F472023
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 644 | 290 | 644 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100094264|Ga0068862_1000942642 |
| Length | 241 |
| Sequence | MMPDSDLSDKAQRGSVFRGTLWYLEVMAKLRVQSFGVSLDGFGAGTDQSLEYPLGKRGPELMEWFFPTRMFQTMHGQGDGESGTDNGIAEQGFAGIGAWILGRNMFGPVRGPWPDANWKGWWGDEPPYHAPVFVLTHHRRAPLPMAGGTEFHFVTGGIRDAYDRAMEAAGGLDVRVGGGVSTIRQYLQAGLIDELHLAVRPVLLGRGENLFQGLDLDALGYECGPFVPGERAVHMFLRQRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 222 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 223 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 227 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 228 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 229 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 281 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 282 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.16 |
| Nodule | 0 |
| Rhizoplane | 4.5 |
| Rhizosphere | 93.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10022621 | 3300001979 | Bacteria | 2160 |
| 2 | JGI24737J22298_10044449 | 3300001990 | Bacteria | 1358 |
| 3 | JGI24735J21928_10021736 | 3300002067 | Bacteria | 1957 |
| 4 | JGI25406J46586_10087553 | 3300003203 | Bacteria | 944 |
| 5 | rootH2_10037647 | 3300003320 | Bacteria | 7156 |
| 6 | Ga0065712_10161511 | 3300005290 | Bacteria | 1299 |
| 7 | Ga0070658_10000960 | 3300005327 | Bacteria | 24674 |
| 8 | Ga0070676_10009642 | 3300005328 | Bacteria | 5220 |
| 9 | Ga0070690_100779805 | 3300005330 | Bacteria | 740 |
| 10 | Ga0070670_100001648 | 3300005331 | Bacteria | 18088 |
| 11 | Ga0070670_100009312 | 3300005331 | Bacteria | 8390 |
| 12 | Ga0070670_100012745 | 3300005331 | Bacteria | 7195 |
| 13 | Ga0070670_100061114 | 3300005331 | Bacteria | 3234 |
| 14 | Ga0070677_10013217 | 3300005333 | Bacteria | 2883 |
| 15 | Ga0068869_100003631 | 3300005334 | Bacteria | 9466 |
| 16 | Ga0068869_100075175 | 3300005334 | Bacteria | 2509 |
| 17 | Ga0068869_100253831 | 3300005334 | Bacteria | 1405 |
| 18 | Ga0070666_10000883 | 3300005335 | Bacteria | 18203 |
| 19 | Ga0070666_10011620 | 3300005335 | Bacteria | 5532 |
| 20 | Ga0070666_10033401 | 3300005335 | Bacteria | 3404 |
| 21 | Ga0070666_10146480 | 3300005335 | Bacteria | 1646 |
| 22 | Ga0070666_10555969 | 3300005335 | Bacteria | 835 |
| 23 | Ga0070680_100031707 | 3300005336 | Bacteria | 4249 |
| 24 | Ga0070680_100112412 | 3300005336 | Bacteria | 2268 |
| 25 | Ga0068868_100024734 | 3300005338 | Bacteria | 4559 |
| 26 | Ga0068868_100044045 | 3300005338 | Bacteria | 3488 |
| 27 | Ga0068868_100186069 | 3300005338 | Bacteria | 1725 |
| 28 | Ga0070660_100005482 | 3300005339 | Bacteria | 8790 |
| 29 | Ga0070660_100073845 | 3300005339 | Bacteria | 2667 |
| 30 | Ga0070660_100400349 | 3300005339 | Bacteria | 1135 |
| 31 | Ga0070660_100660730 | 3300005339 | Bacteria | 875 |
| 32 | Ga0070689_100000405 | 3300005340 | Bacteria | 25370 |
| 33 | Ga0070687_100049781 | 3300005343 | Bacteria | 2161 |
| 34 | Ga0070687_100234630 | 3300005343 | Bacteria | 1131 |
| 35 | Ga0070661_100002335 | 3300005344 | Bacteria | 13013 |
| 36 | Ga0070661_100035283 | 3300005344 | Bacteria | 3631 |
| 37 | Ga0070661_100207255 | 3300005344 | Bacteria | 1500 |
| 38 | Ga0070661_100322795 | 3300005344 | Bacteria | 1206 |
| 39 | Ga0070661_100592225 | 3300005344 | Bacteria | 896 |
| 40 | Ga0070692_10290225 | 3300005345 | Bacteria | 995 |
| 41 | Ga0070668_100033665 | 3300005347 | Bacteria | 3903 |
| 42 | Ga0070668_100081514 | 3300005347 | Bacteria | 2537 |
| 43 | Ga0070669_100149724 | 3300005353 | Bacteria | 1806 |
| 44 | Ga0070669_100207865 | 3300005353 | Bacteria | 1543 |
| 45 | Ga0070669_100213917 | 3300005353 | Bacteria | 1522 |
| 46 | Ga0070675_100029260 | 3300005354 | Bacteria | 4441 |
| 47 | Ga0070675_100492206 | 3300005354 | Bacteria | 1104 |
| 48 | Ga0070671_100028890 | 3300005355 | Bacteria | 4569 |
| 49 | Ga0070671_100257189 | 3300005355 | Bacteria | 1484 |
| 50 | Ga0070671_100464423 | 3300005355 | Bacteria | 1087 |
| 51 | Ga0070674_100000708 | 3300005356 | Bacteria | 16973 |
| 52 | Ga0070674_100129232 | 3300005356 | Bacteria | 1881 |
| 53 | Ga0070674_100259001 | 3300005356 | Bacteria | 1370 |
| 54 | Ga0070673_100002708 | 3300005364 | Bacteria | 10862 |
| 55 | Ga0070673_100373988 | 3300005364 | Bacteria | 1269 |
| 56 | Ga0070673_100463812 | 3300005364 | Bacteria | 1141 |
| 57 | Ga0070688_100002477 | 3300005365 | Bacteria | 9339 |
| 58 | Ga0070659_100006550 | 3300005366 | Bacteria | 8411 |
| 59 | Ga0070659_100069221 | 3300005366 | Bacteria | 2801 |
| 60 | Ga0070659_100141592 | 3300005366 | Bacteria | 1958 |
| 61 | Ga0070667_100000070 | 3300005367 | Bacteria | 126321 |
| 62 | Ga0070667_100004034 | 3300005367 | Bacteria | 12425 |
| 63 | Ga0070667_100007792 | 3300005367 | Bacteria | 8878 |
| 64 | Ga0070667_100043123 | 3300005367 | Bacteria | 3786 |
| 65 | Ga0070667_100144266 | 3300005367 | Bacteria | 2087 |
| 66 | Ga0070667_100155755 | 3300005367 | Bacteria | 2009 |
| 67 | Ga0070714_100000954 | 3300005435 | Bacteria | 20605 |
| 68 | Ga0070714_100190455 | 3300005435 | Bacteria | 1871 |
| 69 | Ga0070713_100034884 | 3300005436 | Bacteria | 4046 |
| 70 | Ga0070713_100216895 | 3300005436 | Bacteria | 1734 |
| 71 | Ga0070710_10005351 | 3300005437 | Bacteria | 6088 |
| 72 | Ga0070701_10186042 | 3300005438 | Bacteria | 1219 |
| 73 | Ga0070711_100002923 | 3300005439 | Bacteria | 9845 |
| 74 | Ga0070705_100231817 | 3300005440 | Bacteria | 1285 |
| 75 | Ga0070700_100040841 | 3300005441 | Bacteria | 2842 |
| 76 | Ga0070663_100115168 | 3300005455 | Bacteria | 2025 |
| 77 | Ga0070663_100227824 | 3300005455 | Bacteria | 1466 |
| 78 | Ga0070678_100035786 | 3300005456 | Bacteria | 3470 |
| 79 | Ga0070678_100908091 | 3300005456 | Bacteria | 805 |
| 80 | Ga0070662_100020585 | 3300005457 | Bacteria | 4496 |
| 81 | Ga0070662_100068743 | 3300005457 | Bacteria | 2605 |
| 82 | Ga0070662_100205312 | 3300005457 | Bacteria | 1565 |
| 83 | Ga0068867_100004004 | 3300005459 | Bacteria | 10362 |
| 84 | Ga0068867_100044544 | 3300005459 | Bacteria | 3251 |
| 85 | Ga0068867_100080291 | 3300005459 | Bacteria | 2456 |
| 86 | Ga0068867_100129727 | 3300005459 | Bacteria | 1958 |
| 87 | Ga0070685_10000781 | 3300005466 | Bacteria | 17262 |
| 88 | Ga0070685_10054797 | 3300005466 | Bacteria | 2315 |
| 89 | Ga0070707_100081984 | 3300005468 | Bacteria | 3115 |
| 90 | Ga0070707_100368654 | 3300005468 | Bacteria | 1395 |
| 91 | Ga0070679_100350049 | 3300005530 | Bacteria | 1425 |
| 92 | Ga0070679_100432899 | 3300005530 | Bacteria | 1260 |
| 93 | Ga0070684_100078053 | 3300005535 | Bacteria | 2925 |
| 94 | Ga0070684_100100487 | 3300005535 | Bacteria | 2583 |
| 95 | Ga0070697_100475732 | 3300005536 | Bacteria | 1090 |
| 96 | Ga0068853_100012867 | 3300005539 | Bacteria | 6819 |
| 97 | Ga0068853_100016601 | 3300005539 | Bacteria | 6062 |
| 98 | Ga0068853_100261502 | 3300005539 | Bacteria | 1591 |
| 99 | Ga0068853_100342657 | 3300005539 | Bacteria | 1389 |
| 100 | Ga0070672_100029879 | 3300005543 | Bacteria | 4090 |
| 101 | Ga0070672_100107727 | 3300005543 | Bacteria | 2268 |
| 102 | Ga0070672_100174684 | 3300005543 | Bacteria | 1788 |
| 103 | Ga0070672_100512162 | 3300005543 | Bacteria | 1039 |
| 104 | Ga0070686_100009269 | 3300005544 | Bacteria | 5527 |
| 105 | Ga0070696_100002515 | 3300005546 | Bacteria | 12139 |
| 106 | Ga0070696_100027759 | 3300005546 | Bacteria | 3860 |
| 107 | Ga0070696_100317235 | 3300005546 | Bacteria | 1198 |
| 108 | Ga0070693_100004506 | 3300005547 | Bacteria | 6594 |
| 109 | Ga0070693_100077002 | 3300005547 | Bacteria | 1978 |
| 110 | Ga0070665_100012399 | 3300005548 | Bacteria | 8591 |
| 111 | Ga0070665_100035492 | 3300005548 | Bacteria | 5014 |
| 112 | Ga0070704_100296117 | 3300005549 | Unclassified | 1346 |
| 113 | Ga0070704_100775592 | 3300005549 | Bacteria | 855 |
| 114 | Ga0068855_100008716 | 3300005563 | Bacteria | 12261 |
| 115 | Ga0068855_100033228 | 3300005563 | Bacteria | 6158 |
| 116 | Ga0068855_100116020 | 3300005563 | Bacteria | 3069 |
| 117 | Ga0070664_100005045 | 3300005564 | Bacteria | 10584 |
| 118 | Ga0070664_100040329 | 3300005564 | Bacteria | 3935 |
| 119 | Ga0070664_100388901 | 3300005564 | Bacteria | 1274 |
| 120 | Ga0068857_100003573 | 3300005577 | Bacteria | 13005 |
| 121 | Ga0068857_100004795 | 3300005577 | Bacteria | 11462 |
| 122 | Ga0068857_100029378 | 3300005577 | Bacteria | 4851 |
| 123 | Ga0068854_100000351 | 3300005578 | Bacteria | 29668 |
| 124 | Ga0068854_100004788 | 3300005578 | Bacteria | 8535 |
| 125 | Ga0068854_100018892 | 3300005578 | Bacteria | 4635 |
| 126 | Ga0068854_100143794 | 3300005578 | Bacteria | 1833 |
| 127 | Ga0068854_100239851 | 3300005578 | Bacteria | 1443 |
| 128 | Ga0068854_100523802 | 3300005578 | Bacteria | 1002 |
| 129 | Ga0068856_100016485 | 3300005614 | Bacteria | 7152 |
| 130 | Ga0068856_100023023 | 3300005614 | Bacteria | 6056 |
| 131 | Ga0068856_100071577 | 3300005614 | Bacteria | 3433 |
| 132 | Ga0068856_100083131 | 3300005614 | Bacteria | 3179 |
| 133 | Ga0068856_100099014 | 3300005614 | Bacteria | 2906 |
| 134 | Ga0070702_100021363 | 3300005615 | Bacteria | 3404 |
| 135 | Ga0068852_100024598 | 3300005616 | Bacteria | 4870 |
| 136 | Ga0068852_100032787 | 3300005616 | Bacteria | 4305 |
| 137 | Ga0068852_100034850 | 3300005616 | Bacteria | 4192 |
| 138 | Ga0068852_100397247 | 3300005616 | Bacteria | 1355 |
| 139 | Ga0068852_100434409 | 3300005616 | Bacteria | 1297 |
| 140 | Ga0068852_100750496 | 3300005616 | Bacteria | 988 |
| 141 | Ga0068859_100001347 | 3300005617 | Bacteria | 25058 |
| 142 | Ga0068859_100009913 | 3300005617 | Bacteria | 9622 |
| 143 | Ga0068859_100062429 | 3300005617 | Bacteria | 3756 |
| 144 | Ga0068859_100077063 | 3300005617 | Bacteria | 3375 |
| 145 | Ga0068864_100010584 | 3300005618 | Bacteria | 7626 |
| 146 | Ga0068864_100017409 | 3300005618 | Bacteria | 5991 |
| 147 | Ga0068864_100018003 | 3300005618 | Bacteria | 5895 |
| 148 | Ga0068864_100035436 | 3300005618 | Bacteria | 4248 |
| 149 | Ga0068866_10007029 | 3300005718 | Bacteria | 4705 |
| 150 | Ga0068866_10074224 | 3300005718 | Bacteria | 1808 |
| 151 | Ga0068861_100014002 | 3300005719 | Bacteria | 5623 |
| 152 | Ga0068861_100087995 | 3300005719 | Bacteria | 2445 |
| 153 | Ga0068861_100114982 | 3300005719 | Bacteria | 2161 |
| 154 | Ga0068851_10006735 | 3300005834 | Bacteria | 5256 |
| 155 | Ga0068851_10099648 | 3300005834 | Bacteria | 1540 |
| 156 | Ga0068870_10009728 | 3300005840 | Bacteria | 4384 |
| 157 | Ga0068870_10107234 | 3300005840 | Bacteria | 1589 |
| 158 | Ga0068863_100013951 | 3300005841 | Bacteria | 7745 |
| 159 | Ga0068863_100026288 | 3300005841 | Bacteria | 5553 |
| 160 | Ga0068863_100374528 | 3300005841 | Bacteria | 1390 |
| 161 | Ga0068863_100460961 | 3300005841 | Bacteria | 1248 |
| 162 | Ga0068863_100605580 | 3300005841 | Bacteria | 1085 |
| 163 | Ga0068858_100003331 | 3300005842 | Bacteria | 15997 |
| 164 | Ga0068858_100036483 | 3300005842 | Bacteria | 4559 |
| 165 | Ga0068858_100058263 | 3300005842 | Bacteria | 3571 |
| 166 | Ga0068858_100860432 | 3300005842 | Bacteria | 886 |
| 167 | Ga0068860_100006411 | 3300005843 | Bacteria | 11811 |
| 168 | Ga0068860_100030495 | 3300005843 | Bacteria | 5186 |
| 169 | Ga0068860_100031074 | 3300005843 | Bacteria | 5135 |
| 170 | Ga0068860_100063672 | 3300005843 | Bacteria | 3502 |
| 171 | Ga0068860_100086234 | 3300005843 | Bacteria | 2988 |
| 172 | Ga0068860_100101809 | 3300005843 | Bacteria | 2740 |
| 173 | Ga0068860_100243006 | 3300005843 | Bacteria | 1751 |
| 174 | Ga0068862_100004281 | 3300005844 | Bacteria | 12075 |
| 175 | Ga0068862_100036178 | 3300005844 | Bacteria | 4184 |
| 176 | Ga0068862_100094264 | 3300005844 | Bacteria | 2611 |
| 177 | Ga0081539_10003560 | 3300005985 | Bacteria | 18916 |
| 178 | Ga0081539_10010113 | 3300005985 | Bacteria | 7739 |
| 179 | Ga0070715_10054981 | 3300006163 | Bacteria | 1726 |
| 180 | Ga0070715_10196118 | 3300006163 | Bacteria | 1023 |
| 181 | Ga0070712_100016494 | 3300006175 | Bacteria | 4774 |
| 182 | Ga0070712_100809659 | 3300006175 | Bacteria | 804 |
| 183 | Ga0097621_100026284 | 3300006237 | Bacteria | 4564 |
| 184 | Ga0097621_100037602 | 3300006237 | Bacteria | 3880 |
| 185 | Ga0068871_100029400 | 3300006358 | Bacteria | 4316 |
| 186 | Ga0068871_100064326 | 3300006358 | Bacteria | 3003 |
| 187 | Ga0068871_100092803 | 3300006358 | Bacteria | 2518 |
| 188 | Ga0068871_100108507 | 3300006358 | Bacteria | 2333 |
| 189 | Ga0075430_100924021 | 3300006846 | Bacteria | 719 |
| 190 | Ga0075433_10346127 | 3300006852 | Bacteria | 1314 |
| 191 | Ga0068865_100038324 | 3300006881 | Bacteria | 3243 |
| 192 | Ga0068865_100048848 | 3300006881 | Bacteria | 2914 |
| 193 | Ga0068865_100147208 | 3300006881 | Bacteria | 1783 |
| 194 | Ga0097620_100001347 | 3300006931 | Bacteria | 25058 |
| 195 | Ga0097620_100009913 | 3300006931 | Bacteria | 9622 |
| 196 | Ga0097620_100062426 | 3300006931 | Bacteria | 3756 |
| 197 | Ga0097620_100077064 | 3300006931 | Bacteria | 3375 |
| 198 | Ga0097620_100122140 | 3300006931 | Bacteria | 2671 |
| 199 | Ga0075435_100067875 | 3300007076 | Bacteria | 2904 |
| 200 | Ga0075435_100315408 | 3300007076 | Bacteria | 1338 |
| 201 | Ga0075435_100582374 | 3300007076 | Bacteria | 970 |
| 202 | Ga0099794_10016035 | 3300007265 | Bacteria | 3316 |
| 203 | Ga0105244_10004531 | 3300009036 | Bacteria | 9527 |
| 204 | Ga0105240_10003598 | 3300009093 | Bacteria | 24007 |
| 205 | Ga0105240_10015820 | 3300009093 | Bacteria | 10235 |
| 206 | Ga0105240_10040583 | 3300009093 | Bacteria | 5950 |
| 207 | Ga0105240_10090577 | 3300009093 | Bacteria | 3738 |
| 208 | Ga0105240_10104545 | 3300009093 | Bacteria | 3439 |
| 209 | Ga0105240_10301933 | 3300009093 | Bacteria | 1831 |
| 210 | Ga0111539_10006635 | 3300009094 | Bacteria | 14908 |
| 211 | Ga0111539_10033069 | 3300009094 | Bacteria | 6279 |
| 212 | Ga0111539_10055709 | 3300009094 | Unclassified | 4700 |
| 213 | Ga0105245_10001706 | 3300009098 | Bacteria | 20010 |
| 214 | Ga0105245_10004524 | 3300009098 | Bacteria | 12279 |
| 215 | Ga0105245_10128767 | 3300009098 | Bacteria | 2372 |
| 216 | Ga0105247_10001753 | 3300009101 | Bacteria | 15274 |
| 217 | Ga0105247_10003347 | 3300009101 | Bacteria | 10492 |
| 218 | Ga0105247_10006032 | 3300009101 | Bacteria | 7538 |
| 219 | Ga0114129_10246825 | 3300009147 | Bacteria | 2398 |
| 220 | Ga0105243_10019788 | 3300009148 | Bacteria | 5103 |
| 221 | Ga0105241_10032952 | 3300009174 | Bacteria | 3886 |
| 222 | Ga0105241_10053418 | 3300009174 | Bacteria | 3089 |
| 223 | Ga0105241_10326953 | 3300009174 | Bacteria | 1324 |
| 224 | Ga0105241_10399357 | 3300009174 | Bacteria | 1205 |
| 225 | Ga0105241_10410591 | 3300009174 | Bacteria | 1190 |
| 226 | Ga0105241_10616428 | 3300009174 | Bacteria | 982 |
| 227 | Ga0105242_10006602 | 3300009176 | Bacteria | 8936 |
| 228 | Ga0105242_10026457 | 3300009176 | Bacteria | 4599 |
| 229 | Ga0105248_10003961 | 3300009177 | Bacteria | 16379 |
| 230 | Ga0105248_10007310 | 3300009177 | Bacteria | 12118 |
| 231 | Ga0105248_10032837 | 3300009177 | Bacteria | 5799 |
| 232 | Ga0105248_10081849 | 3300009177 | Bacteria | 3629 |
| 233 | Ga0105248_10283874 | 3300009177 | Bacteria | 1864 |
| 234 | Ga0105237_10000568 | 3300009545 | Bacteria | 51589 |
| 235 | Ga0105237_10013037 | 3300009545 | Bacteria | 8728 |
| 236 | Ga0105237_10150764 | 3300009545 | Bacteria | 2322 |
| 237 | Ga0105237_10378771 | 3300009545 | Bacteria | 1420 |
| 238 | Ga0105237_11062671 | 3300009545 | Bacteria | 816 |
| 239 | Ga0105238_10003097 | 3300009551 | Bacteria | 16583 |
| 240 | Ga0105238_10014903 | 3300009551 | Bacteria | 7866 |
| 241 | Ga0105238_10022895 | 3300009551 | Bacteria | 6369 |
| 242 | Ga0105238_10159418 | 3300009551 | Bacteria | 2232 |
| 243 | Ga0105238_10315307 | 3300009551 | Bacteria | 1549 |
| 244 | Ga0105238_10512987 | 3300009551 | Bacteria | 1201 |
| 245 | Ga0105249_10022284 | 3300009553 | Bacteria | 5674 |
| 246 | Ga0105249_10039088 | 3300009553 | Bacteria | 4307 |
| 247 | Ga0105249_10688461 | 3300009553 | Bacteria | 1082 |
| 248 | Ga0105249_10858970 | 3300009553 | Bacteria | 973 |
| 249 | Ga0105239_10007023 | 3300010375 | Bacteria | 12960 |
| 250 | Ga0105239_10025591 | 3300010375 | Bacteria | 6497 |
| 251 | Ga0105239_10112639 | 3300010375 | Bacteria | 3016 |
| 252 | Ga0105239_10230480 | 3300010375 | Bacteria | 2078 |
| 253 | Ga0105239_10279455 | 3300010375 | Bacteria | 1879 |
| 254 | Ga0105246_10030657 | 3300011119 | Bacteria | 3553 |
| 255 | Ga0157314_1000326 | 3300012500 | Bacteria | 5014 |
| 256 | Ga0157373_10012155 | 3300013100 | Bacteria | 6329 |
| 257 | Ga0157373_10084243 | 3300013100 | Bacteria | 2241 |
| 258 | Ga0157373_10243308 | 3300013100 | Bacteria | 1272 |
| 259 | Ga0157371_10062807 | 3300013102 | Bacteria | 2632 |
| 260 | Ga0157370_10060564 | 3300013104 | Bacteria | 3594 |
| 261 | Ga0157369_10003187 | 3300013105 | Bacteria | 19569 |
| 262 | Ga0157369_10168551 | 3300013105 | Bacteria | 2308 |
| 263 | Ga0157369_10652521 | 3300013105 | Bacteria | 1085 |
| 264 | Ga0157374_10019920 | 3300013296 | Bacteria | 5946 |
| 265 | Ga0157374_10192892 | 3300013296 | Unclassified | 1993 |
| 266 | Ga0157374_10560234 | 3300013296 | Bacteria | 1151 |
| 267 | Ga0157378_10020320 | 3300013297 | Bacteria | 5841 |
| 268 | Ga0157378_10062016 | 3300013297 | Bacteria | 3338 |
| 269 | Ga0157378_10521596 | 3300013297 | Bacteria | 1190 |
| 270 | Ga0163162_10005971 | 3300013306 | Bacteria | 11787 |
| 271 | Ga0163162_10024462 | 3300013306 | Bacteria | 5962 |
| 272 | Ga0163162_10058014 | 3300013306 | Bacteria | 3899 |
| 273 | Ga0163162_10088120 | 3300013306 | Bacteria | 3183 |
| 274 | Ga0163162_10112768 | 3300013306 | Bacteria | 2818 |
| 275 | Ga0163162_10136794 | 3300013306 | Bacteria | 2561 |
| 276 | Ga0157372_10002205 | 3300013307 | Bacteria | 21152 |
| 277 | Ga0157372_10008580 | 3300013307 | Bacteria | 10859 |
| 278 | Ga0157372_11238964 | 3300013307 | Bacteria | 862 |
| 279 | Ga0157375_10005247 | 3300013308 | Bacteria | 11248 |
| 280 | Ga0157375_10037335 | 3300013308 | Bacteria | 4654 |
| 281 | Ga0157375_10038253 | 3300013308 | Bacteria | 4606 |
| 282 | Ga0157375_10184938 | 3300013308 | Bacteria | 2236 |
| 283 | Ga0157375_10513323 | 3300013308 | Unclassified | 1362 |
| 284 | Ga0157375_10792393 | 3300013308 | Unclassified | 1097 |
| 285 | Ga0157375_11447407 | 3300013308 | Bacteria | 810 |
| 286 | Ga0163163_10000419 | 3300014325 | Bacteria | 39366 |
| 287 | Ga0163163_10008697 | 3300014325 | Bacteria | 9030 |
| 288 | Ga0163163_10104973 | 3300014325 | Bacteria | 2851 |
| 289 | Ga0163163_10117183 | 3300014325 | Bacteria | 2695 |
| 290 | Ga0157380_10006058 | 3300014326 | Bacteria | 8473 |
| 291 | Ga0182008_10009166 | 3300014497 | Bacteria | 5354 |
| 292 | Ga0157379_10000468 | 3300014968 | Bacteria | 32782 |
| 293 | Ga0157379_10002075 | 3300014968 | Bacteria | 16642 |
| 294 | Ga0157379_10026687 | 3300014968 | Bacteria | 5141 |
| 295 | Ga0157376_10001151 | 3300014969 | Bacteria | 17372 |
| 296 | Ga0157376_10015295 | 3300014969 | Bacteria | 5793 |
| 297 | Ga0157376_10063420 | 3300014969 | Bacteria | 3113 |
| 298 | Ga0157376_10305672 | 3300014969 | Bacteria | 1507 |
| 299 | Ga0157376_10948747 | 3300014969 | Bacteria | 881 |
| 300 | Ga0182006_1039066 | 3300015261 | Bacteria | 1875 |
| 301 | Ga0182007_10003164 | 3300015262 | Bacteria | 7886 |
| 302 | Ga0182005_1009509 | 3300015265 | Bacteria | 2828 |
| 303 | Ga0163161_10026834 | 3300017792 | Bacteria | 4083 |
| 304 | Ga0163161_10030598 | 3300017792 | Bacteria | 3833 |
| 305 | Ga0163161_10115289 | 3300017792 | Bacteria | 2013 |
| 306 | Ga0163161_10171649 | 3300017792 | Bacteria | 1658 |
| 307 | Ga0163161_10331662 | 3300017792 | Bacteria | 1205 |
| 308 | Ga0209758_1050042 | 3300025297 | Bacteria | 1469 |
| 309 | Ga0207697_10027886 | 3300025315 | Bacteria | 2308 |
| 310 | Ga0207697_10135798 | 3300025315 | Bacteria | 1065 |
| 311 | Ga0207655_1015566 | 3300025728 | Bacteria | 4217 |
| 312 | Ga0207682_10020033 | 3300025893 | Bacteria | 2623 |
| 313 | Ga0207692_10156829 | 3300025898 | Bacteria | 1308 |
| 314 | Ga0207642_10025498 | 3300025899 | Bacteria | 2393 |
| 315 | Ga0207642_10106899 | 3300025899 | Bacteria | 1417 |
| 316 | Ga0207710_10003077 | 3300025900 | Bacteria | 7493 |
| 317 | Ga0207710_10101516 | 3300025900 | Bacteria | 1357 |
| 318 | Ga0207688_10272398 | 3300025901 | Bacteria | 1030 |
| 319 | Ga0207680_10000440 | 3300025903 | Bacteria | 19637 |
| 320 | Ga0207680_10019916 | 3300025903 | Bacteria | 3599 |
| 321 | Ga0207680_10023317 | 3300025903 | Bacteria | 3378 |
| 322 | Ga0207680_10100749 | 3300025903 | Bacteria | 1855 |
| 323 | Ga0207680_10154888 | 3300025903 | Bacteria | 1531 |
| 324 | Ga0207680_10172638 | 3300025903 | Bacteria | 1457 |
| 325 | Ga0207647_10029287 | 3300025904 | Bacteria | 3565 |
| 326 | Ga0207685_10009453 | 3300025905 | Bacteria | 2833 |
| 327 | Ga0207645_10013709 | 3300025907 | Bacteria | 5448 |
| 328 | Ga0207645_10038352 | 3300025907 | Bacteria | 3073 |
| 329 | Ga0207645_10265210 | 3300025907 | Bacteria | 1138 |
| 330 | Ga0207643_10003322 | 3300025908 | Bacteria | 8671 |
| 331 | Ga0207643_10328033 | 3300025908 | Bacteria | 957 |
| 332 | Ga0207705_10012447 | 3300025909 | Bacteria | 6145 |
| 333 | Ga0207705_10071909 | 3300025909 | Bacteria | 2508 |
| 334 | Ga0207705_10137909 | 3300025909 | Bacteria | 1820 |
| 335 | Ga0207654_10080201 | 3300025911 | Bacteria | 1962 |
| 336 | Ga0207654_10126932 | 3300025911 | Bacteria | 1610 |
| 337 | Ga0207654_10153447 | 3300025911 | Bacteria | 1481 |
| 338 | Ga0207654_10211411 | 3300025911 | Bacteria | 1282 |
| 339 | Ga0207654_10274196 | 3300025911 | Bacteria | 1139 |
| 340 | Ga0207695_10003722 | 3300025913 | Bacteria | 21227 |
| 341 | Ga0207695_10004423 | 3300025913 | Bacteria | 19193 |
| 342 | Ga0207695_10006828 | 3300025913 | Bacteria | 14698 |
| 343 | Ga0207695_10031401 | 3300025913 | Bacteria | 5825 |
| 344 | Ga0207695_10070211 | 3300025913 | Bacteria | 3582 |
| 345 | Ga0207671_10000037 | 3300025914 | Bacteria | 230395 |
| 346 | Ga0207671_10002300 | 3300025914 | Bacteria | 20631 |
| 347 | Ga0207671_10373785 | 3300025914 | Bacteria | 1132 |
| 348 | Ga0207693_10000325 | 3300025915 | Bacteria | 44161 |
| 349 | Ga0207693_10064198 | 3300025915 | Bacteria | 2876 |
| 350 | Ga0207663_10001645 | 3300025916 | Bacteria | 10535 |
| 351 | Ga0207662_10011038 | 3300025918 | Bacteria | 4999 |
| 352 | Ga0207657_10035541 | 3300025919 | Bacteria | 4467 |
| 353 | Ga0207657_10370933 | 3300025919 | Bacteria | 1128 |
| 354 | Ga0207649_10004472 | 3300025920 | Bacteria | 7587 |
| 355 | Ga0207649_10065595 | 3300025920 | Bacteria | 2299 |
| 356 | Ga0207649_10510067 | 3300025920 | Bacteria | 916 |
| 357 | Ga0207652_10247307 | 3300025921 | Bacteria | 1608 |
| 358 | Ga0207646_10037033 | 3300025922 | Bacteria | 4400 |
| 359 | Ga0207646_10120309 | 3300025922 | Bacteria | 2359 |
| 360 | Ga0207646_10276750 | 3300025922 | Bacteria | 1517 |
| 361 | Ga0207646_10294966 | 3300025922 | Bacteria | 1465 |
| 362 | Ga0207681_10042262 | 3300025923 | Bacteria | 3044 |
| 363 | Ga0207681_10375181 | 3300025923 | Bacteria | 1144 |
| 364 | Ga0207694_10042190 | 3300025924 | Bacteria | 3518 |
| 365 | Ga0207694_10208215 | 3300025924 | Bacteria | 1593 |
| 366 | Ga0207650_10088594 | 3300025925 | Bacteria | 2360 |
| 367 | Ga0207650_10107882 | 3300025925 | Bacteria | 2151 |
| 368 | Ga0207650_10170456 | 3300025925 | Bacteria | 1729 |
| 369 | Ga0207650_10259718 | 3300025925 | Bacteria | 1409 |
| 370 | Ga0207659_10010560 | 3300025926 | Bacteria | 5807 |
| 371 | Ga0207659_10140884 | 3300025926 | Bacteria | 1872 |
| 372 | Ga0207687_10002556 | 3300025927 | Bacteria | 12360 |
| 373 | Ga0207687_10103818 | 3300025927 | Bacteria | 2097 |
| 374 | Ga0207687_10413500 | 3300025927 | Bacteria | 1112 |
| 375 | Ga0207700_10010506 | 3300025928 | Bacteria | 5846 |
| 376 | Ga0207664_10258077 | 3300025929 | Bacteria | 1523 |
| 377 | Ga0207664_10300326 | 3300025929 | Bacteria | 1412 |
| 378 | Ga0207644_10003120 | 3300025931 | Bacteria | 10665 |
| 379 | Ga0207644_10059832 | 3300025931 | Bacteria | 2756 |
| 380 | Ga0207644_10585121 | 3300025931 | Bacteria | 926 |
| 381 | Ga0207690_10139991 | 3300025932 | Bacteria | 1782 |
| 382 | Ga0207690_10296588 | 3300025932 | Bacteria | 1264 |
| 383 | Ga0207706_10021523 | 3300025933 | Bacteria | 5789 |
| 384 | Ga0207706_10035277 | 3300025933 | Bacteria | 4447 |
| 385 | Ga0207706_10091789 | 3300025933 | Bacteria | 2670 |
| 386 | Ga0207706_10122495 | 3300025933 | Bacteria | 2287 |
| 387 | Ga0207686_10001142 | 3300025934 | Bacteria | 15331 |
| 388 | Ga0207686_10017354 | 3300025934 | Bacteria | 4055 |
| 389 | Ga0207709_10123926 | 3300025935 | Bacteria | 1750 |
| 390 | Ga0207670_10004331 | 3300025936 | Bacteria | 7625 |
| 391 | Ga0207669_10007901 | 3300025937 | Bacteria | 4959 |
| 392 | Ga0207669_10022493 | 3300025937 | Bacteria | 3350 |
| 393 | Ga0207704_10057363 | 3300025938 | Bacteria | 2392 |
| 394 | Ga0207665_10447370 | 3300025939 | Bacteria | 991 |
| 395 | Ga0207691_10009974 | 3300025940 | Bacteria | 9123 |
| 396 | Ga0207691_10047774 | 3300025940 | Bacteria | 3926 |
| 397 | Ga0207691_10060832 | 3300025940 | Bacteria | 3431 |
| 398 | Ga0207691_10097780 | 3300025940 | Bacteria | 2623 |
| 399 | Ga0207691_10105000 | 3300025940 | Bacteria | 2517 |
| 400 | Ga0207691_10518885 | 3300025940 | Bacteria | 1011 |
| 401 | Ga0207711_10000206 | 3300025941 | Bacteria | 62928 |
| 402 | Ga0207711_10041780 | 3300025941 | Bacteria | 3905 |
| 403 | Ga0207711_10694106 | 3300025941 | Bacteria | 949 |
| 404 | Ga0207689_10000042 | 3300025942 | Bacteria | 93077 |
| 405 | Ga0207689_10034225 | 3300025942 | Bacteria | 4219 |
| 406 | Ga0207689_10041601 | 3300025942 | Bacteria | 3803 |
| 407 | Ga0207661_10108914 | 3300025944 | Bacteria | 2340 |
| 408 | Ga0207679_10253958 | 3300025945 | Bacteria | 1496 |
| 409 | Ga0207679_10416478 | 3300025945 | Bacteria | 1185 |
| 410 | Ga0207667_10003980 | 3300025949 | Bacteria | 18160 |
| 411 | Ga0207667_10043195 | 3300025949 | Bacteria | 4784 |
| 412 | Ga0207667_10117769 | 3300025949 | Bacteria | 2737 |
| 413 | Ga0207651_10001984 | 3300025960 | Bacteria | 9623 |
| 414 | Ga0207651_10313059 | 3300025960 | Bacteria | 1310 |
| 415 | Ga0207712_10003603 | 3300025961 | Bacteria | 9769 |
| 416 | Ga0207712_10007987 | 3300025961 | Bacteria | 6690 |
| 417 | Ga0207712_10186473 | 3300025961 | Bacteria | 1634 |
| 418 | Ga0207712_10307219 | 3300025961 | Bacteria | 1304 |
| 419 | Ga0207668_10082092 | 3300025972 | Bacteria | 2340 |
| 420 | Ga0207668_10141605 | 3300025972 | Bacteria | 1850 |
| 421 | Ga0207668_10301551 | 3300025972 | Bacteria | 1322 |
| 422 | Ga0207640_10000315 | 3300025981 | Bacteria | 32394 |
| 423 | Ga0207640_10012908 | 3300025981 | Bacteria | 4772 |
| 424 | Ga0207640_10026979 | 3300025981 | Bacteria | 3495 |
| 425 | Ga0207640_10205867 | 3300025981 | Bacteria | 1495 |
| 426 | Ga0207658_10000035 | 3300025986 | Bacteria | 154818 |
| 427 | Ga0207658_10017499 | 3300025986 | Bacteria | 4940 |
| 428 | Ga0207658_10030509 | 3300025986 | Bacteria | 3818 |
| 429 | Ga0207658_10054823 | 3300025986 | Bacteria | 2951 |
| 430 | Ga0207658_10253494 | 3300025986 | Bacteria | 1496 |
| 431 | Ga0207658_10676543 | 3300025986 | Bacteria | 931 |
| 432 | Ga0207658_10700490 | 3300025986 | Bacteria | 915 |
| 433 | Ga0207677_10004097 | 3300026023 | Bacteria | 7795 |
| 434 | Ga0207677_10032562 | 3300026023 | Bacteria | 3353 |
| 435 | Ga0207677_10089299 | 3300026023 | Bacteria | 2237 |
| 436 | Ga0207677_10137262 | 3300026023 | Bacteria | 1867 |
| 437 | Ga0207703_10001548 | 3300026035 | Bacteria | 20841 |
| 438 | Ga0207703_10001771 | 3300026035 | Bacteria | 19284 |
| 439 | Ga0207639_10006857 | 3300026041 | Bacteria | 7761 |
| 440 | Ga0207639_10023140 | 3300026041 | Bacteria | 4484 |
| 441 | Ga0207639_10108211 | 3300026041 | Bacteria | 2260 |
| 442 | Ga0207639_10111387 | 3300026041 | Bacteria | 2231 |
| 443 | Ga0207639_10193220 | 3300026041 | Bacteria | 1740 |
| 444 | Ga0207639_10206112 | 3300026041 | Bacteria | 1690 |
| 445 | Ga0207678_10259577 | 3300026067 | Bacteria | 1489 |
| 446 | Ga0207678_10267074 | 3300026067 | Bacteria | 1467 |
| 447 | Ga0207678_10396925 | 3300026067 | Bacteria | 1194 |
| 448 | Ga0207678_10698709 | 3300026067 | Bacteria | 892 |
| 449 | Ga0207708_10038249 | 3300026075 | Bacteria | 3655 |
| 450 | Ga0207702_10030647 | 3300026078 | Bacteria | 4481 |
| 451 | Ga0207702_10074138 | 3300026078 | Bacteria | 2937 |
| 452 | Ga0207702_10099904 | 3300026078 | Bacteria | 2559 |
| 453 | Ga0207641_10005413 | 3300026088 | Bacteria | 10900 |
| 454 | Ga0207641_10023799 | 3300026088 | Bacteria | 5047 |
| 455 | Ga0207641_10207230 | 3300026088 | Bacteria | 1811 |
| 456 | Ga0207641_10286084 | 3300026088 | Bacteria | 1552 |
| 457 | Ga0207641_10435132 | 3300026088 | Bacteria | 1265 |
| 458 | Ga0207641_10521523 | 3300026088 | Unclassified | 1156 |
| 459 | Ga0207641_10561490 | 3300026088 | Bacteria | 1114 |
| 460 | Ga0207648_10001802 | 3300026089 | Bacteria | 23480 |
| 461 | Ga0207648_10038418 | 3300026089 | Bacteria | 4212 |
| 462 | Ga0207648_10115237 | 3300026089 | Bacteria | 2361 |
| 463 | Ga0207648_10116436 | 3300026089 | Bacteria | 2349 |
| 464 | Ga0207676_10032664 | 3300026095 | Bacteria | 3924 |
| 465 | Ga0207676_10119664 | 3300026095 | Bacteria | 2218 |
| 466 | Ga0207676_10163635 | 3300026095 | Bacteria | 1930 |
| 467 | Ga0207676_10208943 | 3300026095 | Bacteria | 1730 |
| 468 | Ga0207676_10519215 | 3300026095 | Bacteria | 1134 |
| 469 | Ga0207674_10002494 | 3300026116 | Bacteria | 23211 |
| 470 | Ga0207674_10002673 | 3300026116 | Bacteria | 22237 |
| 471 | Ga0207675_100001457 | 3300026118 | Bacteria | 23724 |
| 472 | Ga0207675_100012967 | 3300026118 | Bacteria | 7783 |
| 473 | Ga0207675_100165849 | 3300026118 | Bacteria | 2109 |
| 474 | Ga0207675_100479577 | 3300026118 | Bacteria | 1236 |
| 475 | Ga0207683_10000671 | 3300026121 | Bacteria | 31464 |
| 476 | Ga0207683_10000805 | 3300026121 | Bacteria | 28690 |
| 477 | Ga0207683_10022091 | 3300026121 | Bacteria | 5460 |
| 478 | Ga0207683_10037366 | 3300026121 | Bacteria | 4228 |
| 479 | Ga0207698_10032964 | 3300026142 | Bacteria | 3758 |
| 480 | Ga0207698_10150601 | 3300026142 | Bacteria | 2018 |
| 481 | Ga0207698_10324180 | 3300026142 | Bacteria | 1444 |
| 482 | Ga0209588_1017642 | 3300027671 | Bacteria | 2214 |
| 483 | Ga0209966_1011891 | 3300027695 | Bacteria | 1591 |
| 484 | Ga0209974_10054267 | 3300027876 | Bacteria | 1350 |
| 485 | Ga0207428_10000177 | 3300027907 | Bacteria | 89397 |
| 486 | Ga0207428_10057018 | 3300027907 | Bacteria | 3102 |
| 487 | Ga0268266_10021020 | 3300028379 | Bacteria | 5563 |
| 488 | Ga0268266_10153889 | 3300028379 | Bacteria | 2075 |
| 489 | Ga0268266_10406490 | 3300028379 | Bacteria | 1288 |
| 490 | Ga0268265_10014380 | 3300028380 | Bacteria | 5392 |
| 491 | Ga0268265_10086581 | 3300028380 | Bacteria | 2490 |
| 492 | Ga0268265_10314041 | 3300028380 | Unclassified | 1416 |
| 493 | Ga0268264_10000781 | 3300028381 | Bacteria | 34982 |
| 494 | Ga0268264_10001973 | 3300028381 | Bacteria | 18439 |
| 495 | Ga0268264_10005556 | 3300028381 | Bacteria | 10685 |
| 496 | Ga0268264_10046554 | 3300028381 | Bacteria | 3602 |
| 497 | Ga0268264_10075190 | 3300028381 | Bacteria | 2872 |
| 498 | Ga0268264_10129862 | 3300028381 | Bacteria | 2232 |
| 499 | Ga0268264_10136761 | 3300028381 | Bacteria | 2179 |
| 500 | Ga0265337_1013871 | 3300028556 | Bacteria | 2688 |
| 501 | Ga0265336_10025031 | 3300028666 | Bacteria | 1881 |
| 502 | Ga0265338_10041038 | 3300028800 | Bacteria | 4334 |
| 503 | Ga0265338_10047050 | 3300028800 | Bacteria | 3944 |
| 504 | Ga0265324_10008509 | 3300029957 | Bacteria | 4072 |
| 505 | Ga0265324_10015980 | 3300029957 | Bacteria | 2753 |
| 506 | Ga0265320_10016611 | 3300031240 | Bacteria | 4119 |
| 507 | Ga0265327_10029520 | 3300031251 | Bacteria | 3118 |
| 508 | Ga0265316_10108486 | 3300031344 | Bacteria | 2104 |
| 509 | Ga0265314_10024247 | 3300031711 | Bacteria | 4602 |
| 510 | Ga0265342_10194466 | 3300031712 | Bacteria | 1105 |
| 511 | Ga0307516_10142021 | 3300031730 | Bacteria | 2169 |
| 512 | Ga0307405_10013967 | 3300031731 | Bacteria | 4303 |
| 513 | Ga0307413_10000419 | 3300031824 | Bacteria | 13717 |
| 514 | Ga0307410_10005053 | 3300031852 | Bacteria | 6932 |
| 515 | Ga0307410_10326513 | 3300031852 | Bacteria | 1219 |
| 516 | Ga0307406_10162675 | 3300031901 | Bacteria | 1606 |
| 517 | Ga0307407_10010554 | 3300031903 | Bacteria | 4363 |
| 518 | Ga0307412_10121479 | 3300031911 | Bacteria | 1881 |
| 519 | Ga0307409_100017446 | 3300031995 | Bacteria | 4786 |
| 520 | Ga0307409_100044483 | 3300031995 | Bacteria | 3344 |
| 521 | Ga0307414_10004222 | 3300032004 | Bacteria | 7783 |
| 522 | Ga0307411_10000976 | 3300032005 | Bacteria | 10986 |
| 523 | Ga0373926_0028696 | 3300035083 | Unclassified | 1954 |
| 524 | Ga0373928_0036873 | 3300035084 | Bacteria | 1107 |
| 525 | Ga0373923_0001607 | 3300035111 | Bacteria | 6585 |
| 526 | Ga0373932_0010037 | 3300035112 | Bacteria | 2285 |
| 527 | Ga0373939_0006137 | 3300035114 | Bacteria | 2889 |
| 528 | Ga0373945_0019264 | 3300035116 | Bacteria | 2329 |
| 529 | Ga0373954_0009331 | 3300035118 | Bacteria | 4316 |
| 530 | Ga0373957_0021100 | 3300035120 | Bacteria | 2308 |
| 531 | Ga0373955_0001122 | 3300035172 | Bacteria | 11355 |
| 532 | Ga0373931_0007204 | 3300035691 | Bacteria | 5235 |
| 533 | Ga0373931_0199590 | 3300035691 | Bacteria | 1194 |
| 534 | Ga0373935_0472755 | 3300035692 | Bacteria | 907 |
| 535 | Ga0373933_0260264 | 3300035724 | Bacteria | 1118 |
| 536 | Ga0373947_0008671 | 3300035725 | Bacteria | 5850 |
| 537 | Ga0373947_0077549 | 3300035725 | Bacteria | 2049 |
| 538 | Ga0373937_0151265 | 3300036401 | Bacteria | 2174 |
| 539 | Ga0373937_0175992 | 3300036401 | Bacteria | 2009 |
| 540 | Ga0373937_0367182 | 3300036401 | Bacteria | 1364 |
| 541 | Ga0373925_0011050 | 3300037068 | Bacteria | 6557 |
| 542 | Ga0373925_0399798 | 3300037068 | Bacteria | 1120 |
| 543 | Ga0395901_0266020 | 3300038443 | Bacteria | 1784 |
| 544 | Ga0451845_0270843 | 3300041501 | Unclassified | 2954 |
| 545 | Ga0451851_0924877 | 3300041507 | Bacteria | 1230 |
| 546 | Ga0451843_0918627 | 3300041509 | Bacteria | 1771 |
| 547 | Ga0451853_2102187 | 3300041512 | Bacteria | 1086 |
| 548 | Ga0451577_0001644 | 3300042876 | Bacteria | 28947 |
| 549 | Ga0451577_0019299 | 3300042876 | Bacteria | 6270 |
| 550 | Ga0451577_0090372 | 3300042876 | Bacteria | 2733 |
| 551 | Ga0466988_0126519 | 3300044536 | Bacteria | 1501 |
| 552 | Ga0466969_0034122 | 3300044656 | Bacteria | 2579 |
| 553 | Ga0453683_0000001 | 3300044673 | Bacteria | 1384965 |
| 554 | Ga0466966_0032201 | 3300044684 | Bacteria | 3399 |
| 555 | Ga0453684_0030888 | 3300044712 | Bacteria | 7552 |
| 556 | Ga0451576_0004852 | 3300045051 | Bacteria | 17226 |
| 557 | Ga0451576_0023585 | 3300045051 | Bacteria | 6661 |
| 558 | Ga0451576_0396355 | 3300045051 | Bacteria | 1447 |
| 559 | Ga0451576_0801066 | 3300045051 | Bacteria | 989 |
| 560 | Ga0495629_0030534 | 3300046459 | Bacteria | 3819 |
| 561 | Ga0495629_0221763 | 3300046459 | Bacteria | 1304 |
| 562 | Ga0495651_0074188 | 3300046462 | Bacteria | 2582 |
| 563 | Ga0495653_0086422 | 3300046463 | Bacteria | 2305 |
| 564 | Ga0495580_0106700 | 3300046472 | Bacteria | 1945 |
| 565 | Ga0495582_0010846 | 3300046473 | Bacteria | 5014 |
| 566 | Ga0495582_0515502 | 3300046473 | Bacteria | 691 |
| 567 | Ga0495639_0001749 | 3300046475 | Bacteria | 9638 |
| 568 | Ga0495639_0008129 | 3300046475 | Bacteria | 4505 |
| 569 | Ga0495662_0063012 | 3300046476 | Bacteria | 1791 |
| 570 | Ga0495664_0027013 | 3300046477 | Bacteria | 3345 |
| 571 | Ga0495594_0034587 | 3300046499 | Bacteria | 2749 |
| 572 | Ga0495618_0245372 | 3300046514 | Bacteria | 1125 |
| 573 | Ga0495652_0346811 | 3300046529 | Bacteria | 1065 |
| 574 | Ga0495586_0093022 | 3300046535 | Bacteria | 1667 |
| 575 | Ga0495587_0011541 | 3300046536 | Bacteria | 5594 |
| 576 | Ga0495621_0014825 | 3300046539 | Bacteria | 2475 |
| 577 | Ga0495621_0017826 | 3300046539 | Bacteria | 2300 |
| 578 | Ga0495621_0029129 | 3300046539 | Bacteria | 1881 |
| 579 | Ga0495645_0019130 | 3300046543 | Bacteria | 4930 |
| 580 | Ga0495656_0002334 | 3300046615 | Bacteria | 6276 |
| 581 | Ga0495659_0048431 | 3300046664 | Bacteria | 1540 |
| 582 | Ga0495588_0005354 | 3300046674 | Bacteria | 5705 |
| 583 | Ga0495588_0015765 | 3300046674 | Bacteria | 3644 |
| 584 | Ga0495588_0239637 | 3300046674 | Bacteria | 957 |
| 585 | Ga0495657_0220648 | 3300046675 | Bacteria | 1149 |
| 586 | Ga0495599_0159261 | 3300046678 | Bacteria | 1396 |
| 587 | Ga0495646_0151812 | 3300046680 | Bacteria | 1288 |
| 588 | Ga0495647_0004918 | 3300046681 | Bacteria | 4373 |
| 589 | Ga0495647_0051944 | 3300046681 | Bacteria | 1594 |
| 590 | Ga0495658_0162085 | 3300046683 | Bacteria | 1380 |
| 591 | Ga0495624_0201550 | 3300046690 | Bacteria | 1209 |
| 592 | Ga0495670_0007312 | 3300046691 | Bacteria | 5427 |
| 593 | Ga0495600_0009079 | 3300046809 | Bacteria | 6132 |
| 594 | Ga0495581_0000884 | 3300047315 | Bacteria | 16023 |
| 595 | Ga0495581_0093324 | 3300047315 | Bacteria | 1747 |
| 596 | Ga0495674_0297422 | 3300047319 | Bacteria | 1319 |
| 597 | Ga0495674_0338409 | 3300047319 | Bacteria | 1223 |
| 598 | Ga0495676_0023077 | 3300047321 | Bacteria | 5404 |
| 599 | Ga0495680_0097145 | 3300047322 | Bacteria | 2199 |
| 600 | Ga0495675_0066492 | 3300047444 | Bacteria | 2279 |
| 601 | Ga0495614_0376891 | 3300048089 | Bacteria | 664 |
| 602 | Ga0496100_0008854 | 3300048903 | Bacteria | 5630 |
| 603 | Ga0496100_0095849 | 3300048903 | Bacteria | 2035 |
| 604 | Ga0496100_0154433 | 3300048903 | Bacteria | 1640 |
| 605 | Ga0496101_0006811 | 3300048904 | Bacteria | 7371 |
| 606 | Ga0496102_0024354 | 3300048905 | Bacteria | 5381 |
| 607 | Ga0496102_0299290 | 3300048905 | Bacteria | 1516 |
| 608 | Ga0496102_0304204 | 3300048905 | Bacteria | 1503 |
| 609 | Ga0496102_0864825 | 3300048905 | Bacteria | 826 |
| 610 | Ga0496103_0014115 | 3300048906 | Bacteria | 4742 |
| 611 | Ga0496104_0008062 | 3300048907 | Bacteria | 9345 |
| 612 | Ga0496105_0002846 | 3300048908 | Bacteria | 12657 |
| 613 | Ga0496105_0007694 | 3300048908 | Bacteria | 8356 |
| 614 | Ga0496106_0049828 | 3300048909 | Bacteria | 3156 |
| 615 | Ga0496106_0298797 | 3300048909 | Bacteria | 1291 |
| 616 | Ga0496107_0109918 | 3300048910 | Bacteria | 2025 |
| 617 | Ga0496107_0543856 | 3300048910 | Bacteria | 860 |
| 618 | Ga0496107_0642817 | 3300048910 | Bacteria | 782 |
| 619 | Ga0496108_0133437 | 3300048911 | Bacteria | 2134 |
| 620 | Ga0496109_0052691 | 3300048912 | Bacteria | 3710 |
| 621 | Ga0496109_0463833 | 3300048912 | Bacteria | 1196 |
| 622 | Ga0496110_0050474 | 3300048913 | Bacteria | 3652 |
| 623 | Ga0496110_0076385 | 3300048913 | Bacteria | 2978 |
| 624 | Ga0496111_0174964 | 3300048914 | Bacteria | 1595 |
| 625 | Ga0496112_0003976 | 3300048915 | Bacteria | 12383 |
| 626 | Ga0496113_1047041 | 3300048916 | Bacteria | 641 |
| 627 | Ga0496114_0036130 | 3300048917 | Bacteria | 4084 |
| 628 | Ga0496114_0065046 | 3300048917 | Bacteria | 3055 |
| 629 | Ga0496114_0323851 | 3300048917 | Bacteria | 1362 |
| 630 | Ga0496115_0016079 | 3300048918 | Bacteria | 5691 |
| 631 | Ga0496116_0013262 | 3300048919 | Bacteria | 6662 |
| 632 | Ga0496117_0007447 | 3300048920 | Bacteria | 10692 |
| 633 | Ga0496118_0005503 | 3300048921 | Bacteria | 14373 |
| 634 | Ga0501033_0094641 | 3300049570 | Bacteria | 2184 |
| 635 | Ga0501044_0079154 | 3300049823 | Bacteria | 3331 |
| 636 | nmdc:mga05p37_228905_c1 | 3300050507 | Bacteria | 2241 |
| 637 | nmdc:mga06r32_178022_c1 | 3300050510 | Bacteria | 2112 |
| 638 | nmdc:mga08y16_134879_c1 | 3300050511 | Bacteria | 2566 |
| 639 | nmdc:mga08y16_247782_c1 | 3300050511 | Bacteria | 1841 |
| 640 | nmdc:mga08y16_2942_c1 | 3300050511 | Bacteria | 17539 |
| 641 | nmdc:mga0rr50_177103_c1 | 3300050513 | Bacteria | 1741 |
| 642 | nmdc:mga0rr50_425891_c1 | 3300050513 | Bacteria | 1123 |
| 643 | nmdc:mga0a205_324629_c1 | 3300050515 | Bacteria | 1410 |
| 644 | Ga0495619_0001956 | 3300053085 | Bacteria | 13738 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048916 | Ga0496113_1047041 | Ga0496113_1047041_75_617 | 179 |
| 2 | 3300013308 | Ga0157375_10792393 | Ga0157375_107923932 | 203 |
| 3 | 3300048089 | Ga0495614_0376891 | Ga0495614_0376891_24_635 | 203 |
| 4 | 3300013105 | Ga0157369_10168551 | Ga0157369_101685514 | 204 |
| 5 | 3300025923 | Ga0207681_10042262 | Ga0207681_100422623 | 204 |
| 6 | 3300027695 | Ga0209966_1011891 | Ga0209966_10118912 | 206 |
| 7 | 3300005339 | Ga0070660_100400349 | Ga0070660_1004003492 | 212 |
| 8 | 3300005530 | Ga0070679_100350049 | Ga0070679_1003500492 | 212 |
| 9 | 3300005539 | Ga0068853_100261502 | Ga0068853_1002615022 | 212 |
| 10 | 3300013100 | Ga0157373_10012155 | Ga0157373_100121557 | 212 |
| 11 | 3300025919 | Ga0207657_10370933 | Ga0207657_103709332 | 212 |
| 12 | 3300035114 | Ga0373939_0006137 | Ga0373939_0006137_2174_2818 | 212 |
| 13 | 3300005355 | Ga0070671_100464423 | Ga0070671_1004644231 | 213 |
| 14 | 3300005841 | Ga0068863_100460961 | Ga0068863_1004609612 | 213 |
| 15 | 3300005985 | Ga0081539_10010113 | Ga0081539_100101139 | 213 |
| 16 | 3300026088 | Ga0207641_10435132 | Ga0207641_104351322 | 213 |
| 17 | 3300036401 | Ga0373937_0151265 | Ga0373937_0151265_27_677 | 213 |
| 18 | 3300001979 | JGI24740J21852_10022621 | JGI24740J21852_100226212 | 214 |
| 19 | 3300001990 | JGI24737J22298_10044449 | JGI24737J22298_100444491 | 214 |
| 20 | 3300002067 | JGI24735J21928_10021736 | JGI24735J21928_100217362 | 214 |
| 21 | 3300003203 | JGI25406J46586_10087553 | JGI25406J46586_100875532 | 214 |
| 22 | 3300003320 | rootH2_10037647 | rootH2_100376479 | 214 |
| 23 | 3300005290 | Ga0065712_10161511 | Ga0065712_101615111 | 214 |
| 24 | 3300005327 | Ga0070658_10000960 | Ga0070658_100009608 | 214 |
| 25 | 3300005328 | Ga0070676_10009642 | Ga0070676_100096422 | 214 |
| 26 | 3300005330 | Ga0070690_100779805 | Ga0070690_1007798051 | 214 |
| 27 | 3300005331 | Ga0070670_100001648 | Ga0070670_1000016484 | 214 |
| 28 | 3300005331 | Ga0070670_100009312 | Ga0070670_1000093122 | 214 |
| 29 | 3300005331 | Ga0070670_100012745 | Ga0070670_1000127454 | 214 |
| 30 | 3300005331 | Ga0070670_100061114 | Ga0070670_1000611143 | 214 |
| 31 | 3300005333 | Ga0070677_10013217 | Ga0070677_100132173 | 214 |
| 32 | 3300005334 | Ga0068869_100003631 | Ga0068869_1000036318 | 214 |
| 33 | 3300005334 | Ga0068869_100075175 | Ga0068869_1000751753 | 214 |
| 34 | 3300005334 | Ga0068869_100253831 | Ga0068869_1002538311 | 214 |
| 35 | 3300005335 | Ga0070666_10000883 | Ga0070666_100008837 | 214 |
| 36 | 3300005335 | Ga0070666_10011620 | Ga0070666_100116203 | 214 |
| 37 | 3300005335 | Ga0070666_10033401 | Ga0070666_100334015 | 214 |
| 38 | 3300005335 | Ga0070666_10146480 | Ga0070666_101464802 | 214 |
| 39 | 3300005335 | Ga0070666_10555969 | Ga0070666_105559691 | 214 |
| 40 | 3300005336 | Ga0070680_100031707 | Ga0070680_1000317074 | 214 |
| 41 | 3300005336 | Ga0070680_100112412 | Ga0070680_1001124124 | 214 |
| 42 | 3300005338 | Ga0068868_100024734 | Ga0068868_1000247343 | 214 |
| 43 | 3300005338 | Ga0068868_100044045 | Ga0068868_1000440452 | 214 |
| 44 | 3300005338 | Ga0068868_100186069 | Ga0068868_1001860693 | 214 |
| 45 | 3300005339 | Ga0070660_100005482 | Ga0070660_1000054828 | 214 |
| 46 | 3300005339 | Ga0070660_100073845 | Ga0070660_1000738453 | 214 |
| 47 | 3300005339 | Ga0070660_100660730 | Ga0070660_1006607301 | 214 |
| 48 | 3300005340 | Ga0070689_100000405 | Ga0070689_10000040521 | 214 |
| 49 | 3300005343 | Ga0070687_100049781 | Ga0070687_1000497812 | 214 |
| 50 | 3300005343 | Ga0070687_100234630 | Ga0070687_1002346302 | 214 |
| 51 | 3300005344 | Ga0070661_100002335 | Ga0070661_1000023353 | 214 |
| 52 | 3300005344 | Ga0070661_100035283 | Ga0070661_1000352836 | 214 |
| 53 | 3300005344 | Ga0070661_100207255 | Ga0070661_1002072552 | 214 |
| 54 | 3300005344 | Ga0070661_100322795 | Ga0070661_1003227952 | 214 |
| 55 | 3300005344 | Ga0070661_100592225 | Ga0070661_1005922251 | 214 |
| 56 | 3300005345 | Ga0070692_10290225 | Ga0070692_102902251 | 214 |
| 57 | 3300005347 | Ga0070668_100033665 | Ga0070668_1000336653 | 214 |
| 58 | 3300005347 | Ga0070668_100081514 | Ga0070668_1000815142 | 214 |
| 59 | 3300005353 | Ga0070669_100149724 | Ga0070669_1001497242 | 214 |
| 60 | 3300005353 | Ga0070669_100207865 | Ga0070669_1002078652 | 214 |
| 61 | 3300005353 | Ga0070669_100213917 | Ga0070669_1002139172 | 214 |
| 62 | 3300005354 | Ga0070675_100029260 | Ga0070675_1000292602 | 214 |
| 63 | 3300005354 | Ga0070675_100492206 | Ga0070675_1004922061 | 214 |
| 64 | 3300005355 | Ga0070671_100028890 | Ga0070671_1000288903 | 214 |
| 65 | 3300005355 | Ga0070671_100257189 | Ga0070671_1002571893 | 214 |
| 66 | 3300005356 | Ga0070674_100000708 | Ga0070674_1000007086 | 214 |
| 67 | 3300005356 | Ga0070674_100129232 | Ga0070674_1001292322 | 214 |
| 68 | 3300005356 | Ga0070674_100259001 | Ga0070674_1002590012 | 214 |
| 69 | 3300005364 | Ga0070673_100002708 | Ga0070673_10000270811 | 214 |
| 70 | 3300005364 | Ga0070673_100373988 | Ga0070673_1003739881 | 214 |
| 71 | 3300005364 | Ga0070673_100463812 | Ga0070673_1004638122 | 214 |
| 72 | 3300005365 | Ga0070688_100002477 | Ga0070688_1000024778 | 214 |
| 73 | 3300005366 | Ga0070659_100006550 | Ga0070659_1000065501 | 214 |
| 74 | 3300005366 | Ga0070659_100069221 | Ga0070659_1000692212 | 214 |
| 75 | 3300005366 | Ga0070659_100141592 | Ga0070659_1001415922 | 214 |
| 76 | 3300005367 | Ga0070667_100000070 | Ga0070667_10000007079 | 214 |
| 77 | 3300005367 | Ga0070667_100004034 | Ga0070667_10000403413 | 214 |
| 78 | 3300005367 | Ga0070667_100007792 | Ga0070667_10000779215 | 214 |
| 79 | 3300005367 | Ga0070667_100043123 | Ga0070667_1000431233 | 214 |
| 80 | 3300005367 | Ga0070667_100144266 | Ga0070667_1001442662 | 214 |
| 81 | 3300005367 | Ga0070667_100155755 | Ga0070667_1001557553 | 214 |
| 82 | 3300005435 | Ga0070714_100000954 | Ga0070714_1000009545 | 214 |
| 83 | 3300005435 | Ga0070714_100190455 | Ga0070714_1001904552 | 214 |
| 84 | 3300005436 | Ga0070713_100034884 | Ga0070713_1000348842 | 214 |
| 85 | 3300005436 | Ga0070713_100216895 | Ga0070713_1002168953 | 214 |
| 86 | 3300005437 | Ga0070710_10005351 | Ga0070710_100053512 | 214 |
| 87 | 3300005438 | Ga0070701_10186042 | Ga0070701_101860422 | 214 |
| 88 | 3300005439 | Ga0070711_100002923 | Ga0070711_1000029233 | 214 |
| 89 | 3300005440 | Ga0070705_100231817 | Ga0070705_1002318171 | 214 |
| 90 | 3300005441 | Ga0070700_100040841 | Ga0070700_1000408412 | 214 |
| 91 | 3300005455 | Ga0070663_100115168 | Ga0070663_1001151682 | 214 |
| 92 | 3300005455 | Ga0070663_100227824 | Ga0070663_1002278242 | 214 |
| 93 | 3300005456 | Ga0070678_100035786 | Ga0070678_1000357863 | 214 |
| 94 | 3300005456 | Ga0070678_100908091 | Ga0070678_1009080911 | 214 |
| 95 | 3300005457 | Ga0070662_100020585 | Ga0070662_1000205857 | 214 |
| 96 | 3300005457 | Ga0070662_100068743 | Ga0070662_1000687432 | 214 |
| 97 | 3300005457 | Ga0070662_100205312 | Ga0070662_1002053122 | 214 |
| 98 | 3300005459 | Ga0068867_100004004 | Ga0068867_10000400410 | 214 |
| 99 | 3300005459 | Ga0068867_100044544 | Ga0068867_1000445441 | 214 |
| 100 | 3300005459 | Ga0068867_100080291 | Ga0068867_1000802912 | 214 |
| 101 | 3300005459 | Ga0068867_100129727 | Ga0068867_1001297271 | 214 |
| 102 | 3300005466 | Ga0070685_10000781 | Ga0070685_1000078120 | 214 |
| 103 | 3300005466 | Ga0070685_10054797 | Ga0070685_100547973 | 214 |
| 104 | 3300005468 | Ga0070707_100081984 | Ga0070707_1000819843 | 214 |
| 105 | 3300005468 | Ga0070707_100368654 | Ga0070707_1003686541 | 214 |
| 106 | 3300005530 | Ga0070679_100432899 | Ga0070679_1004328992 | 214 |
| 107 | 3300005535 | Ga0070684_100078053 | Ga0070684_1000780534 | 214 |
| 108 | 3300005535 | Ga0070684_100100487 | Ga0070684_1001004873 | 214 |
| 109 | 3300005536 | Ga0070697_100475732 | Ga0070697_1004757322 | 214 |
| 110 | 3300005539 | Ga0068853_100012867 | Ga0068853_1000128678 | 214 |
| 111 | 3300005539 | Ga0068853_100016601 | Ga0068853_1000166014 | 214 |
| 112 | 3300005539 | Ga0068853_100342657 | Ga0068853_1003426572 | 214 |
| 113 | 3300005543 | Ga0070672_100029879 | Ga0070672_1000298794 | 214 |
| 114 | 3300005543 | Ga0070672_100107727 | Ga0070672_1001077273 | 214 |
| 115 | 3300005543 | Ga0070672_100174684 | Ga0070672_1001746842 | 214 |
| 116 | 3300005543 | Ga0070672_100512162 | Ga0070672_1005121622 | 214 |
| 117 | 3300005544 | Ga0070686_100009269 | Ga0070686_1000092698 | 214 |
| 118 | 3300005546 | Ga0070696_100002515 | Ga0070696_10000251517 | 214 |
| 119 | 3300005546 | Ga0070696_100027759 | Ga0070696_1000277596 | 214 |
| 120 | 3300005546 | Ga0070696_100317235 | Ga0070696_1003172352 | 214 |
| 121 | 3300005547 | Ga0070693_100004506 | Ga0070693_1000045063 | 214 |
| 122 | 3300005547 | Ga0070693_100077002 | Ga0070693_1000770022 | 214 |
| 123 | 3300005548 | Ga0070665_100012399 | Ga0070665_10001239913 | 214 |
| 124 | 3300005548 | Ga0070665_100035492 | Ga0070665_1000354922 | 214 |
| 125 | 3300005549 | Ga0070704_100296117 | Ga0070704_1002961172 | 214 |
| 126 | 3300005549 | Ga0070704_100775592 | Ga0070704_1007755922 | 214 |
| 127 | 3300005563 | Ga0068855_100008716 | Ga0068855_1000087166 | 214 |
| 128 | 3300005563 | Ga0068855_100033228 | Ga0068855_1000332286 | 214 |
| 129 | 3300005563 | Ga0068855_100116020 | Ga0068855_1001160202 | 214 |
| 130 | 3300005564 | Ga0070664_100005045 | Ga0070664_1000050452 | 214 |
| 131 | 3300005564 | Ga0070664_100040329 | Ga0070664_1000403294 | 214 |
| 132 | 3300005564 | Ga0070664_100388901 | Ga0070664_1003889012 | 214 |
| 133 | 3300005577 | Ga0068857_100003573 | Ga0068857_1000035739 | 214 |
| 134 | 3300005577 | Ga0068857_100004795 | Ga0068857_1000047954 | 214 |
| 135 | 3300005577 | Ga0068857_100029378 | Ga0068857_1000293782 | 214 |
| 136 | 3300005578 | Ga0068854_100000351 | Ga0068854_1000003516 | 214 |
| 137 | 3300005578 | Ga0068854_100004788 | Ga0068854_1000047889 | 214 |
| 138 | 3300005578 | Ga0068854_100018892 | Ga0068854_1000188922 | 214 |
| 139 | 3300005578 | Ga0068854_100143794 | Ga0068854_1001437942 | 214 |
| 140 | 3300005578 | Ga0068854_100239851 | Ga0068854_1002398512 | 214 |
| 141 | 3300005578 | Ga0068854_100523802 | Ga0068854_1005238022 | 214 |
| 142 | 3300005614 | Ga0068856_100016485 | Ga0068856_1000164853 | 214 |
| 143 | 3300005614 | Ga0068856_100023023 | Ga0068856_10002302310 | 214 |
| 144 | 3300005614 | Ga0068856_100071577 | Ga0068856_1000715773 | 214 |
| 145 | 3300005614 | Ga0068856_100083131 | Ga0068856_1000831314 | 214 |
| 146 | 3300005614 | Ga0068856_100099014 | Ga0068856_1000990142 | 214 |
| 147 | 3300005615 | Ga0070702_100021363 | Ga0070702_1000213635 | 214 |
| 148 | 3300005616 | Ga0068852_100024598 | Ga0068852_1000245984 | 214 |
| 149 | 3300005616 | Ga0068852_100032787 | Ga0068852_1000327876 | 214 |
| 150 | 3300005616 | Ga0068852_100034850 | Ga0068852_1000348502 | 214 |
| 151 | 3300005616 | Ga0068852_100397247 | Ga0068852_1003972472 | 214 |
| 152 | 3300005616 | Ga0068852_100434409 | Ga0068852_1004344092 | 214 |
| 153 | 3300005616 | Ga0068852_100750496 | Ga0068852_1007504961 | 214 |
| 154 | 3300005617 | Ga0068859_100001347 | Ga0068859_10000134728 | 214 |
| 155 | 3300005617 | Ga0068859_100009913 | Ga0068859_1000099132 | 214 |
| 156 | 3300005617 | Ga0068859_100062429 | Ga0068859_1000624292 | 214 |
| 157 | 3300005617 | Ga0068859_100077063 | Ga0068859_1000770633 | 214 |
| 158 | 3300005618 | Ga0068864_100010584 | Ga0068864_1000105846 | 214 |
| 159 | 3300005618 | Ga0068864_100017409 | Ga0068864_10001740910 | 214 |
| 160 | 3300005618 | Ga0068864_100018003 | Ga0068864_1000180034 | 214 |
| 161 | 3300005618 | Ga0068864_100035436 | Ga0068864_1000354364 | 214 |
| 162 | 3300005718 | Ga0068866_10007029 | Ga0068866_100070296 | 214 |
| 163 | 3300005718 | Ga0068866_10074224 | Ga0068866_100742242 | 214 |
| 164 | 3300005719 | Ga0068861_100014002 | Ga0068861_1000140024 | 214 |
| 165 | 3300005719 | Ga0068861_100087995 | Ga0068861_1000879952 | 214 |
| 166 | 3300005719 | Ga0068861_100114982 | Ga0068861_1001149824 | 214 |
| 167 | 3300005834 | Ga0068851_10006735 | Ga0068851_100067352 | 214 |
| 168 | 3300005834 | Ga0068851_10099648 | Ga0068851_100996482 | 214 |
| 169 | 3300005840 | Ga0068870_10009728 | Ga0068870_100097287 | 214 |
| 170 | 3300005840 | Ga0068870_10107234 | Ga0068870_101072342 | 214 |
| 171 | 3300005841 | Ga0068863_100013951 | Ga0068863_1000139514 | 214 |
| 172 | 3300005841 | Ga0068863_100026288 | Ga0068863_10002628811 | 214 |
| 173 | 3300005841 | Ga0068863_100374528 | Ga0068863_1003745282 | 214 |
| 174 | 3300005841 | Ga0068863_100605580 | Ga0068863_1006055802 | 214 |
| 175 | 3300005842 | Ga0068858_100003331 | Ga0068858_1000033316 | 214 |
| 176 | 3300005842 | Ga0068858_100036483 | Ga0068858_1000364833 | 214 |
| 177 | 3300005842 | Ga0068858_100058263 | Ga0068858_1000582632 | 214 |
| 178 | 3300005842 | Ga0068858_100860432 | Ga0068858_1008604321 | 214 |
| 179 | 3300005843 | Ga0068860_100006411 | Ga0068860_1000064112 | 214 |
| 180 | 3300005843 | Ga0068860_100030495 | Ga0068860_1000304957 | 214 |
| 181 | 3300005843 | Ga0068860_100031074 | Ga0068860_1000310743 | 214 |
| 182 | 3300005843 | Ga0068860_100063672 | Ga0068860_1000636722 | 214 |
| 183 | 3300005843 | Ga0068860_100086234 | Ga0068860_1000862346 | 214 |
| 184 | 3300005843 | Ga0068860_100101809 | Ga0068860_1001018094 | 214 |
| 185 | 3300005843 | Ga0068860_100243006 | Ga0068860_1002430061 | 214 |
| 186 | 3300005844 | Ga0068862_100004281 | Ga0068862_1000042819 | 214 |
| 187 | 3300005844 | Ga0068862_100036178 | Ga0068862_1000361784 | 214 |
| 188 | 3300005844 | Ga0068862_100094264 | Ga0068862_1000942642 | 214 |
| 189 | 3300005985 | Ga0081539_10003560 | Ga0081539_100035609 | 214 |
| 190 | 3300006163 | Ga0070715_10054981 | Ga0070715_100549813 | 214 |
| 191 | 3300006163 | Ga0070715_10196118 | Ga0070715_101961182 | 214 |
| 192 | 3300006175 | Ga0070712_100016494 | Ga0070712_1000164943 | 214 |
| 193 | 3300006175 | Ga0070712_100809659 | Ga0070712_1008096591 | 214 |
| 194 | 3300006237 | Ga0097621_100026284 | Ga0097621_1000262844 | 214 |
| 195 | 3300006237 | Ga0097621_100037602 | Ga0097621_1000376026 | 214 |
| 196 | 3300006358 | Ga0068871_100029400 | Ga0068871_1000294007 | 214 |
| 197 | 3300006358 | Ga0068871_100064326 | Ga0068871_1000643264 | 214 |
| 198 | 3300006358 | Ga0068871_100092803 | Ga0068871_1000928033 | 214 |
| 199 | 3300006358 | Ga0068871_100108507 | Ga0068871_1001085073 | 214 |
| 200 | 3300006846 | Ga0075430_100924021 | Ga0075430_1009240211 | 214 |
| 201 | 3300006852 | Ga0075433_10346127 | Ga0075433_103461271 | 214 |
| 202 | 3300006881 | Ga0068865_100038324 | Ga0068865_1000383241 | 214 |
| 203 | 3300006881 | Ga0068865_100048848 | Ga0068865_1000488484 | 214 |
| 204 | 3300006881 | Ga0068865_100147208 | Ga0068865_1001472083 | 214 |
| 205 | 3300006931 | Ga0097620_100001347 | Ga0097620_10000134728 | 214 |
| 206 | 3300006931 | Ga0097620_100009913 | Ga0097620_1000099132 | 214 |
| 207 | 3300006931 | Ga0097620_100062426 | Ga0097620_1000624262 | 214 |
| 208 | 3300006931 | Ga0097620_100077064 | Ga0097620_1000770643 | 214 |
| 209 | 3300006931 | Ga0097620_100122140 | Ga0097620_1001221403 | 214 |
| 210 | 3300007076 | Ga0075435_100067875 | Ga0075435_1000678752 | 214 |
| 211 | 3300007076 | Ga0075435_100315408 | Ga0075435_1003154082 | 214 |
| 212 | 3300007076 | Ga0075435_100582374 | Ga0075435_1005823741 | 214 |
| 213 | 3300007265 | Ga0099794_10016035 | Ga0099794_100160354 | 214 |
| 214 | 3300009036 | Ga0105244_10004531 | Ga0105244_100045318 | 214 |
| 215 | 3300009093 | Ga0105240_10003598 | Ga0105240_1000359823 | 214 |
| 216 | 3300009093 | Ga0105240_10015820 | Ga0105240_100158209 | 214 |
| 217 | 3300009093 | Ga0105240_10040583 | Ga0105240_100405835 | 214 |
| 218 | 3300009093 | Ga0105240_10090577 | Ga0105240_100905772 | 214 |
| 219 | 3300009093 | Ga0105240_10104545 | Ga0105240_101045453 | 214 |
| 220 | 3300009093 | Ga0105240_10301933 | Ga0105240_103019332 | 214 |
| 221 | 3300009094 | Ga0111539_10006635 | Ga0111539_100066356 | 214 |
| 222 | 3300009094 | Ga0111539_10033069 | Ga0111539_100330692 | 214 |
| 223 | 3300009094 | Ga0111539_10055709 | Ga0111539_100557091 | 214 |
| 224 | 3300009098 | Ga0105245_10001706 | Ga0105245_1000170624 | 214 |
| 225 | 3300009098 | Ga0105245_10004524 | Ga0105245_1000452416 | 214 |
| 226 | 3300009098 | Ga0105245_10128767 | Ga0105245_101287672 | 214 |
| 227 | 3300009101 | Ga0105247_10001753 | Ga0105247_1000175327 | 214 |
| 228 | 3300009101 | Ga0105247_10003347 | Ga0105247_1000334710 | 214 |
| 229 | 3300009101 | Ga0105247_10006032 | Ga0105247_100060323 | 214 |
| 230 | 3300009147 | Ga0114129_10246825 | Ga0114129_102468252 | 214 |
| 231 | 3300009148 | Ga0105243_10019788 | Ga0105243_100197886 | 214 |
| 232 | 3300009174 | Ga0105241_10032952 | Ga0105241_100329522 | 214 |
| 233 | 3300009174 | Ga0105241_10053418 | Ga0105241_100534185 | 214 |
| 234 | 3300009174 | Ga0105241_10326953 | Ga0105241_103269532 | 214 |
| 235 | 3300009174 | Ga0105241_10399357 | Ga0105241_103993571 | 214 |
| 236 | 3300009174 | Ga0105241_10410591 | Ga0105241_104105912 | 214 |
| 237 | 3300009174 | Ga0105241_10616428 | Ga0105241_106164282 | 214 |
| 238 | 3300009176 | Ga0105242_10006602 | Ga0105242_100066025 | 214 |
| 239 | 3300009176 | Ga0105242_10026457 | Ga0105242_100264574 | 214 |
| 240 | 3300009177 | Ga0105248_10003961 | Ga0105248_1000396113 | 214 |
| 241 | 3300009177 | Ga0105248_10007310 | Ga0105248_100073107 | 214 |
| 242 | 3300009177 | Ga0105248_10032837 | Ga0105248_100328376 | 214 |
| 243 | 3300009177 | Ga0105248_10081849 | Ga0105248_100818492 | 214 |
| 244 | 3300009177 | Ga0105248_10283874 | Ga0105248_102838742 | 214 |
| 245 | 3300009545 | Ga0105237_10000568 | Ga0105237_1000056834 | 214 |
| 246 | 3300009545 | Ga0105237_10013037 | Ga0105237_100130376 | 214 |
| 247 | 3300009545 | Ga0105237_10150764 | Ga0105237_101507642 | 214 |
| 248 | 3300009545 | Ga0105237_10378771 | Ga0105237_103787712 | 214 |
| 249 | 3300009545 | Ga0105237_11062671 | Ga0105237_110626711 | 214 |
| 250 | 3300009551 | Ga0105238_10003097 | Ga0105238_100030972 | 214 |
| 251 | 3300009551 | Ga0105238_10014903 | Ga0105238_100149034 | 214 |
| 252 | 3300009551 | Ga0105238_10022895 | Ga0105238_100228952 | 214 |
| 253 | 3300009551 | Ga0105238_10159418 | Ga0105238_101594183 | 214 |
| 254 | 3300009551 | Ga0105238_10315307 | Ga0105238_103153071 | 214 |
| 255 | 3300009551 | Ga0105238_10512987 | Ga0105238_105129871 | 214 |
| 256 | 3300009553 | Ga0105249_10022284 | Ga0105249_100222845 | 214 |
| 257 | 3300009553 | Ga0105249_10039088 | Ga0105249_100390883 | 214 |
| 258 | 3300009553 | Ga0105249_10688461 | Ga0105249_106884612 | 214 |
| 259 | 3300009553 | Ga0105249_10858970 | Ga0105249_108589701 | 214 |
| 260 | 3300010375 | Ga0105239_10007023 | Ga0105239_100070232 | 214 |
| 261 | 3300010375 | Ga0105239_10025591 | Ga0105239_100255914 | 214 |
| 262 | 3300010375 | Ga0105239_10112639 | Ga0105239_101126392 | 214 |
| 263 | 3300010375 | Ga0105239_10230480 | Ga0105239_102304802 | 214 |
| 264 | 3300010375 | Ga0105239_10279455 | Ga0105239_102794553 | 214 |
| 265 | 3300011119 | Ga0105246_10030657 | Ga0105246_100306575 | 214 |
| 266 | 3300012500 | Ga0157314_1000326 | Ga0157314_10003264 | 214 |
| 267 | 3300013100 | Ga0157373_10084243 | Ga0157373_100842431 | 214 |
| 268 | 3300013100 | Ga0157373_10243308 | Ga0157373_102433082 | 214 |
| 269 | 3300013102 | Ga0157371_10062807 | Ga0157371_100628071 | 214 |
| 270 | 3300013104 | Ga0157370_10060564 | Ga0157370_100605644 | 214 |
| 271 | 3300013105 | Ga0157369_10003187 | Ga0157369_1000318712 | 214 |
| 272 | 3300013105 | Ga0157369_10652521 | Ga0157369_106525211 | 214 |
| 273 | 3300013296 | Ga0157374_10019920 | Ga0157374_1001992011 | 214 |
| 274 | 3300013296 | Ga0157374_10192892 | Ga0157374_101928922 | 214 |
| 275 | 3300013296 | Ga0157374_10560234 | Ga0157374_105602342 | 214 |
| 276 | 3300013297 | Ga0157378_10020320 | Ga0157378_100203207 | 214 |
| 277 | 3300013297 | Ga0157378_10062016 | Ga0157378_100620162 | 214 |
| 278 | 3300013297 | Ga0157378_10521596 | Ga0157378_105215962 | 214 |
| 279 | 3300013306 | Ga0163162_10005971 | Ga0163162_1000597115 | 214 |
| 280 | 3300013306 | Ga0163162_10024462 | Ga0163162_100244625 | 214 |
| 281 | 3300013306 | Ga0163162_10058014 | Ga0163162_100580143 | 214 |
| 282 | 3300013306 | Ga0163162_10088120 | Ga0163162_100881203 | 214 |
| 283 | 3300013306 | Ga0163162_10112768 | Ga0163162_101127683 | 214 |
| 284 | 3300013306 | Ga0163162_10136794 | Ga0163162_101367944 | 214 |
| 285 | 3300013307 | Ga0157372_10002205 | Ga0157372_100022056 | 214 |
| 286 | 3300013307 | Ga0157372_10008580 | Ga0157372_100085805 | 214 |
| 287 | 3300013307 | Ga0157372_11238964 | Ga0157372_112389642 | 214 |
| 288 | 3300013308 | Ga0157375_10005247 | Ga0157375_1000524711 | 214 |
| 289 | 3300013308 | Ga0157375_10037335 | Ga0157375_100373353 | 214 |
| 290 | 3300013308 | Ga0157375_10038253 | Ga0157375_100382533 | 214 |
| 291 | 3300013308 | Ga0157375_10184938 | Ga0157375_101849382 | 214 |
| 292 | 3300013308 | Ga0157375_10513323 | Ga0157375_105133231 | 214 |
| 293 | 3300013308 | Ga0157375_11447407 | Ga0157375_114474071 | 214 |
| 294 | 3300014325 | Ga0163163_10000419 | Ga0163163_1000041913 | 214 |
| 295 | 3300014325 | Ga0163163_10008697 | Ga0163163_1000869715 | 214 |
| 296 | 3300014325 | Ga0163163_10104973 | Ga0163163_101049734 | 214 |
| 297 | 3300014325 | Ga0163163_10117183 | Ga0163163_101171832 | 214 |
| 298 | 3300014326 | Ga0157380_10006058 | Ga0157380_100060583 | 214 |
| 299 | 3300014497 | Ga0182008_10009166 | Ga0182008_100091665 | 214 |
| 300 | 3300014968 | Ga0157379_10000468 | Ga0157379_1000046810 | 214 |
| 301 | 3300014968 | Ga0157379_10002075 | Ga0157379_1000207511 | 214 |
| 302 | 3300014968 | Ga0157379_10026687 | Ga0157379_100266873 | 214 |
| 303 | 3300014969 | Ga0157376_10001151 | Ga0157376_100011515 | 214 |
| 304 | 3300014969 | Ga0157376_10015295 | Ga0157376_100152955 | 214 |
| 305 | 3300014969 | Ga0157376_10063420 | Ga0157376_100634205 | 214 |
| 306 | 3300014969 | Ga0157376_10305672 | Ga0157376_103056722 | 214 |
| 307 | 3300014969 | Ga0157376_10948747 | Ga0157376_109487471 | 214 |
| 308 | 3300015261 | Ga0182006_1039066 | Ga0182006_10390662 | 214 |
| 309 | 3300015262 | Ga0182007_10003164 | Ga0182007_100031644 | 214 |
| 310 | 3300015265 | Ga0182005_1009509 | Ga0182005_10095093 | 214 |
| 311 | 3300017792 | Ga0163161_10026834 | Ga0163161_100268344 | 214 |
| 312 | 3300017792 | Ga0163161_10030598 | Ga0163161_100305982 | 214 |
| 313 | 3300017792 | Ga0163161_10115289 | Ga0163161_101152892 | 214 |
| 314 | 3300017792 | Ga0163161_10171649 | Ga0163161_101716492 | 214 |
| 315 | 3300017792 | Ga0163161_10331662 | Ga0163161_103316622 | 214 |
| 316 | 3300025297 | Ga0209758_1050042 | Ga0209758_10500422 | 214 |
| 317 | 3300025315 | Ga0207697_10027886 | Ga0207697_100278862 | 214 |
| 318 | 3300025315 | Ga0207697_10135798 | Ga0207697_101357981 | 214 |
| 319 | 3300025728 | Ga0207655_1015566 | Ga0207655_10155661 | 214 |
| 320 | 3300025893 | Ga0207682_10020033 | Ga0207682_100200333 | 214 |
| 321 | 3300025898 | Ga0207692_10156829 | Ga0207692_101568292 | 214 |
| 322 | 3300025899 | Ga0207642_10025498 | Ga0207642_100254983 | 214 |
| 323 | 3300025899 | Ga0207642_10106899 | Ga0207642_101068992 | 214 |
| 324 | 3300025900 | Ga0207710_10003077 | Ga0207710_100030772 | 214 |
| 325 | 3300025900 | Ga0207710_10101516 | Ga0207710_101015162 | 214 |
| 326 | 3300025901 | Ga0207688_10272398 | Ga0207688_102723982 | 214 |
| 327 | 3300025903 | Ga0207680_10000440 | Ga0207680_100004409 | 214 |
| 328 | 3300025903 | Ga0207680_10019916 | Ga0207680_100199166 | 214 |
| 329 | 3300025903 | Ga0207680_10023317 | Ga0207680_100233173 | 214 |
| 330 | 3300025903 | Ga0207680_10100749 | Ga0207680_101007492 | 214 |
| 331 | 3300025903 | Ga0207680_10154888 | Ga0207680_101548882 | 214 |
| 332 | 3300025903 | Ga0207680_10172638 | Ga0207680_101726383 | 214 |
| 333 | 3300025904 | Ga0207647_10029287 | Ga0207647_100292872 | 214 |
| 334 | 3300025905 | Ga0207685_10009453 | Ga0207685_100094533 | 214 |
| 335 | 3300025907 | Ga0207645_10013709 | Ga0207645_100137095 | 214 |
| 336 | 3300025907 | Ga0207645_10038352 | Ga0207645_100383522 | 214 |
| 337 | 3300025907 | Ga0207645_10265210 | Ga0207645_102652101 | 214 |
| 338 | 3300025908 | Ga0207643_10003322 | Ga0207643_100033226 | 214 |
| 339 | 3300025908 | Ga0207643_10328033 | Ga0207643_103280332 | 214 |
| 340 | 3300025909 | Ga0207705_10012447 | Ga0207705_100124474 | 214 |
| 341 | 3300025909 | Ga0207705_10071909 | Ga0207705_100719092 | 214 |
| 342 | 3300025909 | Ga0207705_10137909 | Ga0207705_101379092 | 214 |
| 343 | 3300025911 | Ga0207654_10080201 | Ga0207654_100802014 | 214 |
| 344 | 3300025911 | Ga0207654_10126932 | Ga0207654_101269322 | 214 |
| 345 | 3300025911 | Ga0207654_10153447 | Ga0207654_101534471 | 214 |
| 346 | 3300025911 | Ga0207654_10211411 | Ga0207654_102114112 | 214 |
| 347 | 3300025911 | Ga0207654_10274196 | Ga0207654_102741962 | 214 |
| 348 | 3300025913 | Ga0207695_10003722 | Ga0207695_100037228 | 214 |
| 349 | 3300025913 | Ga0207695_10004423 | Ga0207695_1000442327 | 214 |
| 350 | 3300025913 | Ga0207695_10006828 | Ga0207695_1000682820 | 214 |
| 351 | 3300025913 | Ga0207695_10031401 | Ga0207695_100314012 | 214 |
| 352 | 3300025913 | Ga0207695_10070211 | Ga0207695_100702112 | 214 |
| 353 | 3300025914 | Ga0207671_10000037 | Ga0207671_1000003734 | 214 |
| 354 | 3300025914 | Ga0207671_10002300 | Ga0207671_100023002 | 214 |
| 355 | 3300025914 | Ga0207671_10373785 | Ga0207671_103737852 | 214 |
| 356 | 3300025915 | Ga0207693_10000325 | Ga0207693_100003257 | 214 |
| 357 | 3300025915 | Ga0207693_10064198 | Ga0207693_100641983 | 214 |
| 358 | 3300025916 | Ga0207663_10001645 | Ga0207663_1000164511 | 214 |
| 359 | 3300025918 | Ga0207662_10011038 | Ga0207662_100110382 | 214 |
| 360 | 3300025919 | Ga0207657_10035541 | Ga0207657_100355412 | 214 |
| 361 | 3300025920 | Ga0207649_10004472 | Ga0207649_100044722 | 214 |
| 362 | 3300025920 | Ga0207649_10065595 | Ga0207649_100655953 | 214 |
| 363 | 3300025920 | Ga0207649_10510067 | Ga0207649_105100672 | 214 |
| 364 | 3300025921 | Ga0207652_10247307 | Ga0207652_102473072 | 214 |
| 365 | 3300025922 | Ga0207646_10037033 | Ga0207646_100370332 | 214 |
| 366 | 3300025922 | Ga0207646_10120309 | Ga0207646_101203094 | 214 |
| 367 | 3300025922 | Ga0207646_10276750 | Ga0207646_102767502 | 214 |
| 368 | 3300025922 | Ga0207646_10294966 | Ga0207646_102949662 | 214 |
| 369 | 3300025923 | Ga0207681_10375181 | Ga0207681_103751811 | 214 |
| 370 | 3300025924 | Ga0207694_10042190 | Ga0207694_100421903 | 214 |
| 371 | 3300025924 | Ga0207694_10208215 | Ga0207694_102082152 | 214 |
| 372 | 3300025925 | Ga0207650_10088594 | Ga0207650_100885943 | 214 |
| 373 | 3300025925 | Ga0207650_10107882 | Ga0207650_101078824 | 214 |
| 374 | 3300025925 | Ga0207650_10170456 | Ga0207650_101704562 | 214 |
| 375 | 3300025925 | Ga0207650_10259718 | Ga0207650_102597182 | 214 |
| 376 | 3300025926 | Ga0207659_10010560 | Ga0207659_100105605 | 214 |
| 377 | 3300025926 | Ga0207659_10140884 | Ga0207659_101408843 | 214 |
| 378 | 3300025927 | Ga0207687_10002556 | Ga0207687_1000255620 | 214 |
| 379 | 3300025927 | Ga0207687_10103818 | Ga0207687_101038183 | 214 |
| 380 | 3300025927 | Ga0207687_10413500 | Ga0207687_104135002 | 214 |
| 381 | 3300025928 | Ga0207700_10010506 | Ga0207700_100105068 | 214 |
| 382 | 3300025929 | Ga0207664_10258077 | Ga0207664_102580772 | 214 |
| 383 | 3300025929 | Ga0207664_10300326 | Ga0207664_103003263 | 214 |
| 384 | 3300025931 | Ga0207644_10003120 | Ga0207644_1000312014 | 214 |
| 385 | 3300025931 | Ga0207644_10059832 | Ga0207644_100598324 | 214 |
| 386 | 3300025931 | Ga0207644_10585121 | Ga0207644_105851211 | 214 |
| 387 | 3300025932 | Ga0207690_10139991 | Ga0207690_101399912 | 214 |
| 388 | 3300025932 | Ga0207690_10296588 | Ga0207690_102965881 | 214 |
| 389 | 3300025933 | Ga0207706_10021523 | Ga0207706_100215234 | 214 |
| 390 | 3300025933 | Ga0207706_10035277 | Ga0207706_100352777 | 214 |
| 391 | 3300025933 | Ga0207706_10091789 | Ga0207706_100917892 | 214 |
| 392 | 3300025933 | Ga0207706_10122495 | Ga0207706_101224952 | 214 |
| 393 | 3300025934 | Ga0207686_10001142 | Ga0207686_1000114229 | 214 |
| 394 | 3300025934 | Ga0207686_10017354 | Ga0207686_100173542 | 214 |
| 395 | 3300025935 | Ga0207709_10123926 | Ga0207709_101239262 | 214 |
| 396 | 3300025936 | Ga0207670_10004331 | Ga0207670_100043316 | 214 |
| 397 | 3300025937 | Ga0207669_10007901 | Ga0207669_100079019 | 214 |
| 398 | 3300025937 | Ga0207669_10022493 | Ga0207669_100224932 | 214 |
| 399 | 3300025938 | Ga0207704_10057363 | Ga0207704_100573633 | 214 |
| 400 | 3300025939 | Ga0207665_10447370 | Ga0207665_104473702 | 214 |
| 401 | 3300025940 | Ga0207691_10009974 | Ga0207691_100099745 | 214 |
| 402 | 3300025940 | Ga0207691_10047774 | Ga0207691_100477743 | 214 |
| 403 | 3300025940 | Ga0207691_10060832 | Ga0207691_100608321 | 214 |
| 404 | 3300025940 | Ga0207691_10097780 | Ga0207691_100977802 | 214 |
| 405 | 3300025940 | Ga0207691_10105000 | Ga0207691_101050003 | 214 |
| 406 | 3300025940 | Ga0207691_10518885 | Ga0207691_105188852 | 214 |
| 407 | 3300025941 | Ga0207711_10000206 | Ga0207711_1000020660 | 214 |
| 408 | 3300025941 | Ga0207711_10041780 | Ga0207711_100417805 | 214 |
| 409 | 3300025941 | Ga0207711_10694106 | Ga0207711_106941062 | 214 |
| 410 | 3300025942 | Ga0207689_10000042 | Ga0207689_1000004210 | 214 |
| 411 | 3300025942 | Ga0207689_10034225 | Ga0207689_100342253 | 214 |
| 412 | 3300025942 | Ga0207689_10041601 | Ga0207689_100416012 | 214 |
| 413 | 3300025944 | Ga0207661_10108914 | Ga0207661_101089144 | 214 |
| 414 | 3300025945 | Ga0207679_10253958 | Ga0207679_102539583 | 214 |
| 415 | 3300025945 | Ga0207679_10416478 | Ga0207679_104164782 | 214 |
| 416 | 3300025949 | Ga0207667_10003980 | Ga0207667_1000398010 | 214 |
| 417 | 3300025949 | Ga0207667_10043195 | Ga0207667_100431955 | 214 |
| 418 | 3300025949 | Ga0207667_10117769 | Ga0207667_101177692 | 214 |
| 419 | 3300025960 | Ga0207651_10001984 | Ga0207651_100019843 | 214 |
| 420 | 3300025960 | Ga0207651_10313059 | Ga0207651_103130592 | 214 |
| 421 | 3300025961 | Ga0207712_10003603 | Ga0207712_100036036 | 214 |
| 422 | 3300025961 | Ga0207712_10007987 | Ga0207712_100079872 | 214 |
| 423 | 3300025961 | Ga0207712_10186473 | Ga0207712_101864732 | 214 |
| 424 | 3300025961 | Ga0207712_10307219 | Ga0207712_103072192 | 214 |
| 425 | 3300025972 | Ga0207668_10082092 | Ga0207668_100820922 | 214 |
| 426 | 3300025972 | Ga0207668_10141605 | Ga0207668_101416052 | 214 |
| 427 | 3300025972 | Ga0207668_10301551 | Ga0207668_103015511 | 214 |
| 428 | 3300025981 | Ga0207640_10000315 | Ga0207640_1000031511 | 214 |
| 429 | 3300025981 | Ga0207640_10012908 | Ga0207640_100129083 | 214 |
| 430 | 3300025981 | Ga0207640_10026979 | Ga0207640_100269794 | 214 |
| 431 | 3300025981 | Ga0207640_10205867 | Ga0207640_102058672 | 214 |
| 432 | 3300025986 | Ga0207658_10000035 | Ga0207658_1000003533 | 214 |
| 433 | 3300025986 | Ga0207658_10017499 | Ga0207658_100174996 | 214 |
| 434 | 3300025986 | Ga0207658_10030509 | Ga0207658_100305093 | 214 |
| 435 | 3300025986 | Ga0207658_10054823 | Ga0207658_100548234 | 214 |
| 436 | 3300025986 | Ga0207658_10253494 | Ga0207658_102534943 | 214 |
| 437 | 3300025986 | Ga0207658_10676543 | Ga0207658_106765431 | 214 |
| 438 | 3300025986 | Ga0207658_10700490 | Ga0207658_107004901 | 214 |
| 439 | 3300026023 | Ga0207677_10004097 | Ga0207677_1000409711 | 214 |
| 440 | 3300026023 | Ga0207677_10032562 | Ga0207677_100325623 | 214 |
| 441 | 3300026023 | Ga0207677_10089299 | Ga0207677_100892992 | 214 |
| 442 | 3300026023 | Ga0207677_10137262 | Ga0207677_101372623 | 214 |
| 443 | 3300026035 | Ga0207703_10001548 | Ga0207703_1000154810 | 214 |
| 444 | 3300026035 | Ga0207703_10001771 | Ga0207703_1000177120 | 214 |
| 445 | 3300026041 | Ga0207639_10006857 | Ga0207639_100068573 | 214 |
| 446 | 3300026041 | Ga0207639_10023140 | Ga0207639_100231402 | 214 |
| 447 | 3300026041 | Ga0207639_10108211 | Ga0207639_101082112 | 214 |
| 448 | 3300026041 | Ga0207639_10111387 | Ga0207639_101113874 | 214 |
| 449 | 3300026041 | Ga0207639_10193220 | Ga0207639_101932202 | 214 |
| 450 | 3300026041 | Ga0207639_10206112 | Ga0207639_102061123 | 214 |
| 451 | 3300026067 | Ga0207678_10259577 | Ga0207678_102595772 | 214 |
| 452 | 3300026067 | Ga0207678_10267074 | Ga0207678_102670743 | 214 |
| 453 | 3300026067 | Ga0207678_10396925 | Ga0207678_103969251 | 214 |
| 454 | 3300026067 | Ga0207678_10698709 | Ga0207678_106987091 | 214 |
| 455 | 3300026075 | Ga0207708_10038249 | Ga0207708_100382493 | 214 |
| 456 | 3300026078 | Ga0207702_10030647 | Ga0207702_100306475 | 214 |
| 457 | 3300026078 | Ga0207702_10074138 | Ga0207702_100741384 | 214 |
| 458 | 3300026078 | Ga0207702_10099904 | Ga0207702_100999043 | 214 |
| 459 | 3300026088 | Ga0207641_10005413 | Ga0207641_100054137 | 214 |
| 460 | 3300026088 | Ga0207641_10023799 | Ga0207641_100237995 | 214 |
| 461 | 3300026088 | Ga0207641_10207230 | Ga0207641_102072302 | 214 |
| 462 | 3300026088 | Ga0207641_10286084 | Ga0207641_102860842 | 214 |
| 463 | 3300026088 | Ga0207641_10521523 | Ga0207641_105215232 | 214 |
| 464 | 3300026088 | Ga0207641_10561490 | Ga0207641_105614901 | 214 |
| 465 | 3300026089 | Ga0207648_10001802 | Ga0207648_1000180218 | 214 |
| 466 | 3300026089 | Ga0207648_10038418 | Ga0207648_100384187 | 214 |
| 467 | 3300026089 | Ga0207648_10115237 | Ga0207648_101152372 | 214 |
| 468 | 3300026089 | Ga0207648_10116436 | Ga0207648_101164363 | 214 |
| 469 | 3300026095 | Ga0207676_10032664 | Ga0207676_100326644 | 214 |
| 470 | 3300026095 | Ga0207676_10119664 | Ga0207676_101196642 | 214 |
| 471 | 3300026095 | Ga0207676_10163635 | Ga0207676_101636353 | 214 |
| 472 | 3300026095 | Ga0207676_10208943 | Ga0207676_102089431 | 214 |
| 473 | 3300026095 | Ga0207676_10519215 | Ga0207676_105192152 | 214 |
| 474 | 3300026116 | Ga0207674_10002494 | Ga0207674_1000249412 | 214 |
| 475 | 3300026116 | Ga0207674_10002673 | Ga0207674_100026733 | 214 |
| 476 | 3300026118 | Ga0207675_100001457 | Ga0207675_10000145726 | 214 |
| 477 | 3300026118 | Ga0207675_100012967 | Ga0207675_1000129674 | 214 |
| 478 | 3300026118 | Ga0207675_100165849 | Ga0207675_1001658492 | 214 |
| 479 | 3300026118 | Ga0207675_100479577 | Ga0207675_1004795772 | 214 |
| 480 | 3300026121 | Ga0207683_10000671 | Ga0207683_1000067144 | 214 |
| 481 | 3300026121 | Ga0207683_10000805 | Ga0207683_1000080524 | 214 |
| 482 | 3300026121 | Ga0207683_10022091 | Ga0207683_100220917 | 214 |
| 483 | 3300026121 | Ga0207683_10037366 | Ga0207683_100373662 | 214 |
| 484 | 3300026142 | Ga0207698_10032964 | Ga0207698_100329642 | 214 |
| 485 | 3300026142 | Ga0207698_10150601 | Ga0207698_101506014 | 214 |
| 486 | 3300026142 | Ga0207698_10324180 | Ga0207698_103241802 | 214 |
| 487 | 3300027671 | Ga0209588_1017642 | Ga0209588_10176423 | 214 |
| 488 | 3300027876 | Ga0209974_10054267 | Ga0209974_100542672 | 214 |
| 489 | 3300027907 | Ga0207428_10000177 | Ga0207428_1000017721 | 214 |
| 490 | 3300027907 | Ga0207428_10057018 | Ga0207428_100570184 | 214 |
| 491 | 3300028379 | Ga0268266_10021020 | Ga0268266_100210205 | 214 |
| 492 | 3300028379 | Ga0268266_10153889 | Ga0268266_101538892 | 214 |
| 493 | 3300028379 | Ga0268266_10406490 | Ga0268266_104064902 | 214 |
| 494 | 3300028380 | Ga0268265_10014380 | Ga0268265_100143807 | 214 |
| 495 | 3300028380 | Ga0268265_10086581 | Ga0268265_100865814 | 214 |
| 496 | 3300028380 | Ga0268265_10314041 | Ga0268265_103140412 | 214 |
| 497 | 3300028381 | Ga0268264_10000781 | Ga0268264_1000078138 | 214 |
| 498 | 3300028381 | Ga0268264_10001973 | Ga0268264_1000197317 | 214 |
| 499 | 3300028381 | Ga0268264_10005556 | Ga0268264_100055564 | 214 |
| 500 | 3300028381 | Ga0268264_10046554 | Ga0268264_100465542 | 214 |
| 501 | 3300028381 | Ga0268264_10075190 | Ga0268264_100751902 | 214 |
| 502 | 3300028381 | Ga0268264_10129862 | Ga0268264_101298623 | 214 |
| 503 | 3300028381 | Ga0268264_10136761 | Ga0268264_101367613 | 214 |
| 504 | 3300028556 | Ga0265337_1013871 | Ga0265337_10138712 | 214 |
| 505 | 3300028666 | Ga0265336_10025031 | Ga0265336_100250313 | 214 |
| 506 | 3300028800 | Ga0265338_10041038 | Ga0265338_100410385 | 214 |
| 507 | 3300028800 | Ga0265338_10047050 | Ga0265338_100470503 | 214 |
| 508 | 3300029957 | Ga0265324_10008509 | Ga0265324_100085092 | 214 |
| 509 | 3300029957 | Ga0265324_10015980 | Ga0265324_100159803 | 214 |
| 510 | 3300031240 | Ga0265320_10016611 | Ga0265320_100166114 | 214 |
| 511 | 3300031251 | Ga0265327_10029520 | Ga0265327_100295202 | 214 |
| 512 | 3300031344 | Ga0265316_10108486 | Ga0265316_101084862 | 214 |
| 513 | 3300031711 | Ga0265314_10024247 | Ga0265314_100242472 | 214 |
| 514 | 3300031712 | Ga0265342_10194466 | Ga0265342_101944662 | 214 |
| 515 | 3300031730 | Ga0307516_10142021 | Ga0307516_101420211 | 214 |
| 516 | 3300031731 | Ga0307405_10013967 | Ga0307405_100139672 | 214 |
| 517 | 3300031824 | Ga0307413_10000419 | Ga0307413_1000041911 | 214 |
| 518 | 3300031852 | Ga0307410_10005053 | Ga0307410_100050533 | 214 |
| 519 | 3300031852 | Ga0307410_10326513 | Ga0307410_103265132 | 214 |
| 520 | 3300031901 | Ga0307406_10162675 | Ga0307406_101626752 | 214 |
| 521 | 3300031903 | Ga0307407_10010554 | Ga0307407_100105543 | 214 |
| 522 | 3300031911 | Ga0307412_10121479 | Ga0307412_101214792 | 214 |
| 523 | 3300031995 | Ga0307409_100017446 | Ga0307409_1000174462 | 214 |
| 524 | 3300031995 | Ga0307409_100044483 | Ga0307409_1000444833 | 214 |
| 525 | 3300032004 | Ga0307414_10004222 | Ga0307414_100042223 | 214 |
| 526 | 3300032005 | Ga0307411_10000976 | Ga0307411_1000097610 | 214 |
| 527 | 3300035083 | Ga0373926_0028696 | Ga0373926_0028696_855_1502 | 214 |
| 528 | 3300035084 | Ga0373928_0036873 | Ga0373928_0036873_215_862 | 214 |
| 529 | 3300035111 | Ga0373923_0001607 | Ga0373923_0001607_4421_5074 | 214 |
| 530 | 3300035112 | Ga0373932_0010037 | Ga0373932_0010037_33_680 | 214 |
| 531 | 3300035116 | Ga0373945_0019264 | Ga0373945_0019264_1575_2228 | 214 |
| 532 | 3300035118 | Ga0373954_0009331 | Ga0373954_0009331_3370_4023 | 214 |
| 533 | 3300035120 | Ga0373957_0021100 | Ga0373957_0021100_1387_2040 | 214 |
| 534 | 3300035172 | Ga0373955_0001122 | Ga0373955_0001122_4799_5452 | 214 |
| 535 | 3300035691 | Ga0373931_0007204 | Ga0373931_0007204_3167_3814 | 214 |
| 536 | 3300035691 | Ga0373931_0199590 | Ga0373931_0199590_212_865 | 214 |
| 537 | 3300035692 | Ga0373935_0472755 | Ga0373935_0472755_53_706 | 214 |
| 538 | 3300035724 | Ga0373933_0260264 | Ga0373933_0260264_279_932 | 214 |
| 539 | 3300035725 | Ga0373947_0008671 | Ga0373947_0008671_4778_5431 | 214 |
| 540 | 3300035725 | Ga0373947_0077549 | Ga0373947_0077549_803_1456 | 214 |
| 541 | 3300036401 | Ga0373937_0175992 | Ga0373937_0175992_1033_1677 | 214 |
| 542 | 3300036401 | Ga0373937_0367182 | Ga0373937_0367182_571_1224 | 214 |
| 543 | 3300037068 | Ga0373925_0011050 | Ga0373925_0011050_2123_2776 | 214 |
| 544 | 3300037068 | Ga0373925_0399798 | Ga0373925_0399798_402_1046 | 214 |
| 545 | 3300038443 | Ga0395901_0266020 | Ga0395901_0266020_771_1418 | 214 |
| 546 | 3300041501 | Ga0451845_0270843 | Ga0451845_0270843_2065_2715 | 214 |
| 547 | 3300041507 | Ga0451851_0924877 | Ga0451851_0924877_21_671 | 214 |
| 548 | 3300041509 | Ga0451843_0918627 | Ga0451843_0918627_626_1276 | 214 |
| 549 | 3300041512 | Ga0451853_2102187 | Ga0451853_2102187_294_944 | 214 |
| 550 | 3300042876 | Ga0451577_0001644 | Ga0451577_0001644_25468_26115 | 214 |
| 551 | 3300042876 | Ga0451577_0019299 | Ga0451577_0019299_821_1471 | 214 |
| 552 | 3300042876 | Ga0451577_0090372 | Ga0451577_0090372_966_1613 | 214 |
| 553 | 3300044536 | Ga0466988_0126519 | Ga0466988_0126519_529_1176 | 214 |
| 554 | 3300044656 | Ga0466969_0034122 | Ga0466969_0034122_1647_2294 | 214 |
| 555 | 3300044673 | Ga0453683_0000001 | Ga0453683_0000001_397583_398230 | 214 |
| 556 | 3300044684 | Ga0466966_0032201 | Ga0466966_0032201_163_810 | 214 |
| 557 | 3300044712 | Ga0453684_0030888 | Ga0453684_0030888_3989_4639 | 214 |
| 558 | 3300045051 | Ga0451576_0004852 | Ga0451576_0004852_3567_4217 | 214 |
| 559 | 3300045051 | Ga0451576_0023585 | Ga0451576_0023585_3263_3910 | 214 |
| 560 | 3300045051 | Ga0451576_0396355 | Ga0451576_0396355_408_1055 | 214 |
| 561 | 3300045051 | Ga0451576_0801066 | Ga0451576_0801066_169_816 | 214 |
| 562 | 3300046459 | Ga0495629_0030534 | Ga0495629_0030534_2925_3578 | 214 |
| 563 | 3300046459 | Ga0495629_0221763 | Ga0495629_0221763_437_1084 | 214 |
| 564 | 3300046462 | Ga0495651_0074188 | Ga0495651_0074188_1326_1979 | 214 |
| 565 | 3300046463 | Ga0495653_0086422 | Ga0495653_0086422_440_1093 | 214 |
| 566 | 3300046472 | Ga0495580_0106700 | Ga0495580_0106700_736_1389 | 214 |
| 567 | 3300046473 | Ga0495582_0010846 | Ga0495582_0010846_1518_2171 | 214 |
| 568 | 3300046473 | Ga0495582_0515502 | Ga0495582_0515502_11_664 | 214 |
| 569 | 3300046475 | Ga0495639_0001749 | Ga0495639_0001749_2133_2780 | 214 |
| 570 | 3300046475 | Ga0495639_0008129 | Ga0495639_0008129_1196_1849 | 214 |
| 571 | 3300046476 | Ga0495662_0063012 | Ga0495662_0063012_35_688 | 214 |
| 572 | 3300046477 | Ga0495664_0027013 | Ga0495664_0027013_607_1260 | 214 |
| 573 | 3300046499 | Ga0495594_0034587 | Ga0495594_0034587_684_1331 | 214 |
| 574 | 3300046514 | Ga0495618_0245372 | Ga0495618_0245372_161_808 | 214 |
| 575 | 3300046529 | Ga0495652_0346811 | Ga0495652_0346811_96_749 | 214 |
| 576 | 3300046535 | Ga0495586_0093022 | Ga0495586_0093022_277_930 | 214 |
| 577 | 3300046536 | Ga0495587_0011541 | Ga0495587_0011541_1078_1731 | 214 |
| 578 | 3300046539 | Ga0495621_0014825 | Ga0495621_0014825_647_1300 | 214 |
| 579 | 3300046539 | Ga0495621_0017826 | Ga0495621_0017826_490_1137 | 214 |
| 580 | 3300046539 | Ga0495621_0029129 | Ga0495621_0029129_680_1327 | 214 |
| 581 | 3300046543 | Ga0495645_0019130 | Ga0495645_0019130_103_756 | 214 |
| 582 | 3300046615 | Ga0495656_0002334 | Ga0495656_0002334_3299_3946 | 214 |
| 583 | 3300046664 | Ga0495659_0048431 | Ga0495659_0048431_742_1395 | 214 |
| 584 | 3300046674 | Ga0495588_0005354 | Ga0495588_0005354_2785_3432 | 214 |
| 585 | 3300046674 | Ga0495588_0015765 | Ga0495588_0015765_999_1646 | 214 |
| 586 | 3300046674 | Ga0495588_0239637 | Ga0495588_0239637_121_768 | 214 |
| 587 | 3300046675 | Ga0495657_0220648 | Ga0495657_0220648_409_1062 | 214 |
| 588 | 3300046678 | Ga0495599_0159261 | Ga0495599_0159261_10_663 | 214 |
| 589 | 3300046680 | Ga0495646_0151812 | Ga0495646_0151812_393_1046 | 214 |
| 590 | 3300046681 | Ga0495647_0004918 | Ga0495647_0004918_1827_2474 | 214 |
| 591 | 3300046681 | Ga0495647_0051944 | Ga0495647_0051944_399_1052 | 214 |
| 592 | 3300046683 | Ga0495658_0162085 | Ga0495658_0162085_303_950 | 214 |
| 593 | 3300046690 | Ga0495624_0201550 | Ga0495624_0201550_19_672 | 214 |
| 594 | 3300046691 | Ga0495670_0007312 | Ga0495670_0007312_3002_3649 | 214 |
| 595 | 3300046809 | Ga0495600_0009079 | Ga0495600_0009079_4507_5160 | 214 |
| 596 | 3300047315 | Ga0495581_0000884 | Ga0495581_0000884_6457_7110 | 214 |
| 597 | 3300047315 | Ga0495581_0093324 | Ga0495581_0093324_958_1605 | 214 |
| 598 | 3300047319 | Ga0495674_0297422 | Ga0495674_0297422_628_1281 | 214 |
| 599 | 3300047319 | Ga0495674_0338409 | Ga0495674_0338409_412_1065 | 214 |
| 600 | 3300047321 | Ga0495676_0023077 | Ga0495676_0023077_4360_5007 | 214 |
| 601 | 3300047322 | Ga0495680_0097145 | Ga0495680_0097145_1419_2072 | 214 |
| 602 | 3300047444 | Ga0495675_0066492 | Ga0495675_0066492_41_694 | 214 |
| 603 | 3300048903 | Ga0496100_0008854 | Ga0496100_0008854_2289_2936 | 214 |
| 604 | 3300048903 | Ga0496100_0095849 | Ga0496100_0095849_149_802 | 214 |
| 605 | 3300048903 | Ga0496100_0154433 | Ga0496100_0154433_263_916 | 214 |
| 606 | 3300048904 | Ga0496101_0006811 | Ga0496101_0006811_1938_2585 | 214 |
| 607 | 3300048905 | Ga0496102_0024354 | Ga0496102_0024354_1990_2637 | 214 |
| 608 | 3300048905 | Ga0496102_0299290 | Ga0496102_0299290_120_767 | 214 |
| 609 | 3300048905 | Ga0496102_0304204 | Ga0496102_0304204_172_825 | 214 |
| 610 | 3300048905 | Ga0496102_0864825 | Ga0496102_0864825_116_763 | 214 |
| 611 | 3300048906 | Ga0496103_0014115 | Ga0496103_0014115_2261_2908 | 214 |
| 612 | 3300048907 | Ga0496104_0008062 | Ga0496104_0008062_303_956 | 214 |
| 613 | 3300048908 | Ga0496105_0002846 | Ga0496105_0002846_9526_10173 | 214 |
| 614 | 3300048908 | Ga0496105_0007694 | Ga0496105_0007694_7507_8160 | 214 |
| 615 | 3300048909 | Ga0496106_0049828 | Ga0496106_0049828_737_1384 | 214 |
| 616 | 3300048909 | Ga0496106_0298797 | Ga0496106_0298797_16_669 | 214 |
| 617 | 3300048910 | Ga0496107_0109918 | Ga0496107_0109918_1219_1866 | 214 |
| 618 | 3300048910 | Ga0496107_0543856 | Ga0496107_0543856_122_775 | 214 |
| 619 | 3300048910 | Ga0496107_0642817 | Ga0496107_0642817_44_697 | 214 |
| 620 | 3300048911 | Ga0496108_0133437 | Ga0496108_0133437_183_836 | 214 |
| 621 | 3300048912 | Ga0496109_0052691 | Ga0496109_0052691_395_1048 | 214 |
| 622 | 3300048912 | Ga0496109_0463833 | Ga0496109_0463833_200_847 | 214 |
| 623 | 3300048913 | Ga0496110_0050474 | Ga0496110_0050474_1126_1773 | 214 |
| 624 | 3300048913 | Ga0496110_0076385 | Ga0496110_0076385_1826_2473 | 214 |
| 625 | 3300048914 | Ga0496111_0174964 | Ga0496111_0174964_657_1304 | 214 |
| 626 | 3300048915 | Ga0496112_0003976 | Ga0496112_0003976_5545_6198 | 214 |
| 627 | 3300048917 | Ga0496114_0036130 | Ga0496114_0036130_747_1400 | 214 |
| 628 | 3300048917 | Ga0496114_0065046 | Ga0496114_0065046_1079_1726 | 214 |
| 629 | 3300048917 | Ga0496114_0323851 | Ga0496114_0323851_319_966 | 214 |
| 630 | 3300048918 | Ga0496115_0016079 | Ga0496115_0016079_4769_5422 | 214 |
| 631 | 3300048919 | Ga0496116_0013262 | Ga0496116_0013262_2925_3581 | 214 |
| 632 | 3300048920 | Ga0496117_0007447 | Ga0496117_0007447_9782_10438 | 214 |
| 633 | 3300048921 | Ga0496118_0005503 | Ga0496118_0005503_3713_4369 | 214 |
| 634 | 3300049570 | Ga0501033_0094641 | Ga0501033_0094641_197_847 | 214 |
| 635 | 3300049823 | Ga0501044_0079154 | Ga0501044_0079154_1284_1949 | 214 |
| 636 | 3300050507 | nmdc:mga05p37_228905_c1 | nmdc:mga05p37_228905_c1_1009_1656 | 214 |
| 637 | 3300050510 | nmdc:mga06r32_178022_c1 | nmdc:mga06r32_178022_c1_757_1404 | 214 |
| 638 | 3300050511 | nmdc:mga08y16_134879_c1 | nmdc:mga08y16_134879_c1_1061_1708 | 214 |
| 639 | 3300050511 | nmdc:mga08y16_247782_c1 | nmdc:mga08y16_247782_c1_1088_1738 | 214 |
| 640 | 3300050511 | nmdc:mga08y16_2942_c1 | nmdc:mga08y16_2942_c1_1604_2251 | 214 |
| 641 | 3300050513 | nmdc:mga0rr50_177103_c1 | nmdc:mga0rr50_177103_c1_877_1524 | 214 |
| 642 | 3300050513 | nmdc:mga0rr50_425891_c1 | nmdc:mga0rr50_425891_c1_421_1071 | 214 |
| 643 | 3300050515 | nmdc:mga0a205_324629_c1 | nmdc:mga0a205_324629_c1_119_766 | 214 |
| 644 | 3300053085 | Ga0495619_0001956 | Ga0495619_0001956_4471_5124 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kgy-assembly1.cif.gz_B | crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution | 0.8593 | 1 | 214 |
| 3kgy-assembly1.cif.gz_B | crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution | 0.8479 | 1 | 214 |
| 2xw7-assembly1.cif.gz_B | structure of mycobacterium smegmatis putative reductase ms0308 | 0.7927 | 1 | 214 |
| 2xw7-assembly1.cif.gz_B | structure of mycobacterium smegmatis putative reductase ms0308 | 0.7813 | 1 | 214 |
| 3jtw-assembly1.cif.gz_A-2 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.7601 | 1 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3kgyB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8366 | 2 | 214 | 3.40.430.10 |
| 3kgyB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8101 | 2 | 214 | 3.40.430.10 |
| 2xw7B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7927 | 1 | 214 | 3.40.430.10 |
| 2xw7B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7813 | 1 | 214 | 3.40.430.10 |
| 3zutA01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7471 | 196 | 212 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536TPP6-F1-model_v4 | Dihydrofolate reductase | 0.9834 | 141 | 214 |
GO:0008703
GO:0009231 |
| AF-A0A533J7Y1-F1-model_v4 | deleted | 0.981 | 2 | 214 |
|
| AF-A0A536U3N6-F1-model_v4 | Dihydrofolate reductase | 0.9806 | 1 | 214 |
GO:0008703
GO:0009231 |
| AF-A0A546Y8P0-F1-model_v4 | Dihydrofolate reductase | 0.9793 | 1 | 214 |
GO:0008703
GO:0009231 |
| AF-A0A1E3EWY2-F1-model_v4 | deleted | 0.9782 | 1 | 214 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar