Bacteria | 1388 |
| 286 | Ga0207697_10090735 | 3300025315 | Unclassified | 1295 |
| 287 | Ga0207656_10185259 | 3300025321 | Unclassified | 1001 |
| 288 | Ga0207682_10005198 | 3300025893 | Bacteria | 5327 |
| 289 | Ga0207682_10036190 | 3300025893 | Unclassified | 1997 |
| 290 | Ga0207642_10012037 | 3300025899 | Unclassified | 3110 |
| 291 | Ga0207642_10072320 | 3300025899 | Bacteria | 1645 |
| 292 | Ga0207688_10002725 | 3300025901 | Bacteria | 9558 |
| 293 | Ga0207688_10080895 | 3300025901 | Unclassified | 1855 |
| 294 | Ga0207680_10000843 | 3300025903 | Bacteria | 14479 |
| 295 | Ga0207680_10132329 | 3300025903 | Unclassified | 1645 |
| 296 | Ga0207647_10000652 | 3300025904 | Bacteria | 27131 |
| 297 | Ga0207647_10000953 | 3300025904 | Bacteria | 22378 |
| 298 | Ga0207647_10003821 | 3300025904 | Bacteria | 11264 |
| 299 | Ga0207647_10017333 | 3300025904 | Bacteria | 4897 |
| 300 | Ga0207647_10018812 | 3300025904 | Bacteria | 4659 |
| 301 | Ga0207647_10025396 | 3300025904 | Unclassified | 3894 |
| 302 | Ga0207647_10234379 | 3300025904 | Unclassified | 1055 |
| 303 | Ga0207647_10282552 | 3300025904 | Bacteria | 947 |
| 304 | Ga0207699_10248099 | 3300025906 | Bacteria | 1226 |
| 305 | Ga0207645_10148415 | 3300025907 | Bacteria | 1530 |
| 306 | Ga0207643_10021040 | 3300025908 | Unclassified | 3582 |
| 307 | Ga0207643_10044622 | 3300025908 | Unclassified | 2503 |
| 308 | Ga0207705_10002376 | 3300025909 | Bacteria | 14545 |
| 309 | Ga0207705_10004357 | 3300025909 | Bacteria | 10702 |
| 310 | Ga0207705_10015198 | 3300025909 | Bacteria | 5531 |
| 311 | Ga0207705_10016676 | 3300025909 | Bacteria | 5261 |
| 312 | Ga0207705_10047562 | 3300025909 | Unclassified | 3085 |
| 313 | Ga0207705_10051935 | 3300025909 | Bacteria | 2950 |
| 314 | Ga0207705_10108859 | 3300025909 | Bacteria | 2045 |
| 315 | Ga0207705_10112190 | 3300025909 | Unclassified | 2015 |
| 316 | Ga0207705_10131338 | 3300025909 | Bacteria | 1864 |
| 317 | Ga0207705_10232015 | 3300025909 | Bacteria | 1404 |
| 318 | Ga0207705_10265687 | 3300025909 | Bacteria | 1311 |
| 319 | Ga0207654_10015469 | 3300025911 | Bacteria | 3961 |
| 320 | Ga0207707_10049788 | 3300025912 | Bacteria | 3650 |
| 321 | Ga0207707_10072538 | 3300025912 | Bacteria | 3001 |
| 322 | Ga0207695_10255392 | 3300025913 | Bacteria | 1652 |
| 323 | Ga0207695_10437388 | 3300025913 | Unclassified | 1192 |
| 324 | Ga0207671_10039479 | 3300025914 | Unclassified | 3495 |
| 325 | Ga0207693_10069915 | 3300025915 | Bacteria | 2747 |
| 326 | Ga0207660_10065754 | 3300025917 | Bacteria | 2621 |
| 327 | Ga0207660_10249031 | 3300025917 | Bacteria | 1402 |
| 328 | Ga0207660_10701695 | 3300025917 | Unclassified | 825 |
| 329 | Ga0207662_10006219 | 3300025918 | Bacteria | 6429 |
| 330 | Ga0207657_10004145 | 3300025919 | Bacteria | 15365 |
| 331 | Ga0207657_10007353 | 3300025919 | Bacteria | 11299 |
| 332 | Ga0207657_10014910 | 3300025919 | Bacteria | 7557 |
| 333 | Ga0207657_10015203 | 3300025919 | Bacteria | 7468 |
| 334 | Ga0207657_10017538 | 3300025919 | Bacteria | 6860 |
| 335 | Ga0207657_10019117 | 3300025919 | Bacteria | 6516 |
| 336 | Ga0207657_10034185 | 3300025919 | Unclassified | 4574 |
| 337 | Ga0207657_10087508 | 3300025919 | Bacteria | 2606 |
| 338 | Ga0207657_10103551 | 3300025919 | Bacteria | 2359 |
| 339 | Ga0207657_10105640 | 3300025919 | Bacteria | 2331 |
| 340 | Ga0207657_10112714 | 3300025919 | Bacteria | 2244 |
| 341 | Ga0207657_10499690 | 3300025919 | Bacteria | 953 |
| 342 | Ga0207649_10019824 | 3300025920 | Bacteria | 3849 |
| 343 | Ga0207649_10033103 | 3300025920 | Unclassified | 3086 |
| 344 | Ga0207649_10034491 | 3300025920 | Bacteria | 3032 |
| 345 | Ga0207649_10049691 | 3300025920 | Bacteria | 2591 |
| 346 | Ga0207649_10071710 | 3300025920 | Bacteria | 2213 |
| 347 | Ga0207649_10120981 | 3300025920 | Unclassified | 1765 |
| 348 | Ga0207649_10129138 | 3300025920 | Bacteria | 1714 |
| 349 | Ga0207649_10251820 | 3300025920 | Bacteria | 1272 |
| 350 | Ga0207649_10403100 | 3300025920 | Bacteria | 1024 |
| 351 | Ga0207652_10010377 | 3300025921 | Bacteria | 7500 |
| 352 | Ga0207652_10019231 | 3300025921 | Bacteria | 5613 |
| 353 | Ga0207652_10248124 | 3300025921 | Unclassified | 1605 |
| 354 | Ga0207652_10648343 | 3300025921 | Unclassified | 944 |
| 355 | Ga0207650_10009857 | 3300025925 | Bacteria | 6535 |
| 356 | Ga0207650_10018530 | 3300025925 | Unclassified | 4885 |
| 357 | Ga0207650_10728501 | 3300025925 | Unclassified | 838 |
| 358 | Ga0207650_10858499 | 3300025925 | Unclassified | 770 |
| 359 | Ga0207659_10049306 | 3300025926 | Bacteria | 2986 |
| 360 | Ga0207687_10030895 | 3300025927 | Bacteria | 3616 |
| 361 | Ga0207700_10023556 | 3300025928 | Bacteria | 4248 |
| 362 | Ga0207664_10017766 | 3300025929 | Bacteria | 5224 |
| 363 | Ga0207664_10060049 | 3300025929 | Bacteria | 3030 |
| 364 | Ga0207644_10000110 | 3300025931 | Bacteria | 60867 |
| 365 | Ga0207644_10002394 | 3300025931 | Bacteria | 12090 |
| 366 | Ga0207644_10002765 | 3300025931 | Bacteria | 11299 |
| 367 | Ga0207644_10022898 | 3300025931 | Unclassified | 4272 |
| 368 | Ga0207644_10116021 | 3300025931 | Bacteria | 2031 |
| 369 | Ga0207644_10126324 | 3300025931 | Bacteria | 1952 |
| 370 | Ga0207644_10131711 | 3300025931 | Bacteria | 1915 |
| 371 | Ga0207644_10218257 | 3300025931 | Bacteria | 1510 |
| 372 | Ga0207644_10409776 | 3300025931 | Unclassified | 1109 |
| 373 | Ga0207690_10002722 | 3300025932 | Bacteria | 10672 |
| 374 | Ga0207690_10003887 | 3300025932 | Bacteria | 8831 |
| 375 | Ga0207690_10052271 | 3300025932 | Unclassified | 2736 |
| 376 | Ga0207690_10134744 | 3300025932 | Bacteria | 1812 |
| 377 | Ga0207690_10232934 | 3300025932 | Unclassified | 1415 |
| 378 | Ga0207706_10005674 | 3300025933 | Bacteria | 11630 |
| 379 | Ga0207706_10027754 | 3300025933 | Bacteria | 5060 |
| 380 | Ga0207706_10086196 | 3300025933 | Bacteria | 2760 |
| 381 | Ga0207706_10139498 | 3300025933 | Bacteria | 2132 |
| 382 | Ga0207706_10143644 | 3300025933 | Unclassified | 2099 |
| 383 | Ga0207706_10170088 | 3300025933 | Bacteria | 1915 |
| 384 | Ga0207706_10198767 | 3300025933 | Unclassified | 1758 |
| 385 | Ga0207706_10250631 | 3300025933 | Bacteria | 1547 |
| 386 | Ga0207686_10052215 | 3300025934 | Unclassified | 2550 |
| 387 | Ga0207669_10029521 | 3300025937 | Bacteria | 3034 |
| 388 | Ga0207669_10066421 | 3300025937 | Bacteria | 2242 |
| 389 | Ga0207669_10663310 | 3300025937 | Unclassified | 854 |
| 390 | Ga0207704_10099953 | 3300025938 | Unclassified | 1931 |
| 391 | Ga0207665_10110000 | 3300025939 | Unclassified | 1935 |
| 392 | Ga0207691_10022908 | 3300025940 | Bacteria | 5886 |
| 393 | Ga0207691_10027006 | 3300025940 | Bacteria | 5386 |
| 394 | Ga0207691_10027220 | 3300025940 | Bacteria | 5363 |
| 395 | Ga0207691_10097130 | 3300025940 | Unclassified | 2633 |
| 396 | Ga0207691_10142614 | 3300025940 | Bacteria | 2110 |
| 397 | Ga0207711_10001548 | 3300025941 | Bacteria | 21289 |
| 398 | Ga0207711_10001690 | 3300025941 | Bacteria | 20318 |
| 399 | Ga0207711_10001939 | 3300025941 | Bacteria | 18783 |
| 400 | Ga0207711_10003618 | 3300025941 | Bacteria | 13372 |
| 401 | Ga0207711_10006835 | 3300025941 | Bacteria | 9589 |
| 402 | Ga0207689_10061878 | 3300025942 | Bacteria | 3079 |
| 403 | Ga0207661_10001486 | 3300025944 | Bacteria | 15865 |
| 404 | Ga0207661_10038561 | 3300025944 | Bacteria | 3746 |
| 405 | Ga0207679_10051391 | 3300025945 | Bacteria | 3017 |
| 406 | Ga0207679_10052316 | 3300025945 | Unclassified | 2994 |
| 407 | Ga0207679_10071392 | 3300025945 | Bacteria | 2619 |
| 408 | Ga0207679_10178808 | 3300025945 | Bacteria | 1753 |
| 409 | Ga0207679_10517518 | 3300025945 | Unclassified | 1067 |
| 410 | Ga0207667_10004629 | 3300025949 | Bacteria | 16877 |
| 411 | Ga0207667_10005521 | 3300025949 | Bacteria | 15429 |
| 412 | Ga0207667_10012704 | 3300025949 | Bacteria | 9677 |
| 413 | Ga0207667_10030071 | 3300025949 | Bacteria | 5880 |
| 414 | Ga0207667_10046947 | 3300025949 | Bacteria | 4573 |
| 415 | Ga0207667_10286408 | 3300025949 | Bacteria | 1683 |
| 416 | Ga0207667_10428971 | 3300025949 | Bacteria | 1345 |
| 417 | Ga0207651_10010963 | 3300025960 | Bacteria | 5048 |
| 418 | Ga0207651_10029727 | 3300025960 | Unclassified | 3467 |
| 419 | Ga0207640_10011846 | 3300025981 | Bacteria | 4950 |
| 420 | Ga0207640_10020089 | 3300025981 | Bacteria | 3960 |
| 421 | Ga0207640_10064446 | 3300025981 | Unclassified | 2440 |
| 422 | Ga0207640_10235621 | 3300025981 | Bacteria | 1411 |
| 423 | Ga0207640_10281278 | 3300025981 | Unclassified | 1307 |
| 424 | Ga0207640_10424413 | 3300025981 | Unclassified | 1089 |
| 425 | Ga0207658_10002182 | 3300025986 | Bacteria | 14559 |
| 426 | Ga0207658_10085750 | 3300025986 | Bacteria | 2426 |
| 427 | Ga0207658_10154442 | 3300025986 | Unclassified | 1874 |
| 428 | Ga0207677_10003094 | 3300026023 | Bacteria | 8774 |
| 429 | Ga0207677_10105748 | 3300026023 | Unclassified | 2083 |
| 430 | Ga0207677_10402301 | 3300026023 | Bacteria | 1161 |
| 431 | Ga0207703_10011174 | 3300026035 | Bacteria | 6987 |
| 432 | Ga0207703_10266045 | 3300026035 | Bacteria | 1551 |
| 433 | Ga0207703_11501286 | 3300026035 | Unclassified | 648 |
| 434 | Ga0207639_10027601 | 3300026041 | Bacteria | 4137 |
| 435 | Ga0207639_10048394 | 3300026041 | Bacteria | 3218 |
| 436 | Ga0207639_10234842 | 3300026041 | Bacteria | 1591 |
| 437 | Ga0207639_10362176 | 3300026041 | Unclassified | 1298 |
| 438 | Ga0207639_11004287 | 3300026041 | Bacteria | 781 |
| 439 | Ga0207678_10003264 | 3300026067 | Bacteria | 14641 |
| 440 | Ga0207678_10007049 | 3300026067 | Bacteria | 9982 |
| 441 | Ga0207678_10007874 | 3300026067 | Bacteria | 9399 |
| 442 | Ga0207678_10021167 | 3300026067 | Bacteria | 5700 |
| 443 | Ga0207678_10021916 | 3300026067 | Bacteria | 5600 |
| 444 | Ga0207678_10033391 | 3300026067 | Bacteria | 4483 |
| 445 | Ga0207678_10586382 | 3300026067 | Unclassified | 977 |
| 446 | Ga0207702_10005931 | 3300026078 | Bacteria | 10614 |
| 447 | Ga0207702_10018054 | 3300026078 | Bacteria | 5837 |
| 448 | Ga0207702_10749481 | 3300026078 | Bacteria | 964 |
| 449 | Ga0207641_10115912 | 3300026088 | Bacteria | 2383 |
| 450 | Ga0207641_10316134 | 3300026088 | Unclassified | 1479 |
| 451 | Ga0207641_10807694 | 3300026088 | Bacteria | 928 |
| 452 | Ga0207648_10003640 | 3300026089 | Bacteria | 16124 |
| 453 | Ga0207648_10037185 | 3300026089 | Plasmid | 4287 |
| 454 | Ga0207676_10007387 | 3300026095 | Bacteria | 7794 |
| 455 | Ga0207676_10130076 | 3300026095 | Unclassified | 2139 |
| 456 | Ga0207676_10461405 | 3300026095 | Bacteria | 1199 |
| 457 | Ga0207674_10002992 | 3300026116 | Bacteria | 20959 |
| 458 | Ga0207674_10007460 | 3300026116 | Bacteria | 12748 |
| 459 | Ga0207674_10078538 | 3300026116 | Unclassified | 3305 |
| 460 | Ga0207674_10243247 | 3300026116 | Bacteria | 1746 |
| 461 | Ga0207674_10532959 | 3300026116 | Bacteria | 1134 |
| 462 | Ga0207675_100035806 | 3300026118 | Unclassified | 4630 |
| 463 | Ga0207683_10001954 | 3300026121 | Bacteria | 18251 |
| 464 | Ga0207683_10007409 | 3300026121 | Bacteria | 9410 |
| 465 | Ga0207683_10014754 | 3300026121 | Bacteria | 6651 |
| 466 | Ga0207683_10146387 | 3300026121 | Unclassified | 2130 |
| 467 | Ga0207698_10004870 | 3300026142 | Bacteria | 8229 |
| 468 | Ga0207698_10007906 | 3300026142 | Bacteria | 6697 |
| 469 | Ga0207698_10036417 | 3300026142 | Bacteria | 3611 |
| 470 | Ga0207698_10083077 | 3300026142 | Bacteria | 2591 |
| 471 | Ga0207698_10105969 | 3300026142 | Unclassified | 2343 |
| 472 | Ga0207698_10283411 | 3300026142 | Bacteria | 1534 |
| 473 | Ga0207698_10360435 | 3300026142 | Bacteria | 1377 |
| 474 | Ga0207698_10432017 | 3300026142 | Bacteria | 1267 |
| 475 | Ga0207698_10604218 | 3300026142 | Unclassified | 1082 |
| 476 | Ga0207698_10699788 | 3300026142 | Unclassified | 1008 |
| 477 | Ga0207698_11281133 | 3300026142 | Bacteria | 747 |
| 478 | Ga0268266_10561392 | 3300028379 | Bacteria | 1094 |
| 479 | Ga0268264_10126419 | 3300028381 | Unclassified | 2260 |
| 480 | Ga0268264_10126555 | 3300028381 | Bacteria | 2259 |
| 481 | Ga0307408_100008775 | 3300031548 | Bacteria | 6673 |
| 482 | Ga0307405_10006643 | 3300031731 | Bacteria | 5708 |
| 483 | Ga0307405_10102577 | 3300031731 | Bacteria | 1922 |
| 484 | Ga0307413_10013570 | 3300031824 | Bacteria | 4100 |
| 485 | Ga0307413_10120075 | 3300031824 | Bacteria | 1779 |
| 486 | Ga0307413_10481807 | 3300031824 | Unclassified | 992 |
| 487 | Ga0307410_10005503 | 3300031852 | Bacteria | 6711 |
| 488 | Ga0307410_10092286 | 3300031852 | Bacteria | 2152 |
| 489 | Ga0307410_10326677 | 3300031852 | Bacteria | 1219 |
| 490 | Ga0307406_10030120 | 3300031901 | Unclassified | 3291 |
| 491 | Ga0307406_10052865 | 3300031901 | Bacteria | 2585 |
| 492 | Ga0307407_10060432 | 3300031903 | Bacteria | 2211 |
| 493 | Ga0307412_10013895 | 3300031911 | Bacteria | 4733 |
| 494 | Ga0307412_10154569 | 3300031911 | Bacteria | 1697 |
| 495 | Ga0307409_100005694 | 3300031995 | Bacteria | 7219 |
| 496 | Ga0307409_100226076 | 3300031995 | Bacteria | 1693 |
| 497 | Ga0307416_100016023 | 3300032002 | Bacteria | 5195 |
| 498 | Ga0307416_100019565 | 3300032002 | Unclassified | 4804 |
| 499 | Ga0307416_100122851 | 3300032002 | Unclassified | 2319 |
| 500 | Ga0307414_10035268 | 3300032004 | Bacteria | 3328 |
| 501 | Ga0307414_10868799 | 3300032004 | Unclassified | 825 |
| 502 | Ga0307411_10024827 | 3300032005 | Bacteria | 3580 |
| 503 | Ga0307411_10232881 | 3300032005 | Unclassified | 1437 |
| 504 | Ga0307415_100008308 | 3300032126 | Bacteria | 5746 |
| 505 | Ga0307415_100009449 | 3300032126 | Bacteria | 5467 |
| 506 | Ga0307415_100223658 | 3300032126 | Bacteria | 1511 |
| 507 | Ga0373946_0030460 | 3300035171 | Bacteria | 2154 |
| 508 | Ga0373931_0048019 | 3300035691 | Unclassified | 2261 |
| 509 | Ga0373935_0014000 | 3300035692 | Unclassified | 4844 |
| 510 | Ga0373947_0021896 | 3300035725 | Bacteria | 3704 |
| 511 | Ga0373925_0399294 | 3300037068 | Bacteria | 1121 |
| 512 | Ga0395899_0000274 | 3300037312 | Bacteria | 67210 |
| 513 | Ga0395899_0013744 | 3300037312 | Bacteria | 6189 |
| 514 | Ga0395899_0018865 | 3300037312 | Bacteria | 5242 |
| 515 | Ga0395899_0022022 | 3300037312 | Bacteria | 4833 |
| 516 | Ga0395899_0038774 | 3300037312 | Unclassified | 3567 |
| 517 | Ga0395899_0043264 | 3300037312 | Bacteria | 3360 |
| 518 | Ga0395899_0056578 | 3300037312 | Bacteria | 2898 |
| 519 | Ga0395899_0070897 | 3300037312 | Bacteria | 2551 |
| 520 | Ga0395899_0085878 | 3300037312 | Unclassified | 2286 |
| 521 | Ga0395899_0115094 | 3300037312 | Bacteria | 1930 |
| 522 | Ga0395899_0125702 | 3300037312 | Unclassified | 1834 |
| 523 | Ga0395899_0179765 | 3300037312 | Bacteria | 1486 |
| 524 | Ga0395900_0000595 | 3300037418 | Bacteria | 49632 |
| 525 | Ga0395900_0004150 | 3300037418 | Bacteria | 15419 |
| 526 | Ga0395900_0018303 | 3300037418 | Bacteria | 7146 |
| 527 | Ga0395900_0021697 | 3300037418 | Bacteria | 6566 |
| 528 | Ga0395900_0046219 | 3300037418 | Unclassified | 4483 |
| 529 | Ga0395900_0065619 | 3300037418 | Bacteria | 3729 |
| 530 | Ga0395900_0075993 | 3300037418 | Bacteria | 3452 |
| 531 | Ga0395900_0076541 | 3300037418 | Bacteria | 3439 |
| 532 | Ga0395900_0128536 | 3300037418 | Bacteria | 2597 |
| 533 | Ga0395900_0131492 | 3300037418 | Unclassified | 2565 |
| 534 | Ga0395900_0190363 | 3300037418 | Bacteria | 2081 |
| 535 | Ga0395900_0295802 | 3300037418 | Unclassified | 1606 |
| 536 | Ga0395900_0313818 | 3300037418 | Unclassified | 1550 |
| 537 | Ga0395900_0363748 | 3300037418 | Bacteria | 1417 |
| 538 | Ga0395900_0474290 | 3300037418 | Unclassified | 1204 |
| 539 | Ga0395900_1152973 | 3300037418 | Unclassified | 691 |
| 540 | Ga0395898_0005114 | 3300037466 | Bacteria | 14209 |
| 541 | Ga0395898_0006829 | 3300037466 | Bacteria | 12138 |
| 542 | Ga0395898_0017203 | 3300037466 | Bacteria | 7384 |
| 543 | Ga0395898_0017744 | 3300037466 | Bacteria | 7263 |
| 544 | Ga0395898_0049227 | 3300037466 | Unclassified | 4129 |
| 545 | Ga0395898_0050768 | 3300037466 | Bacteria | 4058 |
| 546 | Ga0395898_0061040 | 3300037466 | Bacteria | 3663 |
| 547 | Ga0395898_0106111 | 3300037466 | Bacteria | 2694 |
| 548 | Ga0395898_0113466 | 3300037466 | Unclassified | 2597 |
| 549 | Ga0395898_0114951 | 3300037466 | Unclassified | 2578 |
| 550 | Ga0395898_0184567 | 3300037466 | Bacteria | 1993 |
| 551 | Ga0395898_0200060 | 3300037466 | Bacteria | 1907 |
| 552 | Ga0395898_0403965 | 3300037466 | Bacteria | 1302 |
| 553 | Ga0395898_0951202 | 3300037466 | Unclassified | 796 |
| 554 | Ga0395905_0002328 | 3300037471 | Bacteria | 21216 |
| 555 | Ga0395905_0003746 | 3300037471 | Bacteria | 16115 |
| 556 | Ga0395905_0010952 | 3300037471 | Bacteria | 8777 |
| 557 | Ga0395905_0011179 | 3300037471 | Bacteria | 8679 |
| 558 | Ga0395905_0017132 | 3300037471 | Bacteria | 6881 |
| 559 | Ga0395905_0021701 | 3300037471 | Bacteria | 6074 |
| 560 | Ga0395905_0030485 | 3300037471 | Bacteria | 5082 |
| 561 | Ga0395905_0050891 | 3300037471 | Bacteria | 3880 |
| 562 | Ga0395905_0052491 | 3300037471 | Bacteria | 3816 |
| 563 | Ga0395905_0119707 | 3300037471 | Bacteria | 2474 |
| 564 | Ga0395905_0141293 | 3300037471 | Bacteria | 2265 |
| 565 | Ga0395905_0160654 | 3300037471 | Unclassified | 2112 |
| 566 | Ga0395905_0246702 | 3300037471 | Bacteria | 1668 |
| 567 | Ga0395905_0278549 | 3300037471 | Bacteria | 1558 |
| 568 | Ga0395905_0290204 | 3300037471 | Unclassified | 1522 |
| 569 | Ga0395905_0429134 | 3300037471 | Bacteria | 1218 |
| 570 | Ga0395905_0912460 | 3300037471 | Unclassified | 781 |
| 571 | Ga0395901_0001391 | 3300038443 | Bacteria | 25281 |
| 572 | Ga0395901_0005012 | 3300038443 | Bacteria | 13368 |
| 573 | Ga0395901_0005682 | 3300038443 | Bacteria | 12622 |
| 574 | Ga0395901_0007094 | 3300038443 | Bacteria | 11329 |
| 575 | Ga0395901_0012920 | 3300038443 | Bacteria | 8471 |
| 576 | Ga0395901_0039018 | 3300038443 | Unclassified | 4913 |
| 577 | Ga0395901_0080083 | 3300038443 | Bacteria | 3409 |
| 578 | Ga0395901_0080413 | 3300038443 | Unclassified | 3403 |
| 579 | Ga0395901_0082438 | 3300038443 | Unclassified | 3360 |
| 580 | Ga0395901_0118824 | 3300038443 | Bacteria | 2777 |
| 581 | Ga0395901_0291162 | 3300038443 | Unclassified | 1694 |
| 582 | Ga0395901_0301711 | 3300038443 | Bacteria | 1660 |
| 583 | Ga0395901_0658451 | 3300038443 | Unclassified | 1049 |
| 584 | Ga0395901_0680966 | 3300038443 | Unclassified | 1028 |
| 585 | Ga0395901_1139394 | 3300038443 | Bacteria | 749 |
| 586 | Ga0436365_0736792 | 3300039437 | Bacteria | 14837 |
| 587 | Ga0439448_0002283 | 3300042005 | Bacteria | 5186 |
| 588 | Ga0439458_0001082 | 3300042157 | Bacteria | 6944 |
| 589 | Ga0466965_0020932 | 3300044683 | Unclassified | 3147 |
| 590 | Ga0466966_0038977 | 3300044684 | Bacteria | 3060 |
| 591 | Ga0466966_0230991 | 3300044684 | Unclassified | 1116 |
| 592 | Ga0466961_0054393 | 3300044693 | Bacteria | 2553 |
| 593 | Ga0466961_0169047 | 3300044693 | Bacteria | 1360 |
| 594 | Ga0466961_0198862 | 3300044693 | Bacteria | 1240 |
| 595 | Ga0466963_0207185 | 3300044694 | Bacteria | 1372 |
| 596 | Ga0466963_0359408 | 3300044694 | Unclassified | 1026 |
| 597 | Ga0466963_0572762 | 3300044694 | Bacteria | 797 |
| 598 | Ga0466964_0012707 | 3300044706 | Unclassified | 3187 |
| 599 | Ga0466971_0069518 | 3300044719 | Unclassified | 1598 |
| 600 | Ga0466970_0005408 | 3300044765 | Bacteria | 6335 |
| 601 | Ga0466970_0193586 | 3300044765 | Unclassified | 1130 |
| 602 | Ga0466970_0226551 | 3300044765 | Bacteria | 1044 |
| 603 | Ga0466970_0280565 | 3300044765 | Unclassified | 937 |
| 604 | Ga0466957_0087909 | 3300044842 | Unclassified | 1944 |
| 605 | Ga0466957_0435089 | 3300044842 | Unclassified | 902 |
| 606 | Ga0466960_0399578 | 3300044901 | Unclassified | 791 |
| 607 | Ga0466959_0031093 | 3300045049 | Unclassified | 3951 |
| 608 | Ga0466959_0038450 | 3300045049 | Bacteria | 3536 |
| 609 | Ga0466958_0011871 | 3300045836 | Unclassified | 4919 |
| 610 | Ga0466958_0034898 | 3300045836 | Bacteria | 3003 |
| 611 | Ga0466958_0155321 | 3300045836 | Bacteria | 1444 |
| 612 | Ga0466967_0176085 | 3300045976 | Unclassified | 2015 |
| 613 | Ga0466967_0775343 | 3300045976 | Unclassified | 951 |
| 614 | Ga0495669_0070262 | 3300046684 | Bacteria | 1594 |
| 615 | Ga0495669_0091710 | 3300046684 | Unclassified | 1403 |
| 616 | Ga0495677_0036977 | 3300047445 | Unclassified | 1783 |
| 617 | Ga0495677_0040249 | 3300047445 | Bacteria | 1709 |
| 618 | Ga0496100_0001297 | 3300048903 | Bacteria | 12196 |
| 619 | Ga0496101_0001820 | 3300048904 | Bacteria | 12844 |
| 620 | Ga0496102_0013872 | 3300048905 | Bacteria | 6992 |
| 621 | Ga0496103_0082086 | 3300048906 | Unclassified | 2028 |
| 622 | Ga0496105_0391590 | 3300048908 | Unclassified | 1104 |
| 623 | Ga0496106_0020047 | 3300048909 | Bacteria | 4959 |
| 624 | Ga0496107_0000488 | 3300048910 | Bacteria | 21814 |
| 625 | Ga0496107_0129165 | 3300048910 | Bacteria | 1865 |
| 626 | Ga0496108_0004915 | 3300048911 | Bacteria | 10796 |
| 627 | Ga0496108_0028497 | 3300048911 | Unclassified | 4621 |
| 628 | Ga0496109_0011392 | 3300048912 | Bacteria | 7642 |
| 629 | Ga0496109_0075799 | 3300048912 | Unclassified | 3092 |
| 630 | Ga0496109_0279831 | 3300048912 | Bacteria | 1572 |
| 631 | Ga0496109_0349630 | 3300048912 | Bacteria | 1396 |
| 632 | Ga0496109_0656373 | 3300048912 | Unclassified | 986 |
| 633 | Ga0496110_0001671 | 3300048913 | Bacteria | 16272 |
| 634 | Ga0496111_0011249 | 3300048914 | Bacteria | 6023 |
| 635 | Ga0496111_0094524 | 3300048914 | Bacteria | 2192 |
| 636 | Ga0496112_0261408 | 3300048915 | Unclassified | 1680 |
| 637 | Ga0496113_0116134 | 3300048916 | Unclassified | 2088 |
| 638 | Ga0496113_0325872 | 3300048916 | Unclassified | 1231 |
| 639 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 640 | Ga0501069_0157337 | 3300049585 | Bacteria | 1308 |
| 641 | Ga0501201_012335 | 3300049651 | Bacteria | 851 |
| 642 | Ga0501223_025215 | 3300049663 | Unclassified | 1157 |
| 643 | Ga0501227_043720 | 3300049665 | Bacteria | 1114 |
| 644 | Ga0501225_0010778 | 3300049705 | Bacteria | 2582 |
| 645 | Ga0466962_0188118 | 3300061719 | Unclassified | 1007 |
| 646 | JGI24737J22298_10042919 | |||
| 647 | MBSR1b_contig_1297016 | |||
| 648 | MBSR1b_contig_13888460 | |||
| 649 | JGI24740J21852_10002403 | |||
| 650 | JGI24739J22299_10006905 | |||
| 651 | JGI24739J22299_10012766 | |||
| 652 | JGI24739J22299_10026558 | |||
| 653 | JGI24739J22299_10044347 | |||
| 654 | JGI24735J21928_10002010 | |||
| 655 | JGI24735J21928_10005193 | |||
| 656 | JGI24735J21928_10034511 | |||
| 657 | JGI24745J21846_1001583 | |||
| 658 | JGI24738J21930_10014491 | |||
| 659 | JGI24744J21845_10000630 | |||
| 660 | rootH2_10261940 | |||
| 661 | rootL2_10140962 | |||
| 662 | rootH1_10175824 | |||
| 663 | Ga0070658_10014874 | |||
| 664 | Ga0070658_10110147 | |||
| 665 | Ga0070658_10133547 | |||
| 666 | Ga0070658_10210057 | |||
| 667 | Ga0070658_10228672 | |||
| 668 | Ga0070676_10146680 | |||
| 669 | Ga0070676_10395315 | |||
| 670 | Ga0070683_100002629 | |||
| 671 | Ga0070683_100030858 | |||
| 672 | Ga0070690_100005322 | |||
| 673 | Ga0070690_100012753 | |||
| 674 | Ga0070690_100223973 | |||
| 675 | Ga0070670_100005192 | |||
| 676 | Ga0070670_100053449 | |||
| 677 | Ga0070677_10096595 | |||
| 678 | Ga0070677_10249946 | |||
| 679 | Ga0070666_10001302 | |||
| 680 | Ga0070666_10026568 | |||
| 681 | Ga0070666_10141152 | |||
| 682 | Ga0070680_100006378 | |||
| 683 | Ga0070680_100015094 | |||
| 684 | Ga0070680_100045029 | |||
| 685 | Ga0070680_100525080 | |||
| 686 | Ga0070680_100526074 | |||
| 687 | Ga0070682_100134841 | |||
| 688 | Ga0068868_100003463 | |||
| 689 | Ga0068868_100054250 | |||
| 690 | Ga0068868_100912969 | |||
| 691 | Ga0068868_101090935 | |||
| 692 | Ga0070660_100003869 | |||
| 693 | Ga0070660_100007812 | |||
| 694 | Ga0070660_100025386 | |||
| 695 | Ga0070660_100037950 | |||
| 696 | Ga0070660_100070204 | |||
| 697 | Ga0070660_100081511 | |||
| 698 | Ga0070660_100174043 | |||
| 699 | Ga0070660_100226464 | |||
| 700 | Ga0070660_100273824 | |||
| 701 | Ga0070660_100282701 | |||
| 702 | Ga0070661_100002823 | |||
| 703 | Ga0070661_100005291 | |||
| 704 | Ga0070661_100006530 | |||
| 705 | Ga0070661_100013143 | |||
| 706 | Ga0070661_100045009 | |||
| 707 | Ga0070661_100050041 | |||
| 708 | Ga0070661_100062736 | |||
| 709 | Ga0070661_100113973 | |||
| 710 | Ga0070661_100292560 | |||
| 711 | Ga0070668_100344277 | |||
| 712 | Ga0070669_100335419 | |||
| 713 | Ga0070675_100002093 | |||
| 714 | Ga0070675_100173112 | |||
| 715 | Ga0070671_100000585 | |||
| 716 | Ga0070671_100001443 | |||
| 717 | Ga0070671_100022690 | |||
| 718 | Ga0070671_100044584 | |||
| 719 | Ga0070671_100057513 | |||
| 720 | Ga0070671_100111029 | |||
| 721 | Ga0070671_100117386 | |||
| 722 | Ga0070671_100316553 | |||
| 723 | Ga0070671_100949568 | |||
| 724 | Ga0070674_100006154 | |||
| 725 | Ga0070674_100453527 | |||
| 726 | Ga0070673_100000518 | |||
| 727 | Ga0070673_100001113 | |||
| 728 | Ga0070673_100719846 | |||
| 729 | Ga0070659_100005596 | |||
| 730 | Ga0070659_100017205 | |||
| 731 | Ga0070659_100019036 | |||
| 732 | Ga0070659_100021733 | |||
| 733 | Ga0070659_100024954 | |||
| 734 | Ga0070659_100042674 | |||
| 735 | Ga0070659_100250631 | |||
| 736 | Ga0070659_100326022 | |||
| 737 | Ga0070667_100012961 | |||
| 738 | Ga0070667_100112420 | |||
| 739 | Ga0070667_100452927 | |||
| 740 | Ga0070714_100002190 | |||
| 741 | Ga0070714_100023812 | |||
| 742 | Ga0070713_100064565 | |||
| 743 | Ga0070713_100264901 | |||
| 744 | Ga0070663_100009807 | |||
| 745 | Ga0070663_100025456 | |||
| 746 | Ga0070663_100115539 | |||
| 747 | Ga0070663_100538293 | |||
| 748 | Ga0070678_100003931 | |||
| 749 | Ga0070678_100020631 | |||
| 750 | Ga0070678_100150888 | |||
| 751 | Ga0070678_100653416 | |||
| 752 | Ga0070662_100005816 | |||
| 753 | Ga0070662_100008179 | |||
| 754 | Ga0070662_100025353 | |||
| 755 | Ga0070662_100043033 | |||
| 756 | Ga0070662_100059180 | |||
| 757 | Ga0070662_100103293 | |||
| 758 | Ga0070662_100108640 | |||
| 759 | Ga0070662_100137131 | |||
| 760 | Ga0070662_101066491 | |||
| 761 | Ga0070681_10026188 | |||
| 762 | Ga0070681_10186571 | |||
| 763 | Ga0070681_10489535 | |||
| 764 | Ga0068867_100005952 | |||
| 765 | Ga0068867_100355309 | |||
| 766 | Ga0070679_100126514 | |||
| 767 | Ga0070679_100129843 | |||
| 768 | Ga0070679_100280316 | |||
| 769 | Ga0070679_100478373 | |||
| 770 | Ga0070684_100004092 | |||
| 771 | Ga0070684_100043342 | |||
| 772 | Ga0068853_100031367 | |||
| 773 | Ga0068853_100100044 | |||
| 774 | Ga0068853_100117230 | |||
| 775 | Ga0068853_100229315 | |||
| 776 | Ga0068853_100383372 | |||
| 777 | Ga0068853_100421992 | |||
| 778 | Ga0070672_100008152 | |||
| 779 | Ga0070672_100139790 | |||
| 780 | Ga0070672_100289410 | |||
| 781 | Ga0070686_100016416 | |||
| 782 | Ga0070686_100089690 | |||
| 783 | Ga0070665_100001865 | |||
| 784 | Ga0070665_100632653 | |||
| 785 | Ga0068855_100005824 | |||
| 786 | Ga0068855_100006659 | |||
| 787 | Ga0068855_100014977 | |||
| 788 | Ga0068855_100017060 | |||
| 789 | Ga0068855_100133125 | |||
| 790 | Ga0068855_100802386 | |||
| 791 | Ga0070664_100003503 | |||
| 792 | Ga0070664_100004995 | |||
| 793 | Ga0070664_100020715 | |||
| 794 | Ga0070664_100021899 | |||
| 795 | Ga0070664_100088628 | |||
| 796 | Ga0070664_100539447 | |||
| 797 | Ga0068857_100005367 | |||
| 798 | Ga0068857_100008638 | |||
| 799 | Ga0068857_100342573 | |||
| 800 | Ga0068857_100524603 | |||
| 801 | Ga0068854_100005714 | |||
| 802 | Ga0068854_100011868 | |||
| 803 | Ga0068854_100013435 | |||
| 804 | Ga0068854_100043575 | |||
| 805 | Ga0068854_100282391 | |||
| 806 | Ga0068854_100345931 | |||
| 807 | Ga0068856_100092419 | |||
| 808 | Ga0068856_100095480 | |||
| 809 | Ga0068856_100663484 | |||
| 810 | Ga0068852_100007810 | |||
| 811 | Ga0068852_100008650 | |||
| 812 | Ga0068852_100062081 | |||
| 813 | Ga0068852_100067621 | |||
| 814 | Ga0068852_100100758 | |||
| 815 | Ga0068852_100108071 | |||
| 816 | Ga0068852_100262170 | |||
| 817 | Ga0068852_100378225 | |||
| 818 | Ga0068852_100578630 | |||
| 819 | Ga0068852_100807244 | |||
| 820 | Ga0068859_100004211 | |||
| 821 | Ga0068859_100114502 | |||
| 822 | Ga0068864_100002449 | |||
| 823 | Ga0068864_100124984 | |||
| 824 | Ga0068864_100545710 | |||
| 825 | Ga0068864_100695511 | |||
| 826 | Ga0068866_10004286 | |||
| 827 | Ga0068866_10005540 | |||
| 828 | Ga0068866_10153176 | |||
| 829 | Ga0068861_100317559 | |||
| 830 | Ga0068851_10023519 | |||
| 831 | Ga0068851_10030910 | |||
| 832 | Ga0068851_10298309 | |||
| 833 | Ga0068863_100004949 | |||
| 834 | Ga0068863_100118766 | |||
| 835 | Ga0068863_100324651 | |||
| 836 | Ga0068858_100016957 | |||
| 837 | Ga0068858_100050121 | |||
| 838 | Ga0068858_100131372 | |||
| 839 | Ga0068860_100046428 | |||
| 840 | Ga0068860_100422061 | |||
| 841 | Ga0081539_10012110 | |||
| 842 | Ga0097621_100054597 | |||
| 843 | Ga0097621_100421824 | |||
| 844 | Ga0068871_100081679 | |||
| 845 | Ga0068871_100155028 | |||
| 846 | Ga0068871_100462434 | |||
| 847 | Ga0097620_100004211 | |||
| 848 | Ga0097620_100114501 | |||
| 849 | Ga0105251_10106287 | |||
| 850 | Ga0105240_10045600 | |||
| 851 | Ga0105240_10098372 | |||
| 852 | Ga0105240_10160539 | |||
| 853 | Ga0105245_10006582 | |||
| 854 | Ga0105245_10044171 | |||
| 855 | Ga0105245_10065173 | |||
| 856 | Ga0105243_10167559 | |||
| 857 | Ga0105243_10205041 | |||
| 858 | Ga0105241_10592309 | |||
| 859 | Ga0105242_10002916 | |||
| 860 | Ga0105248_10000864 | |||
| 861 | Ga0105248_10013935 | |||
| 862 | Ga0105248_10037356 | |||
| 863 | Ga0105248_10329159 | |||
| 864 | Ga0105237_10049349 | |||
| 865 | Ga0105238_10002340 | |||
| 866 | Ga0105238_10013299 | |||
| 867 | Ga0105238_10096370 | |||
| 868 | Ga0105239_10068875 | |||
| 869 | Ga0105239_11327088 | |||
| 870 | Ga0105239_11483585 | |||
| 871 | Ga0105246_10805378 | |||
| 872 | Ga0157373_10004072 | |||
| 873 | Ga0157373_10008312 | |||
| 874 | Ga0157373_10008647 | |||
| 875 | Ga0157373_10069909 | |||
| 876 | Ga0157373_10086467 | |||
| 877 | Ga0157373_10487288 | |||
| 878 | Ga0157373_10531554 | |||
| 879 | Ga0157371_10008598 | |||
| 880 | Ga0157371_10018990 | |||
| 881 | Ga0157371_10024427 | |||
| 882 | Ga0157371_10035385 | |||
| 883 | Ga0157371_10039072 | |||
| 884 | Ga0157371_10172622 | |||
| 885 | Ga0157371_10561715 | |||
| 886 | Ga0157370_10008977 | |||
| 887 | Ga0157370_10015649 | |||
| 888 | Ga0157370_10016993 | |||
| 889 | Ga0157370_10022730 | |||
| 890 | Ga0157370_10072735 | |||
| 891 | Ga0157370_10116084 | |||
| 892 | Ga0157369_10002126 | |||
| 893 | Ga0157369_10014353 | |||
| 894 | Ga0157369_10056672 | |||
| 895 | Ga0157369_10060324 | |||
| 896 | Ga0157369_10343321 | |||
| 897 | Ga0157369_10589894 | |||
| 898 | Ga0157369_11140891 | |||
| 899 | Ga0157369_11146045 | |||
| 900 | Ga0157369_11307932 | |||
| 901 | Ga0157374_10002280 | |||
| 902 | Ga0157374_10123330 | |||
| 903 | Ga0157374_10240917 | |||
| 904 | Ga0157374_10372727 | |||
| 905 | Ga0157378_10007867 | |||
| 906 | Ga0157378_10007999 | |||
| 907 | Ga0157378_10034100 | |||
| 908 | Ga0157378_10282423 | |||
| 909 | Ga0163162_10030131 | |||
| 910 | Ga0163162_10038669 | |||
| 911 | Ga0163162_10064407 | |||
| 912 | Ga0163162_10147070 | |||
| 913 | Ga0163162_10318788 | |||
| 914 | Ga0163162_10353316 | |||
| 915 | Ga0157372_10001798 | |||
| 916 | Ga0157372_10012759 | |||
| 917 | Ga0157372_10040118 | |||
| 918 | Ga0157372_10165822 | |||
| 919 | Ga0157375_10012218 | |||
| 920 | Ga0157375_10294531 | |||
| 921 | Ga0157375_10400064 | |||
| 922 | Ga0163163_10013953 | |||
| 923 | Ga0157380_10365206 | |||
| 924 | Ga0157377_10013653 | |||
| 925 | Ga0157379_10068937 | |||
| 926 | Ga0157376_10003176 | |||
| 927 | Ga0157376_10424354 | |||
| 928 | Ga0163161_10013190 | |||
| 929 | Ga0206356_11305088 | |||
| 930 | Ga0206353_11863051 | |||
| 931 | Ga0207697_10090735 | |||
| 932 | Ga0207656_10185259 | |||
| 933 | Ga0207682_10005198 | |||
| 934 | Ga0207682_10036190 | |||
| 935 | Ga0207642_10012037 | |||
| 936 | Ga0207642_10072320 | |||
| 937 | Ga0207688_10002725 | |||
| 938 | Ga0207688_10080895 | |||
| 939 | Ga0207680_10000843 | |||
| 940 | Ga0207680_10132329 | |||
| 941 | Ga0207647_10000652 | |||
| 942 | Ga0207647_10000953 | |||
| 943 | Ga0207647_10003821 | |||
| 944 | Ga0207647_10017333 | |||
| 945 | Ga0207647_10018812 | |||
| 946 | Ga0207647_10025396 | |||
| 947 | Ga0207647_10234379 | |||
| 948 | Ga0207647_10282552 | |||
| 949 | Ga0207699_10248099 | |||
| 950 | Ga0207645_10148415 | |||
| 951 | Ga0207643_10021040 | |||
| 952 | Ga0207643_10044622 | |||
| 953 | Ga0207705_10002376 | |||
| 954 | Ga0207705_10004357 | |||
| 955 | Ga0207705_10015198 | |||
| 956 | Ga0207705_10016676 | |||
| 957 | Ga0207705_10047562 | |||
| 958 | Ga0207705_10051935 | |||
| 959 | Ga0207705_10108859 | |||
| 960 | Ga0207705_10112190 | |||
| 961 | Ga0207705_10131338 | |||
| 962 | Ga0207705_10232015 | |||
| 963 | Ga0207705_10265687 | |||
| 964 | Ga0207654_10015469 | |||
| 965 | Ga0207707_10049788 | |||
| 966 | Ga0207707_10072538 | |||
| 967 | Ga0207695_10255392 | |||
| 968 | Ga0207695_10437388 | |||
| 969 | Ga0207671_10039479 | |||
| 970 | Ga0207693_10069915 | |||
| 971 | Ga0207660_10065754 | |||
| 972 | Ga0207660_10249031 | |||
| 973 | Ga0207660_10701695 | |||
| 974 | Ga0207662_10006219 | |||
| 975 | Ga0207657_10004145 | |||
| 976 | Ga0207657_10007353 | |||
| 977 | Ga0207657_10014910 | |||
| 978 | Ga0207657_10015203 | |||
| 979 | Ga0207657_10017538 | |||
| 980 | Ga0207657_10019117 | |||
| 981 | Ga0207657_10034185 | |||
| 982 | Ga0207657_10087508 | |||
| 983 | Ga0207657_10103551 | |||
| 984 | Ga0207657_10105640 | |||
| 985 | Ga0207657_10112714 | |||
| 986 | Ga0207657_10499690 | |||
| 987 | Ga0207649_10019824 | |||
| 988 | Ga0207649_10033103 | |||
| 989 | Ga0207649_10034491 | |||
| 990 | Ga0207649_10049691 | |||
| 991 | Ga0207649_10071710 | |||
| 992 | Ga0207649_10120981 | |||
| 993 | Ga0207649_10129138 | |||
| 994 | Ga0207649_10251820 | |||
| 995 | Ga0207649_10403100 | |||
| 996 | Ga0207652_10010377 | |||
| 997 | Ga0207652_10019231 | |||
| 998 | Ga0207652_10248124 | |||
| 999 | Ga0207652_10648343 | |||
| 1000 | Ga0207650_10009857 | |||
| 1001 | Ga0207650_10018530 | |||
| 1002 | Ga0207650_10728501 | |||
| 1003 | Ga0207650_10858499 | |||
| 1004 | Ga0207659_10049306 | |||
| 1005 | Ga0207687_10030895 | |||
| 1006 | Ga0207700_10023556 | |||
| 1007 | Ga0207664_10017766 | |||
| 1008 | Ga0207664_10060049 | |||
| 1009 | Ga0207644_10000110 | |||
| 1010 | Ga0207644_10002394 | |||
| 1011 | Ga0207644_10002765 | |||
| 1012 | Ga0207644_10022898 | |||
| 1013 | Ga0207644_10116021 | |||
| 1014 | Ga0207644_10126324 | |||
| 1015 | Ga0207644_10131711 | |||
| 1016 | Ga0207644_10218257 | |||
| 1017 | Ga0207644_10409776 | |||
| 1018 | Ga0207690_10002722 | |||
| 1019 | Ga0207690_10003887 | |||
| 1020 | Ga0207690_10052271 | |||
| 1021 | Ga0207690_10134744 | |||
| 1022 | Ga0207690_10232934 | |||
| 1023 | Ga0207706_10005674 | |||
| 1024 | Ga0207706_10027754 | |||
| 1025 | Ga0207706_10086196 | |||
| 1026 | Ga0207706_10139498 | |||
| 1027 | Ga0207706_10143644 | |||
| 1028 | Ga0207706_10170088 | |||
| 1029 | Ga0207706_10198767 | |||
| 1030 | Ga0207706_10250631 | |||
| 1031 | Ga0207686_10052215 | |||
| 1032 | Ga0207669_10029521 | |||
| 1033 | Ga0207669_10066421 | |||
| 1034 | Ga0207669_10663310 | |||
| 1035 | Ga0207704_10099953 | |||
| 1036 | Ga0207665_10110000 | |||
| 1037 | Ga0207691_10022908 | |||
| 1038 | Ga0207691_10027006 | |||
| 1039 | Ga0207691_10027220 | |||
| 1040 | Ga0207691_10097130 | |||
| 1041 | Ga0207691_10142614 | |||
| 1042 | Ga0207711_10001548 | |||
| 1043 | Ga0207711_10001690 | |||
| 1044 | Ga0207711_10001939 | |||
| 1045 | Ga0207711_10003618 | |||
| 1046 | Ga0207711_10006835 | |||
| 1047 | Ga0207689_10061878 | |||
| 1048 | Ga0207661_10001486 | |||
| 1049 | Ga0207661_10038561 | |||
| 1050 | Ga0207679_10051391 | |||
| 1051 | Ga0207679_10052316 | |||
| 1052 | Ga0207679_10071392 | |||
| 1053 | Ga0207679_10178808 | |||
| 1054 | Ga0207679_10517518 | |||
| 1055 | Ga0207667_10004629 | |||
| 1056 | Ga0207667_10005521 | |||
| 1057 | Ga0207667_10012704 | |||
| 1058 | Ga0207667_10030071 | |||
| 1059 | Ga0207667_10046947 | |||
| 1060 | Ga0207667_10286408 | |||
| 1061 | Ga0207667_10428971 | |||
| 1062 | Ga0207651_10010963 | |||
| 1063 | Ga0207651_10029727 | |||
| 1064 | Ga0207640_10011846 | |||
| 1065 | Ga0207640_10020089 | |||
| 1066 | Ga0207640_10064446 | |||
| 1067 | Ga0207640_10235621 | |||
| 1068 | Ga0207640_10281278 | |||
| 1069 | Ga0207640_10424413 | |||
| 1070 | Ga0207658_10002182 | |||
| 1071 | Ga0207658_10085750 | |||
| 1072 | Ga0207658_10154442 | |||
| 1073 | Ga0207677_10003094 | |||
| 1074 | Ga0207677_10105748 | |||
| 1075 | Ga0207677_10402301 | |||
| 1076 | Ga0207703_10011174 | |||
| 1077 | Ga0207703_10266045 | |||
| 1078 | Ga0207703_11501286 | |||
| 1079 | Ga0207639_10027601 | |||
| 1080 | Ga0207639_10048394 | |||
| 1081 | Ga0207639_10234842 | |||
| 1082 | Ga0207639_10362176 | |||
| 1083 | Ga0207639_11004287 | |||
| 1084 | Ga0207678_10003264 | |||
| 1085 | Ga0207678_10007049 | |||
| 1086 | Ga0207678_10007874 | |||
| 1087 | Ga0207678_10021167 | |||
| 1088 | Ga0207678_10021916 | |||
| 1089 | Ga0207678_10033391 | |||
| 1090 | Ga0207678_10586382 | |||
| 1091 | Ga0207702_10005931 | |||
| 1092 | Ga0207702_10018054 | |||
| 1093 | Ga0207702_10749481 | |||
| 1094 | Ga0207641_10115912 | |||
| 1095 | Ga0207641_10316134 | |||
| 1096 | Ga0207641_10807694 | |||
| 1097 | Ga0207648_10003640 | |||
| 1098 | Ga0207648_10037185 | |||
| 1099 | Ga0207676_10007387 | |||
| 1100 | Ga0207676_10130076 | |||
| 1101 | Ga0207676_10461405 | |||
| 1102 | Ga0207674_10002992 | |||
| 1103 | Ga0207674_10007460 | |||
| 1104 | Ga0207674_10078538 | |||
| 1105 | Ga0207674_10243247 | |||
| 1106 | Ga0207674_10532959 | |||
| 1107 | Ga0207675_100035806 | |||
| 1108 | Ga0207683_10001954 | |||
| 1109 | Ga0207683_10007409 | |||
| 1110 | Ga0207683_10014754 | |||
| 1111 | Ga0207683_10146387 | |||
| 1112 | Ga0207698_10004870 | |||
| 1113 | Ga0207698_10007906 | |||
| 1114 | Ga0207698_10036417 | |||
| 1115 | Ga0207698_10083077 | |||
| 1116 | Ga0207698_10105969 | |||
| 1117 | Ga0207698_10283411 | |||
| 1118 | Ga0207698_10360435 | |||
| 1119 | Ga0207698_10432017 | |||
| 1120 | Ga0207698_10604218 | |||
| 1121 | Ga0207698_10699788 | |||
| 1122 | Ga0207698_11281133 | |||
| 1123 | Ga0268266_10561392 | |||
| 1124 | Ga0268264_10126419 | |||
| 1125 | Ga0268264_10126555 | |||
| 1126 | Ga0307408_100008775 | |||
| 1127 | Ga0307405_10006643 | |||
| 1128 | Ga0307405_10102577 | |||
| 1129 | Ga0307413_10013570 | |||
| 1130 | Ga0307413_10120075 | |||
| 1131 | Ga0307413_10481807 | |||
| 1132 | Ga0307410_10005503 | |||
| 1133 | Ga0307410_10092286 | |||
| 1134 | Ga0307410_10326677 | |||
| 1135 | Ga0307406_10030120 | |||
| 1136 | Ga0307406_10052865 | |||
| 1137 | Ga0307407_10060432 | |||
| 1138 | Ga0307412_10013895 | |||
| 1139 | Ga0307412_10154569 | |||
| 1140 | Ga0307409_100005694 | |||
| 1141 | Ga0307409_100226076 | |||
| 1142 | Ga0307416_100016023 | |||
| 1143 | Ga0307416_100019565 | |||
| 1144 | Ga0307416_100122851 | |||
| 1145 | Ga0307414_10035268 | |||
| 1146 | Ga0307414_10868799 | |||
| 1147 | Ga0307411_10024827 | |||
| 1148 | Ga0307411_10232881 | |||
| 1149 | Ga0307415_100008308 | |||
| 1150 | Ga0307415_100009449 | |||
| 1151 | Ga0307415_100223658 | |||
| 1152 | Ga0373946_0030460 | |||
| 1153 | Ga0373931_0048019 | |||
| 1154 | Ga0373935_0014000 | |||
| 1155 | Ga0373947_0021896 | |||
| 1156 | Ga0373925_0399294 | |||
| 1157 | Ga0395899_0000274 | |||
| 1158 | Ga0395899_0013744 | |||
| 1159 | Ga0395899_0018865 | |||
| 1160 | Ga0395899_0022022 | |||
| 1161 | Ga0395899_0038774 | |||
| 1162 | Ga0395899_0043264 | |||
| 1163 | Ga0395899_0056578 | |||
| 1164 | Ga0395899_0070897 | |||
| 1165 | Ga0395899_0085878 | |||
| 1166 | Ga0395899_0115094 | |||
| 1167 | Ga0395899_0125702 | |||
| 1168 | Ga0395899_0179765 | |||
| 1169 | Ga0395900_0000595 | |||
| 1170 | Ga0395900_0004150 | |||
| 1171 | Ga0395900_0018303 | |||
| 1172 | Ga0395900_0021697 | |||
| 1173 | Ga0395900_0046219 | |||
| 1174 | Ga0395900_0065619 | |||
| 1175 | Ga0395900_0075993 | |||
| 1176 | Ga0395900_0076541 | |||
| 1177 | Ga0395900_0128536 | |||
| 1178 | Ga0395900_0131492 | |||
| 1179 | Ga0395900_0190363 | |||
| 1180 | Ga0395900_0295802 | |||
| 1181 | Ga0395900_0313818 | |||
| 1182 | Ga0395900_0363748 | |||
| 1183 | Ga0395900_0474290 | |||
| 1184 | Ga0395900_1152973 | |||
| 1185 | Ga0395898_0005114 | |||
| 1186 | Ga0395898_0006829 | |||
| 1187 | Ga0395898_0017203 | |||
| 1188 | Ga0395898_0017744 | |||
| 1189 | Ga0395898_0049227 | |||
| 1190 | Ga0395898_0050768 | |||
| 1191 | Ga0395898_0061040 | |||
| 1192 | Ga0395898_0106111 | |||
| 1193 | Ga0395898_0113466 | |||
| 1194 | Ga0395898_0114951 | |||
| 1195 | Ga0395898_0184567 | |||
| 1196 | Ga0395898_0200060 | |||
| 1197 | Ga0395898_0403965 | |||
| 1198 | Ga0395898_0951202 | |||
| 1199 | Ga0395905_0002328 | |||
| 1200 | Ga0395905_0003746 | |||
| 1201 | Ga0395905_0010952 | |||
| 1202 | Ga0395905_0011179 | |||
| 1203 | Ga0395905_0017132 | |||
| 1204 | Ga0395905_0021701 | |||
| 1205 | Ga0395905_0030485 | |||
| 1206 | Ga0395905_0050891 | |||
| 1207 | Ga0395905_0052491 | |||
| 1208 | Ga0395905_0119707 | |||
| 1209 | Ga0395905_0141293 | |||
| 1210 | Ga0395905_0160654 | |||
| 1211 | Ga0395905_0246702 | |||
| 1212 | Ga0395905_0278549 | |||
| 1213 | Ga0395905_0290204 | |||
| 1214 | Ga0395905_0429134 | |||
| 1215 | Ga0395905_0912460 | |||
| 1216 | Ga0395901_0001391 | |||
| 1217 | Ga0395901_0005012 | |||
| 1218 | Ga0395901_0005682 | |||
| 1219 | Ga0395901_0007094 | |||
| 1220 | Ga0395901_0012920 | |||
| 1221 | Ga0395901_0039018 | |||
| 1222 | Ga0395901_0080083 | |||
| 1223 | Ga0395901_0080413 | |||
| 1224 | Ga0395901_0082438 | |||
| 1225 | Ga0395901_0118824 | |||
| 1226 | Ga0395901_0291162 | |||
| 1227 | Ga0395901_0301711 | |||
| 1228 | Ga0395901_0658451 | |||
| 1229 | Ga0395901_0680966 | |||
| 1230 | Ga0395901_1139394 | |||
| 1231 | Ga0436365_0736792 | |||
| 1232 | Ga0439448_0002283 | |||
| 1233 | Ga0439458_0001082 | |||
| 1234 | Ga0466965_0020932 | |||
| 1235 | Ga0466966_0038977 | |||
| 1236 | Ga0466966_0230991 | |||
| 1237 | Ga0466961_0054393 | |||
| 1238 | Ga0466961_0169047 | |||
| 1239 | Ga0466961_0198862 | |||
| 1240 | Ga0466963_0207185 | |||
| 1241 | Ga0466963_0359408 | |||
| 1242 | Ga0466963_0572762 | |||
| 1243 | Ga0466964_0012707 | |||
| 1244 | Ga0466971_0069518 | |||
| 1245 | Ga0466970_0005408 | |||
| 1246 | Ga0466970_0193586 | |||
| 1247 | Ga0466970_0226551 | |||
| 1248 | Ga0466970_0280565 | |||
| 1249 | Ga0466957_0087909 | |||
| 1250 | Ga0466957_0435089 | |||
| 1251 | Ga0466960_0399578 | |||
| 1252 | Ga0466959_0031093 | |||
| 1253 | Ga0466959_0038450 | |||
| 1254 | Ga0466958_0011871 | |||
| 1255 | Ga0466958_0034898 | |||
| 1256 | Ga0466958_0155321 | |||
| 1257 | Ga0466967_0176085 | |||
| 1258 | Ga0466967_0775343 | |||
| 1259 | Ga0495669_0070262 | |||
| 1260 | Ga0495669_0091710 | |||
| 1261 | Ga0495677_0036977 | |||
| 1262 | Ga0495677_0040249 | |||
| 1263 | Ga0496100_0001297 | |||
| 1264 | Ga0496101_0001820 | |||
| 1265 | Ga0496102_0013872 | |||
| 1266 | Ga0496103_0082086 | |||
| 1267 | Ga0496105_0391590 | |||
| 1268 | Ga0496106_0020047 | |||
| 1269 | Ga0496107_0000488 | |||
| 1270 | Ga0496107_0129165 | |||
| 1271 | Ga0496108_0004915 | |||
| 1272 | Ga0496108_0028497 | |||
| 1273 | Ga0496109_0011392 | |||
| 1274 | Ga0496109_0075799 | |||
| 1275 | Ga0496109_0279831 | |||
| 1276 | Ga0496109_0349630 | |||
| 1277 | Ga0496109_0656373 | |||
| 1278 | Ga0496110_0001671 | |||
| 1279 | Ga0496111_0011249 | |||
| 1280 | Ga0496111_0094524 | |||
| 1281 | Ga0496112_0261408 | |||
| 1282 | Ga0496113_0116134 | |||
| 1283 | Ga0496113_0325872 | |||
| 1284 | Ga0496114_0000006 | |||
| 1285 | Ga0501069_0157337 | |||
| 1286 | Ga0501201_012335 | |||
| 1287 | Ga0501223_025215 | |||
| 1288 | Ga0501227_043720 | |||
| 1289 | Ga0501225_0010778 | |||
| 1290 | Ga0466962_0188118 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy