F472074

General Info

Members Datasets Scaffolds Average Seq Length
644 462 1288 218

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0296423|Ga0496109_0296423_152_862
Length 236
Sequence MIMTKEAPKTTRKSASKPANGPAGETIDLALPKPFSSRAERAAERRAAIIEAAMDEFIARGFAATRLDDVAKRAGVAKGTIYLHFKDKEALFEDLIRTAIVPLVNQLGAGPPPVGASVRDMIEGFARTFIQEVTTTRRGDIVRLIVAEGPRFPEIADFYYREVVSKGLAGMRAAISLGIARGEIQHKDLAQFPQILIAPAMIAVIWQSLFSKHAPLDAIEMFRVHLDLIFGERRTT

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
59 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
135 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
136 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
137 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
279 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
283 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
284 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
287 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
288 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
289 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
290 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
291 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
292 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
293 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
296 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
297 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
298 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
299 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
300 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
304 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
305 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
308 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
309 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
310 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
311 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
312 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
313 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
314 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
315 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
316 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
317 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
318 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
319 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
320 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
321 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
322 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
323 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
324 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
325 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
326 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
327 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
328 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
329 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
330 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
331 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
332 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
333 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
334 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
335 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
336 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
337 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
338 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
339 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
340 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
341 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
342 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
343 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
344 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
345 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
346 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
347 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
348 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
349 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
350 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
351 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
352 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
353 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
354 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
355 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
356 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
357 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
358 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
359 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
360 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
361 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
362 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
363 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
364 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
365 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
366 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
367 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
368 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
369 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
370 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
371 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
372 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
373 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
374 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
375 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
376 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
377 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
378 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
379 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
380 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
381 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
382 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
383 2906610324
384 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
385 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
386 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
387 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
388 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
389 2922368715
390 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
391 2922425934
392 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
393 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
394 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
395 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
396 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
397 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
398 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
399 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
400 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
401 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
402 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
403 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
404 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
405 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
406 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
407 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
408 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
409 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
410 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
411 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
412 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
413 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
414 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
415 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
416 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
417 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
418 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
419 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
420 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
421 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
422 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
423 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
424 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
425 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
426 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
427 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
428 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
429 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
430 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
431 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
432 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
433 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
434 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
435 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
436 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
437 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
438 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
439 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
440 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
441 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
442 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
443 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
444 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
445 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
446 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
447 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
448 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
449 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
450 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
451 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
452 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
453 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
454 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
455 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
456 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
457 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
458 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
459 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
460 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
461 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
462 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.69
Metatranscriptomes 0
Isolates 22.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 17.08
Rhizoplane 2.8
Rhizosphere 52.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0296423 3300048912 Bacteria 1525
2 RicEn_C9286 2010549000 Bacteria 1292
3 JGI25153J46596_10002262 3300003215 Bacteria 11217
4 rootL2_10212093 3300003322 Bacteria 1313
5 JGI25160J50197_1000504 3300003354 Bacteria 23228
6 Ga0055542_1022221 3300003762 Bacteria 905
7 Ga0065165_1000278 3300005262 Bacteria 87353
8 Ga0070676_10209625 3300005328 Bacteria 1282
9 Ga0070683_100220572 3300005329 Bacteria 1802
10 Ga0070683_100382796 3300005329 Bacteria 1341
11 Ga0068869_100032657 3300005334 Bacteria 3669
12 Ga0070680_100120406 3300005336 Bacteria 2191
13 Ga0068868_100260338 3300005338 Bacteria 1462
14 Ga0070660_100010789 3300005339 Bacteria 6468
15 Ga0070691_10291187 3300005341 Bacteria 889
16 Ga0070661_100051599 3300005344 Bacteria 3010
17 Ga0070661_100101466 3300005344 Bacteria 2141
18 Ga0070668_100155147 3300005347 Bacteria 1854
19 Ga0070669_100269093 3300005353 Bacteria 1362
20 Ga0070671_100201520 3300005355 Bacteria 1688
21 Ga0070659_100465735 3300005366 Bacteria 1074
22 Ga0070667_100111593 3300005367 Bacteria 2372
23 Ga0070709_10027043 3300005434 Bacteria 3408
24 Ga0070709_10059724 3300005434 Bacteria 2422
25 Ga0070714_100026363 3300005435 Bacteria 4803
26 Ga0070714_100068810 3300005435 Bacteria 3056
27 Ga0070714_100206316 3300005435 Bacteria 1800
28 Ga0070713_100046773 3300005436 Bacteria 3552
29 Ga0070713_100284513 3300005436 Bacteria 1518
30 Ga0070713_100415984 3300005436 Bacteria 1258
31 Ga0070711_100010148 3300005439 Bacteria 5819
32 Ga0070711_100055685 3300005439 Bacteria 2733
33 Ga0070663_100167747 3300005455 Bacteria 1695
34 Ga0070678_100067978 3300005456 Bacteria 2654
35 Ga0070662_100040741 3300005457 Bacteria 3309
36 Ga0070681_10028493 3300005458 Bacteria 5615
37 Ga0070679_100022437 3300005530 Bacteria 6169
38 Ga0070679_100203887 3300005530 Bacteria 1943
39 Ga0070684_100010644 3300005535 Bacteria 7294
40 Ga0070684_100037899 3300005535 Bacteria 4138
41 Ga0070697_100044646 3300005536 Bacteria 3590
42 Ga0068855_100036244 3300005563 Bacteria 5872
43 Ga0068855_100945833 3300005563 Bacteria 908
44 Ga0068856_100176374 3300005614 Bacteria 2150
45 Ga0068852_100724410 3300005616 Bacteria 1006
46 Ga0068859_100287684 3300005617 Bacteria 1736
47 Ga0068859_100717724 3300005617 Bacteria 1090
48 Ga0068864_100011235 3300005618 Bacteria 7399
49 Ga0068861_100114047 3300005719 Bacteria 2169
50 Ga0068851_10468980 3300005834 Bacteria 751
51 Ga0068863_100209522 3300005841 Bacteria 1877
52 Ga0068858_100069742 3300005842 Bacteria 3258
53 Ga0068858_100142967 3300005842 Bacteria 2246
54 Ga0068860_100000240 3300005843 Bacteria 83866
55 Ga0068860_100399425 3300005843 Bacteria 1360
56 Ga0068862_100099701 3300005844 Bacteria 2539
57 Ga0068862_100253094 3300005844 Bacteria 1606
58 Ga0081540_1003729 3300005983 Bacteria 11938
59 Ga0081540_1011415 3300005983 Bacteria 5938
60 Ga0081540_1175048 3300005983 Bacteria 811
61 Ga0081539_10007751 3300005985 Bacteria 9622
62 Ga0070717_10122998 3300006028 Bacteria 2225
63 Ga0075365_10052571 3300006038 Bacteria 2695
64 Ga0075365_10105534 3300006038 Bacteria 1932
65 Ga0075365_10230360 3300006038 Bacteria 1300
66 Ga0075368_10007174 3300006042 Bacteria 3927
67 Ga0075368_10054928 3300006042 Bacteria 1587
68 Ga0075368_10197444 3300006042 Bacteria 851
69 Ga0075363_100001650 3300006048 Bacteria 8628
70 Ga0075364_10248597 3300006051 Bacteria 1209
71 Ga0070715_10092453 3300006163 Bacteria 1395
72 Ga0070715_10309070 3300006163 Bacteria 849
73 Ga0070716_100011343 3300006173 Bacteria 4486
74 Ga0070712_100018443 3300006175 Bacteria 4534
75 Ga0070712_100213343 3300006175 Bacteria 1523
76 Ga0075369_10019487 3300006186 Bacteria 2770
77 Ga0075369_10056550 3300006186 Bacteria 1705
78 Ga0075369_10312322 3300006186 Bacteria 735
79 Ga0097621_100033808 3300006237 Bacteria 4075
80 Ga0097621_100674896 3300006237 Bacteria 950
81 Ga0068871_100017134 3300006358 Bacteria 5475
82 Ga0075434_100044151 3300006871 Bacteria 4422
83 Ga0075434_100325853 3300006871 Bacteria 1557
84 Ga0097620_100287671 3300006931 Bacteria 1736
85 Ga0097620_100717674 3300006931 Bacteria 1090
86 Ga0099824_1017617 3300006942 Bacteria 6127
87 Ga0099822_1002963 3300006943 Bacteria 21553
88 Ga0075435_100075137 3300007076 Bacteria 2766
89 Ga0099795_10242191 3300007788 Bacteria 775
90 Ga0105240_10365551 3300009093 Bacteria 1633
91 Ga0105240_10641833 3300009093 Bacteria 1165
92 Ga0105245_10034342 3300009098 Bacteria 4498
93 Ga0105247_10017329 3300009101 Bacteria 4324
94 Ga0105247_10535911 3300009101 Bacteria 858
95 Ga0105243_10048108 3300009148 Bacteria 3360
96 Ga0105243_10587569 3300009148 Bacteria 1070
97 Ga0105241_10054933 3300009174 Bacteria 3050
98 Ga0105241_10089422 3300009174 Bacteria 2426
99 Ga0105241_11075988 3300009174 Bacteria 756
100 Ga0105242_10247940 3300009176 Bacteria 1603
101 Ga0105248_10099852 3300009177 Bacteria 3270
102 Ga0105237_10003312 3300009545 Bacteria 19195
103 Ga0105237_10012234 3300009545 Bacteria 9045
104 Ga0105237_10035674 3300009545 Bacteria 5031
105 Ga0105237_10123123 3300009545 Bacteria 2587
106 Ga0105238_10048562 3300009551 Bacteria 4276
107 Ga0105238_10062165 3300009551 Bacteria 3735
108 Ga0105238_10778792 3300009551 Bacteria 971
109 Ga0099796_10027744 3300010159 Bacteria 1811
110 Ga0105239_10022884 3300010375 Bacteria 6889
111 Ga0105239_10157705 3300010375 Bacteria 2535
112 Ga0105239_10400191 3300010375 Bacteria 1554
113 Ga0105246_10041441 3300011119 Bacteria 3112
114 Ga0105246_10409971 3300011119 Bacteria 1128
115 Ga0105246_10763724 3300011119 Bacteria 854
116 Ga0157369_10033485 3300013105 Bacteria 5646
117 Ga0157378_10427356 3300013297 Bacteria 1310
118 Ga0163163_10153121 3300014325 Bacteria 2349
119 Ga0163163_10524473 3300014325 Bacteria 1247
120 Ga0163163_10526826 3300014325 Bacteria 1244
121 Ga0157379_10185296 3300014968 Bacteria 1881
122 Ga0157376_10233069 3300014969 Bacteria 1711
123 Ga0213873_10014037 3300021358 Bacteria 1769
124 Ga0213875_10141351 3300021388 Bacteria 1126
125 Ga0209563_103359 3300025230 Bacteria 3332
126 Ga0209677_105274 3300025253 Bacteria 3422
127 Ga0209148_1000574 3300025254 Bacteria 34124
128 Ga0209233_1004212 3300025261 Bacteria 4931
129 Ga0209455_1000834 3300025272 Bacteria 16636
130 Ga0209564_1029379 3300025295 Bacteria 1731
131 Ga0209758_1000498 3300025297 Bacteria 64011
132 Ga0209758_1015655 3300025297 Bacteria 3910
133 Ga0209758_1045976 3300025297 Bacteria 1579
134 Ga0209256_1024358 3300025299 Bacteria 1783
135 Ga0207426_1000721 3300025302 Bacteria 38161
136 Ga0207426_1015834 3300025302 Bacteria 2726
137 Ga0209257_1063542 3300025304 Bacteria 995
138 Ga0207697_10021892 3300025315 Bacteria 2619
139 Ga0207692_10000702 3300025898 Bacteria 11780
140 Ga0207692_10339234 3300025898 Bacteria 924
141 Ga0207710_10279945 3300025900 Bacteria 839
142 Ga0207647_10011713 3300025904 Bacteria 6138
143 Ga0207685_10136121 3300025905 Bacteria 1096
144 Ga0207699_10001397 3300025906 Bacteria 11471
145 Ga0207699_10047362 3300025906 Bacteria 2520
146 Ga0207645_10133672 3300025907 Bacteria 1615
147 Ga0207705_10017045 3300025909 Bacteria 5203
148 Ga0207654_10067495 3300025911 Bacteria 2113
149 Ga0207707_10005454 3300025912 Bacteria 11118
150 Ga0207695_10046953 3300025913 Bacteria 4574
151 Ga0207695_10427081 3300025913 Bacteria 1209
152 Ga0207671_10060487 3300025914 Bacteria 2810
153 Ga0207693_10016800 3300025915 Bacteria 5842
154 Ga0207693_10031102 3300025915 Bacteria 4217
155 Ga0207693_10197579 3300025915 Bacteria 1582
156 Ga0207663_10071461 3300025916 Bacteria 2240
157 Ga0207663_10184582 3300025916 Bacteria 1492
158 Ga0207660_10124137 3300025917 Bacteria 1959
159 Ga0207657_10186851 3300025919 Bacteria 1673
160 Ga0207649_10219042 3300025920 Bacteria 1355
161 Ga0207652_10001798 3300025921 Bacteria 18633
162 Ga0207652_10017746 3300025921 Bacteria 5829
163 Ga0207681_10225060 3300025923 Bacteria 1453
164 Ga0207694_10116911 3300025924 Bacteria 2125
165 Ga0207694_10156005 3300025924 Bacteria 1841
166 Ga0207694_10319331 3300025924 Bacteria 1281
167 Ga0207650_10038362 3300025925 Bacteria 3498
168 Ga0207687_10005054 3300025927 Bacteria 8732
169 Ga0207700_10006382 3300025928 Bacteria 7116
170 Ga0207700_10127450 3300025928 Bacteria 2073
171 Ga0207664_10026844 3300025929 Bacteria 4358
172 Ga0207644_10009377 3300025931 Bacteria 6429
173 Ga0207644_10406731 3300025931 Bacteria 1113
174 Ga0207709_10078643 3300025935 Bacteria 2118
175 Ga0207665_10004907 3300025939 Bacteria 8915
176 Ga0207665_10052545 3300025939 Bacteria 2745
177 Ga0207665_10268465 3300025939 Bacteria 1266
178 Ga0207665_10319150 3300025939 Bacteria 1165
179 Ga0207711_10209900 3300025941 Bacteria 1779
180 Ga0207689_10027511 3300025942 Bacteria 4759
181 Ga0207661_10021041 3300025944 Bacteria 4885
182 Ga0207661_10753259 3300025944 Bacteria 896
183 Ga0207679_10506040 3300025945 Bacteria 1078
184 Ga0207667_10007884 3300025949 Bacteria 12714
185 Ga0207651_10864145 3300025960 Bacteria 804
186 Ga0207668_10123494 3300025972 Bacteria 1964
187 Ga0207677_10047609 3300026023 Bacteria 2880
188 Ga0207703_10389878 3300026035 Bacteria 1290
189 Ga0207703_10575154 3300026035 Bacteria 1064
190 Ga0207639_10004621 3300026041 Bacteria 9267
191 Ga0207678_10018858 3300026067 Bacteria 6060
192 Ga0207702_10000403 3300026078 Bacteria 49280
193 Ga0207676_10039626 3300026095 Bacteria 3605
194 Ga0207674_10091587 3300026116 Bacteria 3030
195 Ga0207674_10254513 3300026116 Bacteria 1703
196 Ga0207683_10038299 3300026121 Bacteria 4178
197 Ga0207698_10621394 3300026142 Bacteria 1067
198 Ga0209389_1000025 3300027296 Bacteria 149588
199 Ga0209589_1000018 3300027357 Bacteria 192614
200 Ga0209589_1000066 3300027357 Bacteria 100795
201 Ga0209489_100026 3300027361 Bacteria 192614
202 Ga0209489_100030 3300027361 Bacteria 185999
203 Ga0209700_100035 3300027363 Bacteria 192614
204 Ga0209588_1025157 3300027671 Bacteria 1882
205 Ga0209813_10018563 3300027866 Bacteria 1924
206 Ga0268266_10350817 3300028379 Bacteria 1386
207 Ga0268265_10753440 3300028380 Bacteria 945
208 Ga0268264_10000035 3300028381 Bacteria 398196
209 Ga0268264_10221943 3300028381 Bacteria 1740
210 Ga0307511_10081777 3300030521 Bacteria 2264
211 Ga0307509_10007153 3300031507 Bacteria 14704
212 Ga0307509_10191035 3300031507 Bacteria 1899
213 Ga0307508_10121413 3300031616 Bacteria 2215
214 Ga0265314_10038916 3300031711 Bacteria 3431
215 Ga0265314_10110866 3300031711 Bacteria 1744
216 Ga0265342_10002787 3300031712 Bacteria 14791
217 Ga0307516_10010831 3300031730 Bacteria 9978
218 Ga0307516_10062664 3300031730 Bacteria 3603
219 Ga0307415_100456496 3300032126 Bacteria 1106
220 Ga0307510_10049877 3300033180 Bacteria 4448
221 Ga0307510_10055825 3300033180 Bacteria 4121
222 Ga0373923_0019424 3300035111 Bacteria 2631
223 Ga0373936_0002935 3300035113 Bacteria 6373
224 Ga0373936_0117957 3300035113 Bacteria 1131
225 Ga0373953_0000420 3300035117 Bacteria 11547
226 Ga0373953_0251308 3300035117 Bacteria 768
227 Ga0373954_0000663 3300035118 Bacteria 13181
228 Ga0373956_0000275 3300035119 Bacteria 20650
229 Ga0373957_0000426 3300035120 Bacteria 10649
230 Ga0373943_0002244 3300035170 Bacteria 8781
231 Ga0373946_0022256 3300035171 Bacteria 2465
232 Ga0373955_0000510 3300035172 Bacteria 16513
233 Ga0373955_0175522 3300035172 Bacteria 1270
234 Ga0373924_0031154 3300035410 Bacteria 2143
235 Ga0373935_0000344 3300035692 Bacteria 23571
236 Ga0373935_0027493 3300035692 Bacteria 3515
237 Ga0373935_0219654 3300035692 Bacteria 1320
238 Ga0373927_0000665 3300035695 Bacteria 26133
239 Ga0373927_0011552 3300035695 Bacteria 5883
240 Ga0373933_0000405 3300035724 Bacteria 27323
241 Ga0373933_0003239 3300035724 Bacteria 9087
242 Ga0373933_0344961 3300035724 Bacteria 967
243 Ga0373947_0003567 3300035725 Bacteria 9185
244 Ga0373947_0092699 3300035725 Bacteria 1887
245 Ga0373937_0016746 3300036401 Bacteria 6514
246 Ga0373937_0019554 3300036401 Bacteria 6060
247 Ga0373937_0038342 3300036401 Bacteria 4366
248 Ga0373925_0051507 3300037068 Bacteria 3073
249 Ga0373925_0099301 3300037068 Bacteria 2236
250 Ga0395900_0001369 3300037418 Bacteria 29330
251 Ga0395900_0490131 3300037418 Bacteria 1181
252 Ga0395898_0132467 3300037466 Bacteria 2387
253 Ga0395905_0019296 3300037471 Bacteria 6464
254 Ga0395905_0060245 3300037471 Bacteria 3550
255 Ga0436364_1260694 3300037853 Bacteria 2707
256 Ga0395901_0004623 3300038443 Bacteria 13893
257 Ga0395901_0112041 3300038443 Bacteria 2866
258 Ga0436365_0722166 3300039437 Bacteria 4126
259 Ga0436365_1348420 3300039437 Bacteria 1603
260 Ga0436360_0579443 3300039438 Bacteria 1290
261 Ga0436361_0126094 3300039447 Bacteria 5267
262 Ga0436363_0188494 3300039450 Bacteria 1986
263 Ga0436363_1417522 3300039450 Bacteria 845
264 Ga0436362_1039640 3300039453 Bacteria 2753
265 Ga0466969_0014853 3300044656 Bacteria 4088
266 Ga0466965_0047899 3300044683 Bacteria 2116
267 Ga0466966_0001348 3300044684 Bacteria 15776
268 Ga0466966_0031942 3300044684 Bacteria 3415
269 Ga0466966_0085860 3300044684 Bacteria 1957
270 Ga0466961_0000120 3300044693 Bacteria 52569
271 Ga0466961_0123635 3300044693 Bacteria 1624
272 Ga0466963_0011705 3300044694 Bacteria 5348
273 Ga0466963_0356987 3300044694 Bacteria 1029
274 Ga0466960_0037601 3300044901 Bacteria 2272
275 Ga0466959_0097855 3300045049 Bacteria 2102
276 Ga0466959_0108014 3300045049 Bacteria 1988
277 Ga0466959_0472605 3300045049 Bacteria 849
278 Ga0466958_0346233 3300045836 Bacteria 956
279 Ga0466967_0077104 3300045976 Bacteria 3000
280 Ga0466967_0082012 3300045976 Bacteria 2914
281 Ga0466967_0420708 3300045976 Bacteria 1302
282 Ga0495592_0003383 3300046454 Bacteria 11439
283 Ga0495592_0036537 3300046454 Bacteria 3699
284 Ga0495592_0441859 3300046454 Bacteria 816
285 Ga0495603_0000094 3300046455 Bacteria 40636
286 Ga0495603_0013103 3300046455 Bacteria 5012
287 Ga0495603_0020849 3300046455 Bacteria 3968
288 Ga0495590_0226704 3300046457 Bacteria 691
289 Ga0495629_0000612 3300046459 Bacteria 29083
290 Ga0495629_0001119 3300046459 Bacteria 21231
291 Ga0495638_0004073 3300046460 Bacteria 11197
292 Ga0495641_0003738 3300046461 Bacteria 11192
293 Ga0495651_0000889 3300046462 Bacteria 23256
294 Ga0495651_0009999 3300046462 Bacteria 7292
295 Ga0495653_0000399 3300046463 Bacteria 34847
296 Ga0495580_0002084 3300046472 Bacteria 17548
297 Ga0495582_0000256 3300046473 Bacteria 29694
298 Ga0495605_0096450 3300046474 Bacteria 1364
299 Ga0495639_0000114 3300046475 Bacteria 40307
300 Ga0495639_0079658 3300046475 Bacteria 1524
301 Ga0495662_0003498 3300046476 Bacteria 7946
302 Ga0495664_0007443 3300046477 Bacteria 6082
303 Ga0495594_0000393 3300046499 Bacteria 22014
304 Ga0495606_0246950 3300046507 Bacteria 992
305 Ga0495608_0001226 3300046511 Bacteria 18178
306 Ga0495608_0059203 3300046511 Bacteria 2524
307 Ga0495618_0220654 3300046514 Bacteria 1196
308 Ga0495620_0225393 3300046515 Bacteria 717
309 Ga0495628_0021333 3300046516 Bacteria 5331
310 Ga0495628_0026173 3300046516 Bacteria 4762
311 Ga0495628_0042972 3300046516 Bacteria 3602
312 Ga0495630_0000459 3300046517 Bacteria 30805
313 Ga0495643_0076606 3300046522 Bacteria 1748
314 Ga0495648_0069995 3300046524 Bacteria 2040
315 Ga0495666_0047291 3300046526 Bacteria 2072
316 Ga0495652_0006874 3300046529 Bacteria 10531
317 Ga0495652_0017641 3300046529 Bacteria 6370
318 Ga0495665_0000130 3300046531 Bacteria 35880
319 Ga0495640_0007646 3300046533 Bacteria 8498
320 Ga0495640_0016287 3300046533 Bacteria 5564
321 Ga0495640_0077117 3300046533 Bacteria 2222
322 Ga0495587_0001432 3300046536 Bacteria 15878
323 Ga0495587_0101081 3300046536 Bacteria 1661
324 Ga0495645_0001776 3300046543 Bacteria 14687
325 Ga0495622_0005481 3300046557 Bacteria 5885
326 Ga0495622_0022021 3300046557 Bacteria 2969
327 Ga0495622_0031173 3300046557 Bacteria 2492
328 Ga0495667_0001452 3300046559 Bacteria 15607
329 Ga0495667_0005133 3300046559 Bacteria 8844
330 Ga0495667_0020287 3300046559 Bacteria 4485
331 Ga0495668_0094861 3300046616 Bacteria 1633
332 Ga0495634_0002801 3300046642 Bacteria 14322
333 Ga0495634_0231703 3300046642 Bacteria 1136
334 Ga0495625_0284382 3300046660 Bacteria 1063
335 Ga0495635_0000088 3300046663 Bacteria 54355
336 Ga0495635_0006280 3300046663 Bacteria 8276
337 Ga0495588_0004028 3300046674 Bacteria 6463
338 Ga0495657_0001352 3300046675 Bacteria 21318
339 Ga0495657_0003974 3300046675 Bacteria 11866
340 Ga0495657_0108585 3300046675 Bacteria 1760
341 Ga0495599_0001137 3300046678 Bacteria 15035
342 Ga0495599_0008246 3300046678 Bacteria 6335
343 Ga0495599_0044471 3300046678 Bacteria 2785
344 Ga0495623_0006628 3300046679 Bacteria 7538
345 Ga0495623_0039776 3300046679 Bacteria 3004
346 Ga0495623_0081886 3300046679 Bacteria 1995
347 Ga0495646_0002433 3300046680 Bacteria 11422
348 Ga0495646_0016831 3300046680 Bacteria 4644
349 Ga0495646_0290084 3300046680 Bacteria 867
350 Ga0495647_0000070 3300046681 Bacteria 24847
351 Ga0495613_0004685 3300046689 Bacteria 10263
352 Ga0495613_0084216 3300046689 Bacteria 2309
353 Ga0495624_0000079 3300046690 Bacteria 63196
354 Ga0495624_0061882 3300046690 Bacteria 2343
355 Ga0495624_0090495 3300046690 Bacteria 1888
356 Ga0495589_0116943 3300046794 Bacteria 1285
357 Ga0495600_0000484 3300046809 Bacteria 20528
358 Ga0495600_0000715 3300046809 Bacteria 17456
359 Ga0495600_0153992 3300046809 Bacteria 1487
360 Ga0495581_0000082 3300047315 Bacteria 38294
361 Ga0495604_0001221 3300047317 Bacteria 21092
362 Ga0495604_0002253 3300047317 Bacteria 15447
363 Ga0495674_0001729 3300047319 Bacteria 21443
364 Ga0495674_0028341 3300047319 Bacteria 5108
365 Ga0495674_0029949 3300047319 Bacteria 4952
366 Ga0495672_0217952 3300047320 Bacteria 944
367 Ga0495676_0016546 3300047321 Bacteria 6540
368 Ga0495680_0004231 3300047322 Bacteria 13778
369 Ga0495680_0006059 3300047322 Bacteria 11303
370 Ga0495683_0021360 3300047323 Bacteria 3336
371 Ga0495687_011038 3300047443 Bacteria 4891
372 Ga0495687_095344 3300047443 Bacteria 1129
373 Ga0495675_0000977 3300047444 Bacteria 17351
374 Ga0495675_0022872 3300047444 Bacteria 3985
375 Ga0495684_0001326 3300047471 Bacteria 19921
376 Ga0495684_0101470 3300047471 Bacteria 2175
377 Ga0495593_0000206 3300047673 Bacteria 31187
378 Ga0495602_0004704 3300048088 Bacteria 14269
379 Ga0495602_0033605 3300048088 Bacteria 4809
380 Ga0495602_0239731 3300048088 Bacteria 1357
381 Ga0495614_0008940 3300048089 Bacteria 4444
382 Ga0496100_0763704 3300048903 Bacteria 756
383 Ga0496102_0034116 3300048905 Bacteria 4576
384 Ga0496102_0622676 3300048905 Bacteria 1002
385 Ga0496103_0002701 3300048906 Bacteria 11067
386 Ga0496106_0000339 3300048909 Bacteria 32893
387 Ga0496106_0211964 3300048909 Bacteria 1543
388 Ga0496107_0003415 3300048910 Bacteria 10621
389 Ga0496110_0092863 3300048913 Bacteria 2701
390 Ga0496110_0412002 3300048913 Bacteria 1232
391 Ga0496111_0194556 3300048914 Bacteria 1507
392 Ga0496111_0203113 3300048914 Bacteria 1473
393 Ga0496112_0018095 3300048915 Bacteria 6630
394 Ga0496113_0204192 3300048916 Bacteria 1571
395 Ga0496113_0259376 3300048916 Bacteria 1388
396 Ga0496114_0941552 3300048917 Bacteria 746
397 Ga0496115_0363992 3300048918 Bacteria 1178
398 Ga0496116_0112814 3300048919 Bacteria 1592
399 Ga0496116_0206572 3300048919 Bacteria 1022
400 Ga0496117_0032645 3300048920 Bacteria 3952
401 Ga0496117_0112447 3300048920 Bacteria 1693
402 Ga0496118_0002852 3300048921 Bacteria 22557
403 Ga0496118_0018021 3300048921 Bacteria 6394
404 Ga0496119_0058581 3300048922 Bacteria 2320
405 Ga0496119_0116523 3300048922 Bacteria 1474
406 Ga0496121_0000041 3300048924 Bacteria 346686
407 Ga0496121_0029418 3300048924 Bacteria 5079
408 Ga0496121_0034794 3300048924 Bacteria 4527
409 Ga0496121_0049259 3300048924 Bacteria 3574
410 Ga0496122_0141282 3300048925 Bacteria 1506
411 Ga0496124_0003141 3300048927 Bacteria 20452
412 Ga0496125_0016125 3300048928 Bacteria 7189
413 Ga0496125_0057028 3300048928 Bacteria 3167
414 Ga0496125_0069446 3300048928 Bacteria 2765
415 Ga0496125_0300461 3300048928 Bacteria 984
416 Ga0496126_0017256 3300048929 Bacteria 7193
417 Ga0496126_0063564 3300048929 Bacteria 3309
418 Ga0496126_0103731 3300048929 Bacteria 2485
419 Ga0496126_0252106 3300048929 Bacteria 1470
420 Ga0496126_0260178 3300048929 Bacteria 1443
421 Ga0496126_0299106 3300048929 Bacteria 1328
422 Ga0496126_0302428 3300048929 Bacteria 1319
423 Ga0496126_0480722 3300048929 Bacteria 995
424 Ga0496126_0755537 3300048929 Bacteria 750
425 Ga0495682_0105206 3300049460 Bacteria 1012
426 Ga0501046_0077193 3300049580 Bacteria 2579
427 Ga0501070_0033613 3300049586 Bacteria 4292
428 Ga0501073_0100745 3300049589 Bacteria 2006
429 Ga0501080_0012678 3300049742 Bacteria 7730
430 Ga0501044_0066876 3300049823 Bacteria 3663
431 nmdc:mga03n38_424823_c1 3300050490 Bacteria 735
432 nmdc:mga00v17_211817_c1 3300050491 Bacteria 1254
433 nmdc:mga0yw44_11693_c1 3300050492 Bacteria 4545
434 nmdc:mga0yw44_215690_c1 3300050492 Bacteria 1271
435 nmdc:mga0yw44_90597_c1 3300050492 Bacteria 1932
436 nmdc:mga0k408_76153_c1 3300050493 Bacteria 1961
437 nmdc:mga06z11_136195_c1 3300050494 Bacteria 1384
438 nmdc:mga07m45_132766_c1 3300050496 Bacteria 1441
439 nmdc:mga07m45_188585_c1 3300050496 Bacteria 1199
440 nmdc:mga07m45_299622_c1 3300050496 Bacteria 935
441 nmdc:mga0n895_250483_c1 3300050512 Bacteria 1797
442 nmdc:mga0n895_47874_c1 3300050512 Bacteria 4182
443 nmdc:mga0sz30_34331_c1 3300050516 Bacteria 2111
444 Ga0500635_0124277 3300053080 Bacteria 968
445 Ga0500635_0166241 3300053080 Bacteria 848
446 Ga0495655_0027835 3300053083 Bacteria 1344
447 Ga0495595_0000480 3300053084 Bacteria 15215
448 Ga0495595_0172425 3300053084 Bacteria 1071
449 Ga0495619_0000332 3300053085 Bacteria 33066
450 Ga0500578_0044563 3300053086 Bacteria 2847
451 Ga0500643_000019 3300053087 Bacteria 294301
452 Ga0500647_0256488 3300053091 Bacteria 766
453 Ga0500651_0264894 3300053093 Bacteria 995
454 Ga0500566_0000537 3300053094 Bacteria 21255
455 Ga0500566_0000601 3300053094 Bacteria 20208
456 Ga0500640_001185 3300053095 Bacteria 7640
457 Ga0500648_056006 3300053097 Bacteria 2236
458 Ga0500554_003682 3300053102 Bacteria 3161
459 Ga0500562_012893 3300053108 Bacteria 2128
460 Ga0500569_003017 3300053109 Bacteria 3384
461 Ga0500572_002533 3300053111 Bacteria 4365
462 Ga0500591_061794 3300053115 Bacteria 1724
463 Ga0500595_020891 3300053119 Bacteria 2346
464 Ga0500595_034020 3300053119 Bacteria 1688
465 Ga0500597_242931 3300053120 Bacteria 740
466 Ga0500607_011476 3300053121 Bacteria 5240
467 Ga0500608_084996 3300053122 Bacteria 1487
468 Ga0500614_001061 3300053123 Bacteria 6833
469 Ga0500614_039148 3300053123 Bacteria 1197
470 Ga0500626_204584 3300053128 Bacteria 775
471 Ga0500642_0000063 3300053130 Bacteria 58680
472 Ga0500559_0013563 3300053136 Bacteria 3449
473 Ga0500559_0014002 3300053136 Bacteria 3390
474 Ga0500559_0019774 3300053136 Bacteria 2845
475 Ga0500573_0066490 3300053140 Bacteria 2060
476 Ga0500590_046103 3300053148 Bacteria 2230
477 Ga0500603_000166 3300053150 Bacteria 16600
478 Ga0500603_000205 3300053150 Bacteria 15582
479 Ga0500619_023059 3300053154 Bacteria 1814
480 Ga0500622_0009099 3300053156 Bacteria 5515
481 Ga0500630_006610 3300053159 Bacteria 5683
482 Ga0500633_0013201 3300053160 Bacteria 2307
483 Ga0500638_036943 3300053162 Bacteria 2369
484 Ga0500638_088958 3300053162 Bacteria 1457
485 Ga0500638_207877 3300053162 Bacteria 822
486 Ga0500639_000166 3300053163 Bacteria 32001
487 Ga0500639_041883 3300053163 Bacteria 2406
488 Ga0500636_0000076 3300053177 Bacteria 48321
489 Ga0500636_0050783 3300053177 Bacteria 2439
490 Ga0500636_0145394 3300053177 Bacteria 1307
491 Ga0500636_0213566 3300053177 Bacteria 1010
492 Ga0500637_0000818 3300053178 Bacteria 12411
493 Ga0500649_049044 3300053722 Bacteria 1776
494 Ga0500609_017241 3300053731 Bacteria 981
495 Ga0500552_002169 3300053733 Bacteria 1895
496 Ga0500552_035897 3300053733 Bacteria 787
497 Ga0500596_000426 3300053735 Bacteria 7768
498 Ga0500596_000771 3300053735 Bacteria 6316
499 2507510022 2507262055 Bacteria 8048963
500 2513628183 2513237092 Bacteria 8341956
501 2513649012 2513237095 Bacteria 8976980
502 2513660096 2513237096 Bacteria 8722461
503 2513676416 2513237098 Bacteria 9902361
504 2513702556 2513237102 Bacteria 7703324
505 2513720535 2513237104 Bacteria 10034502
506 2513858273 2513237137 Bacteria 9558895
507 2513878128 2513237139 Bacteria 8737671
508 2513893311 2513237141 Bacteria 8496279
509 2513922094 2513237145 Bacteria 8979722
510 2517107517 2517093001 Bacteria 9002274
511 2517893838 2517572143 Bacteria 9484767
512 2524469457 2524023210 Bacteria 9029266
513 2524537791 2524023228 Bacteria 10118060
514 2617353084 2617270735 Bacteria 9163226
515 2671122834 2667528175 Bacteria 7532676
516 2745078839 2744054633 Bacteria 8678936
517 2793072526 2791355197 Bacteria 8420563
518 2805920089 2802429603 Bacteria 8777136
519 2818241584 2816332527 Bacteria 8933356
520 2824605612 2824600985 Bacteria 8488197
521 2824609862 2824609381 Bacteria 8672835
522 2824625352 2824617872 Bacteria 8814715
523 2824633839 2824626560 Bacteria 8813858
524 2824641557 2824635225 Bacteria 8785348
525 2824649784 2824644064 Bacteria 8743947
526 2824655739 2824653114 Bacteria 8493680
527 2824669448 2824661429 Bacteria 9877870
528 2824674196 2824671348 Bacteria 8369588
529 2824686182 2824679649 Bacteria 8248951
530 2824693024 2824687955 Bacteria 8360029
531 2824698907 2824696289 Bacteria 8335049
532 2824711486 2824704595 Bacteria 9667483
533 2824720961 2824714736 Bacteria 8717648
534 2824729002 2824723954 Bacteria 8758240
535 2824752364 2824746037 Bacteria 7911610
536 2824758037 2824753945 Bacteria 9787441
537 2824766175 2824763712 Bacteria 9792355
538 2824781058 2824773399 Bacteria 8360218
539 2838127537 2838122688 Bacteria 8803140
540 2841941510 2841941048 Bacteria 8688029
541 2841952476 2841949485 Bacteria 8680857
542 2841959497 2841957949 Bacteria 8652217
543 2841967653 2841966195 Bacteria 8673214
544 2841982180 2841974524 Bacteria 8931498
545 2841986498 2841983080 Bacteria 8395090
546 2842038263 2842038055 Bacteria 8002051
547 2842048792 2842045827 Bacteria 8006841
548 2844317743 2844315083 Bacteria 8138177
549 2847945139 2847939898 Bacteria 8606328
550 2849080680 2849076700 Bacteria 7039503
551 2857509958 2857509624 Bacteria 7472071
552 2874618230 2874612657 Bacteria 8252029
553 2874623219 2874620515 Bacteria 8290088
554 2874636033 2874628541 Bacteria 8630250
555 2879107737 2879099564 Bacteria 10442239
556 2881365668 2881364244 Bacteria 7710352
557 2881671729 2881665667 Bacteria 8175609
558 2885382514 2885374607 Bacteria 8927485
559 2888423049 2888419890 Bacteria 7857137
560 2903735422 2903727486 Bacteria 8281579
561 2903751851 2903748898 Bacteria 9972761
562 2904670039 2904666416 Bacteria 8226587
563 2904718473 2904711408 Bacteria 9771557
564 2906608659 2906602504 Bacteria 8295279
565 2906610721
566 2906633553 2906626472 Bacteria 8826946
567 2906635883 2906635258 Bacteria 8601019
568 2906664021 2906660503 Bacteria 8595048
569 2908744240 2908739725 Bacteria 8628932
570 2908778717 2908775508 Bacteria 8092255
571 2922375497
572 2922394990 2922393267 Bacteria 8285685
573 2922428597
574 2929616232 2929615660 Bacteria 9193770
575 2929624976 2929624759 Bacteria 9339455
576 2932787101 2932784394 Bacteria 9704911
577 2932811296 2932809354 Bacteria 9135765
578 2932819831 2932818245 Bacteria 9955613
579 2932832309 2932828146 Bacteria 9745859
580 2933578484 2933577622 Bacteria 9116884
581 2935619019 2935616580 Bacteria 9032984
582 2935634574 2935630451 Bacteria 8169952
583 2935643164 2935638405 Bacteria 10015038
584 2935669790 2935665750 Bacteria 9571747
585 2935677070 2935675223 Bacteria 9928132
586 2935693109 2935684952 Bacteria 9590419
587 2935695400 2935694250 Bacteria 9291695
588 2935709491 2935703347 Bacteria 10242284
589 2935719717 2935713505 Bacteria 9608509
590 2935729516 2935722832 Bacteria 9608746
591 2935739600 2935732158 Bacteria 9706831
592 2935748638 2935741537 Bacteria 9707219
593 2935756775 2935750917 Bacteria 9590372
594 2935761237 2935760218 Bacteria 9817913
595 2935771488 2935769743 Bacteria 7878163
596 2935779177 2935777560 Bacteria 8077691
597 2935790854 2935785616 Bacteria 7962367
598 2935799205 2935793552 Bacteria 8012592
599 2935807308 2935801545 Bacteria 9301974
600 2935812447 2935810662 Bacteria 9401221
601 2935832692 2935827899 Bacteria 10038562
602 2935839229 2935837841 Bacteria 9454360
603 2935857384 2935855204 Bacteria 9035059
604 2935864913 2935864058 Bacteria 9784707
605 2935876691 2935873716 Bacteria 9632195
606 2935963351 2935959822 Bacteria 7869783
607 2935998958 2935992306 Bacteria 9802711
608 2936008284 2936002035 Bacteria 9362176
609 2936039040 2936037263 Bacteria 9446081
610 2940562689 2940556831 Bacteria 9590747
611 2941509060 2941507105 Bacteria 8166816
612 2941516889 2941515067 Bacteria 8166720
613 2941525016 2941523033 Bacteria 8169134
614 2941536381 2941531003 Bacteria 7653939
615 2941539919 2941538514 Bacteria 9402094
616 3005478727 3005474847 Bacteria 9259049
617 3005487941 3005483717 Bacteria 7877331
618 3005589449 3005587118 Bacteria 7794411
619 3005720913 3005718088 Bacteria 8283608
620 8006942617 8006933436 Bacteria 10410654
621 8006982345 8006973647 Bacteria 10679141
622 8016515105 8016511872 Bacteria 9921665
623 8016522894 8016522445 Bacteria 8156687
624 8016536355 8016530956 Bacteria 8155261
625 8016540631 8016539877 Bacteria 8155419
626 8016552612 8016548790 Bacteria 8155074
627 8016560991 8016557553 Bacteria 8154380
628 8016574716 8016566248 Bacteria 8158151
629 8016578791 8016575299 Bacteria 8154085
630 8016590856 8016583857 Bacteria 10421953
631 8016598854 8016595262 Bacteria 8149947
632 8016612223 8016603502 Bacteria 8731218
633 8016621580 8016613128 Bacteria 8794220
634 8016628378 8016622563 Bacteria 7999408
635 8017061348 8017057580 Bacteria 10023680
636 8019536075 8019530166 Bacteria 8155624
637 8019543395 8019538911 Bacteria 7872763
638 8019555459 8019547302 Bacteria 7996444
639 8019558391 8019555841 Bacteria 9642137
640 8019566905 8019565922 Bacteria 9639779
641 8019656474 8019648815 Bacteria 10014479
642 8055747879 8055742211 Bacteria 9226248
643 8056695903 8056689827 Bacteria 6712655
644 8056969542 8056967851 Bacteria 9038162
645 Ga0496109_0296423
646 RicEn_C9286
647 JGI25153J46596_10002262
648 rootL2_10212093
649 JGI25160J50197_1000504
650 Ga0055542_1022221
651 Ga0065165_1000278
652 Ga0070676_10209625
653 Ga0070683_100220572
654 Ga0070683_100382796
655 Ga0068869_100032657
656 Ga0070680_100120406
657 Ga0068868_100260338
658 Ga0070660_100010789
659 Ga0070691_10291187
660 Ga0070661_100051599
661 Ga0070661_100101466
662 Ga0070668_100155147
663 Ga0070669_100269093
664 Ga0070671_100201520
665 Ga0070659_100465735
666 Ga0070667_100111593
667 Ga0070709_10027043
668 Ga0070709_10059724
669 Ga0070714_100026363
670 Ga0070714_100068810
671 Ga0070714_100206316
672 Ga0070713_100046773
673 Ga0070713_100284513
674 Ga0070713_100415984
675 Ga0070711_100010148
676 Ga0070711_100055685
677 Ga0070663_100167747
678 Ga0070678_100067978
679 Ga0070662_100040741
680 Ga0070681_10028493
681 Ga0070679_100022437
682 Ga0070679_100203887
683 Ga0070684_100010644
684 Ga0070684_100037899
685 Ga0070697_100044646
686 Ga0068855_100036244
687 Ga0068855_100945833
688 Ga0068856_100176374
689 Ga0068852_100724410
690 Ga0068859_100287684
691 Ga0068859_100717724
692 Ga0068864_100011235
693 Ga0068861_100114047
694 Ga0068851_10468980
695 Ga0068863_100209522
696 Ga0068858_100069742
697 Ga0068858_100142967
698 Ga0068860_100000240
699 Ga0068860_100399425
700 Ga0068862_100099701
701 Ga0068862_100253094
702 Ga0081540_1003729
703 Ga0081540_1011415
704 Ga0081540_1175048
705 Ga0081539_10007751
706 Ga0070717_10122998
707 Ga0075365_10052571
708 Ga0075365_10105534
709 Ga0075365_10230360
710 Ga0075368_10007174
711 Ga0075368_10054928
712 Ga0075368_10197444
713 Ga0075363_100001650
714 Ga0075364_10248597
715 Ga0070715_10092453
716 Ga0070715_10309070
717 Ga0070716_100011343
718 Ga0070712_100018443
719 Ga0070712_100213343
720 Ga0075369_10019487
721 Ga0075369_10056550
722 Ga0075369_10312322
723 Ga0097621_100033808
724 Ga0097621_100674896
725 Ga0068871_100017134
726 Ga0075434_100044151
727 Ga0075434_100325853
728 Ga0097620_100287671
729 Ga0097620_100717674
730 Ga0099824_1017617
731 Ga0099822_1002963
732 Ga0075435_100075137
733 Ga0099795_10242191
734 Ga0105240_10365551
735 Ga0105240_10641833
736 Ga0105245_10034342
737 Ga0105247_10017329
738 Ga0105247_10535911
739 Ga0105243_10048108
740 Ga0105243_10587569
741 Ga0105241_10054933
742 Ga0105241_10089422
743 Ga0105241_11075988
744 Ga0105242_10247940
745 Ga0105248_10099852
746 Ga0105237_10003312
747 Ga0105237_10012234
748 Ga0105237_10035674
749 Ga0105237_10123123
750 Ga0105238_10048562
751 Ga0105238_10062165
752 Ga0105238_10778792
753 Ga0099796_10027744
754 Ga0105239_10022884
755 Ga0105239_10157705
756 Ga0105239_10400191
757 Ga0105246_10041441
758 Ga0105246_10409971
759 Ga0105246_10763724
760 Ga0157369_10033485
761 Ga0157378_10427356
762 Ga0163163_10153121
763 Ga0163163_10524473
764 Ga0163163_10526826
765 Ga0157379_10185296
766 Ga0157376_10233069
767 Ga0213873_10014037
768 Ga0213875_10141351
769 Ga0209563_103359
770 Ga0209677_105274
771 Ga0209148_1000574
772 Ga0209233_1004212
773 Ga0209455_1000834
774 Ga0209564_1029379
775 Ga0209758_1000498
776 Ga0209758_1015655
777 Ga0209758_1045976
778 Ga0209256_1024358
779 Ga0207426_1000721
780 Ga0207426_1015834
781 Ga0209257_1063542
782 Ga0207697_10021892
783 Ga0207692_10000702
784 Ga0207692_10339234
785 Ga0207710_10279945
786 Ga0207647_10011713
787 Ga0207685_10136121
788 Ga0207699_10001397
789 Ga0207699_10047362
790 Ga0207645_10133672
791 Ga0207705_10017045
792 Ga0207654_10067495
793 Ga0207707_10005454
794 Ga0207695_10046953
795 Ga0207695_10427081
796 Ga0207671_10060487
797 Ga0207693_10016800
798 Ga0207693_10031102
799 Ga0207693_10197579
800 Ga0207663_10071461
801 Ga0207663_10184582
802 Ga0207660_10124137
803 Ga0207657_10186851
804 Ga0207649_10219042
805 Ga0207652_10001798
806 Ga0207652_10017746
807 Ga0207681_10225060
808 Ga0207694_10116911
809 Ga0207694_10156005
810 Ga0207694_10319331
811 Ga0207650_10038362
812 Ga0207687_10005054
813 Ga0207700_10006382
814 Ga0207700_10127450
815 Ga0207664_10026844
816 Ga0207644_10009377
817 Ga0207644_10406731
818 Ga0207709_10078643
819 Ga0207665_10004907
820 Ga0207665_10052545
821 Ga0207665_10268465
822 Ga0207665_10319150
823 Ga0207711_10209900
824 Ga0207689_10027511
825 Ga0207661_10021041
826 Ga0207661_10753259
827 Ga0207679_10506040
828 Ga0207667_10007884
829 Ga0207651_10864145
830 Ga0207668_10123494
831 Ga0207677_10047609
832 Ga0207703_10389878
833 Ga0207703_10575154
834 Ga0207639_10004621
835 Ga0207678_10018858
836 Ga0207702_10000403
837 Ga0207676_10039626
838 Ga0207674_10091587
839 Ga0207674_10254513
840 Ga0207683_10038299
841 Ga0207698_10621394
842 Ga0209389_1000025
843 Ga0209589_1000018
844 Ga0209589_1000066
845 Ga0209489_100026
846 Ga0209489_100030
847 Ga0209700_100035
848 Ga0209588_1025157
849 Ga0209813_10018563
850 Ga0268266_10350817
851 Ga0268265_10753440
852 Ga0268264_10000035
853 Ga0268264_10221943
854 Ga0307511_10081777
855 Ga0307509_10007153
856 Ga0307509_10191035
857 Ga0307508_10121413
858 Ga0265314_10038916
859 Ga0265314_10110866
860 Ga0265342_10002787
861 Ga0307516_10010831
862 Ga0307516_10062664
863 Ga0307415_100456496
864 Ga0307510_10049877
865 Ga0307510_10055825
866 Ga0373923_0019424
867 Ga0373936_0002935
868 Ga0373936_0117957
869 Ga0373953_0000420
870 Ga0373953_0251308
871 Ga0373954_0000663
872 Ga0373956_0000275
873 Ga0373957_0000426
874 Ga0373943_0002244
875 Ga0373946_0022256
876 Ga0373955_0000510
877 Ga0373955_0175522
878 Ga0373924_0031154
879 Ga0373935_0000344
880 Ga0373935_0027493
881 Ga0373935_0219654
882 Ga0373927_0000665
883 Ga0373927_0011552
884 Ga0373933_0000405
885 Ga0373933_0003239
886 Ga0373933_0344961
887 Ga0373947_0003567
888 Ga0373947_0092699
889 Ga0373937_0016746
890 Ga0373937_0019554
891 Ga0373937_0038342
892 Ga0373925_0051507
893 Ga0373925_0099301
894 Ga0395900_0001369
895 Ga0395900_0490131
896 Ga0395898_0132467
897 Ga0395905_0019296
898 Ga0395905_0060245
899 Ga0436364_1260694
900 Ga0395901_0004623
901 Ga0395901_0112041
902 Ga0436365_0722166
903 Ga0436365_1348420
904 Ga0436360_0579443
905 Ga0436361_0126094
906 Ga0436363_0188494
907 Ga0436363_1417522
908 Ga0436362_1039640
909 Ga0466969_0014853
910 Ga0466965_0047899
911 Ga0466966_0001348
912 Ga0466966_0031942
913 Ga0466966_0085860
914 Ga0466961_0000120
915 Ga0466961_0123635
916 Ga0466963_0011705
917 Ga0466963_0356987
918 Ga0466960_0037601
919 Ga0466959_0097855
920 Ga0466959_0108014
921 Ga0466959_0472605
922 Ga0466958_0346233
923 Ga0466967_0077104
924 Ga0466967_0082012
925 Ga0466967_0420708
926 Ga0495592_0003383
927 Ga0495592_0036537
928 Ga0495592_0441859
929 Ga0495603_0000094
930 Ga0495603_0013103
931 Ga0495603_0020849
932 Ga0495590_0226704
933 Ga0495629_0000612
934 Ga0495629_0001119
935 Ga0495638_0004073
936 Ga0495641_0003738
937 Ga0495651_0000889
938 Ga0495651_0009999
939 Ga0495653_0000399
940 Ga0495580_0002084
941 Ga0495582_0000256
942 Ga0495605_0096450
943 Ga0495639_0000114
944 Ga0495639_0079658
945 Ga0495662_0003498
946 Ga0495664_0007443
947 Ga0495594_0000393
948 Ga0495606_0246950
949 Ga0495608_0001226
950 Ga0495608_0059203
951 Ga0495618_0220654
952 Ga0495620_0225393
953 Ga0495628_0021333
954 Ga0495628_0026173
955 Ga0495628_0042972
956 Ga0495630_0000459
957 Ga0495643_0076606
958 Ga0495648_0069995
959 Ga0495666_0047291
960 Ga0495652_0006874
961 Ga0495652_0017641
962 Ga0495665_0000130
963 Ga0495640_0007646
964 Ga0495640_0016287
965 Ga0495640_0077117
966 Ga0495587_0001432
967 Ga0495587_0101081
968 Ga0495645_0001776
969 Ga0495622_0005481
970 Ga0495622_0022021
971 Ga0495622_0031173
972 Ga0495667_0001452
973 Ga0495667_0005133
974 Ga0495667_0020287
975 Ga0495668_0094861
976 Ga0495634_0002801
977 Ga0495634_0231703
978 Ga0495625_0284382
979 Ga0495635_0000088
980 Ga0495635_0006280
981 Ga0495588_0004028
982 Ga0495657_0001352
983 Ga0495657_0003974
984 Ga0495657_0108585
985 Ga0495599_0001137
986 Ga0495599_0008246
987 Ga0495599_0044471
988 Ga0495623_0006628
989 Ga0495623_0039776
990 Ga0495623_0081886
991 Ga0495646_0002433
992 Ga0495646_0016831
993 Ga0495646_0290084
994 Ga0495647_0000070
995 Ga0495613_0004685
996 Ga0495613_0084216
997 Ga0495624_0000079
998 Ga0495624_0061882
999 Ga0495624_0090495
1000 Ga0495589_0116943
1001 Ga0495600_0000484
1002 Ga0495600_0000715
1003 Ga0495600_0153992
1004 Ga0495581_0000082
1005 Ga0495604_0001221
1006 Ga0495604_0002253
1007 Ga0495674_0001729
1008 Ga0495674_0028341
1009 Ga0495674_0029949
1010 Ga0495672_0217952
1011 Ga0495676_0016546
1012 Ga0495680_0004231
1013 Ga0495680_0006059
1014 Ga0495683_0021360
1015 Ga0495687_011038
1016 Ga0495687_095344
1017 Ga0495675_0000977
1018 Ga0495675_0022872
1019 Ga0495684_0001326
1020 Ga0495684_0101470
1021 Ga0495593_0000206
1022 Ga0495602_0004704
1023 Ga0495602_0033605
1024 Ga0495602_0239731
1025 Ga0495614_0008940
1026 Ga0496100_0763704
1027 Ga0496102_0034116
1028 Ga0496102_0622676
1029 Ga0496103_0002701
1030 Ga0496106_0000339
1031 Ga0496106_0211964
1032 Ga0496107_0003415
1033 Ga0496110_0092863
1034 Ga0496110_0412002
1035 Ga0496111_0194556
1036 Ga0496111_0203113
1037 Ga0496112_0018095
1038 Ga0496113_0204192
1039 Ga0496113_0259376
1040 Ga0496114_0941552
1041 Ga0496115_0363992
1042 Ga0496116_0112814
1043 Ga0496116_0206572
1044 Ga0496117_0032645
1045 Ga0496117_0112447
1046 Ga0496118_0002852
1047 Ga0496118_0018021
1048 Ga0496119_0058581
1049 Ga0496119_0116523
1050 Ga0496121_0000041
1051 Ga0496121_0029418
1052 Ga0496121_0034794
1053 Ga0496121_0049259
1054 Ga0496122_0141282
1055 Ga0496124_0003141
1056 Ga0496125_0016125
1057 Ga0496125_0057028
1058 Ga0496125_0069446
1059 Ga0496125_0300461
1060 Ga0496126_0017256
1061 Ga0496126_0063564
1062 Ga0496126_0103731
1063 Ga0496126_0252106
1064 Ga0496126_0260178
1065 Ga0496126_0299106
1066 Ga0496126_0302428
1067 Ga0496126_0480722
1068 Ga0496126_0755537
1069 Ga0495682_0105206
1070 Ga0501046_0077193
1071 Ga0501070_0033613
1072 Ga0501073_0100745
1073 Ga0501080_0012678
1074 Ga0501044_0066876
1075 nmdc:mga03n38_424823_c1
1076 nmdc:mga00v17_211817_c1
1077 nmdc:mga0yw44_11693_c1
1078 nmdc:mga0yw44_215690_c1
1079 nmdc:mga0yw44_90597_c1
1080 nmdc:mga0k408_76153_c1
1081 nmdc:mga06z11_136195_c1
1082 nmdc:mga07m45_132766_c1
1083 nmdc:mga07m45_188585_c1
1084 nmdc:mga07m45_299622_c1
1085 nmdc:mga0n895_250483_c1
1086 nmdc:mga0n895_47874_c1
1087 nmdc:mga0sz30_34331_c1
1088 Ga0500635_0124277
1089 Ga0500635_0166241
1090 Ga0495655_0027835
1091 Ga0495595_0000480
1092 Ga0495595_0172425
1093 Ga0495619_0000332
1094 Ga0500578_0044563
1095 Ga0500643_000019
1096 Ga0500647_0256488
1097 Ga0500651_0264894
1098 Ga0500566_0000537
1099 Ga0500566_0000601
1100 Ga0500640_001185
1101 Ga0500648_056006
1102 Ga0500554_003682
1103 Ga0500562_012893
1104 Ga0500569_003017
1105 Ga0500572_002533
1106 Ga0500591_061794
1107 Ga0500595_020891
1108 Ga0500595_034020
1109 Ga0500597_242931
1110 Ga0500607_011476
1111 Ga0500608_084996
1112 Ga0500614_001061
1113 Ga0500614_039148
1114 Ga0500626_204584
1115 Ga0500642_0000063
1116 Ga0500559_0013563
1117 Ga0500559_0014002
1118 Ga0500559_0019774
1119 Ga0500573_0066490
1120 Ga0500590_046103
1121 Ga0500603_000166
1122 Ga0500603_000205
1123 Ga0500619_023059
1124 Ga0500622_0009099
1125 Ga0500630_006610
1126 Ga0500633_0013201
1127 Ga0500638_036943
1128 Ga0500638_088958
1129 Ga0500638_207877
1130 Ga0500639_000166
1131 Ga0500639_041883
1132 Ga0500636_0000076
1133 Ga0500636_0050783
1134 Ga0500636_0145394
1135 Ga0500636_0213566
1136 Ga0500637_0000818
1137 Ga0500649_049044
1138 Ga0500609_017241
1139 Ga0500552_002169
1140 Ga0500552_035897
1141 Ga0500596_000426
1142 Ga0500596_000771
1143 2507510022
1144 2513628183
1145 2513649012
1146 2513660096
1147 2513676416
1148 2513702556
1149 2513720535
1150 2513858273
1151 2513878128
1152 2513893311
1153 2513922094
1154 2517107517
1155 2517893838
1156 2524469457
1157 2524537791
1158 2617353084
1159 2671122834
1160 2745078839
1161 2793072526
1162 2805920089
1163 2818241584
1164 2824605612
1165 2824609862
1166 2824625352
1167 2824633839
1168 2824641557
1169 2824649784
1170 2824655739
1171 2824669448
1172 2824674196
1173 2824686182
1174 2824693024
1175 2824698907
1176 2824711486
1177 2824720961
1178 2824729002
1179 2824752364
1180 2824758037
1181 2824766175
1182 2824781058
1183 2838127537
1184 2841941510
1185 2841952476
1186 2841959497
1187 2841967653
1188 2841982180
1189 2841986498
1190 2842038263
1191 2842048792
1192 2844317743
1193 2847945139
1194 2849080680
1195 2857509958
1196 2874618230
1197 2874623219
1198 2874636033
1199 2879107737
1200 2881365668
1201 2881671729
1202 2885382514
1203 2888423049
1204 2903735422
1205 2903751851
1206 2904670039
1207 2904718473
1208 2906608659
1209 2906610721
1210 2906633553
1211 2906635883
1212 2906664021
1213 2908744240
1214 2908778717
1215 2922375497
1216 2922394990
1217 2922428597
1218 2929616232
1219 2929624976
1220 2932787101
1221 2932811296
1222 2932819831
1223 2932832309
1224 2933578484
1225 2935619019
1226 2935634574
1227 2935643164
1228 2935669790
1229 2935677070
1230 2935693109
1231 2935695400
1232 2935709491
1233 2935719717
1234 2935729516
1235 2935739600
1236 2935748638
1237 2935756775
1238 2935761237
1239 2935771488
1240 2935779177
1241 2935790854
1242 2935799205
1243 2935807308
1244 2935812447
1245 2935832692
1246 2935839229
1247 2935857384
1248 2935864913
1249 2935876691
1250 2935963351
1251 2935998958
1252 2936008284
1253 2936039040
1254 2940562689
1255 2941509060
1256 2941516889
1257 2941525016
1258 2941536381
1259 2941539919
1260 3005478727
1261 3005487941
1262 3005589449
1263 3005720913
1264 8006942617
1265 8006982345
1266 8016515105
1267 8016522894
1268 8016536355
1269 8016540631
1270 8016552612
1271 8016560991
1272 8016574716
1273 8016578791
1274 8016590856
1275 8016598854
1276 8016612223
1277 8016621580
1278 8016628378
1279 8017061348
1280 8019536075
1281 8019543395
1282 8019555459
1283 8019558391
1284 8019566905
1285 8019656474
1286 8055747879
1287 8056695903
1288 8056969542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

49

95

0.98

PF14246

TetR_C_7

AefR-like transcriptional repressor, C-terminal domain

120

226

0.86

PF16859

TetR_C_11

Tetracyclin repressor-like, C-terminal domain

111

224

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jnp-assembly1.cif.gz_B mtrr bound to the rpoh operator from neisseria gonorrhoeae 0.8416 19 204
2g3b-assembly1.cif.gz_B crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp. 0.8294 19 204
3qpl-assembly1.cif.gz_A g106w mutant of ethr from mycobacterium tuberculosis 0.8203 20 207
2g3b-assembly1.cif.gz_B crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp. 0.8175 19 204
3crj-assembly1.cif.gz_B crystal structure of a tetr transcription regulator from haloarcula marismortui atcc 43049 0.8121 18 203
ID Description Score Start End Superfamily
3ih3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.003 20 62 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.002 20 67 1.10.10.60
4xk4D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.002 20 67 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9996 20 67 1.10.10.60
2id6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9995 20 62 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A4Q7FS26-F1-model_v4 TetR family transcriptional regulator 0.988 19 210 GO:0000976
GO:0003700
AF-A0A4Y3ZMG5-F1-model_v4 deleted 0.9843 30 210
AF-A0A0D1NG17-F1-model_v4 deleted 0.9782 9 210
AF-A0A4Q7FS26-F1-model_v4 TetR family transcriptional regulator 0.9779 19 210 GO:0000976
GO:0003700
AF-A0A4Y3ZMG5-F1-model_v4 deleted 0.9737 30 210

Map