F472023

General Info

Members Datasets Scaffolds Average Seq Length
644 290 644 216

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100094264|Ga0068862_1000942642
Length 241
Sequence MMPDSDLSDKAQRGSVFRGTLWYLEVMAKLRVQSFGVSLDGFGAGTDQSLEYPLGKRGPELMEWFFPTRMFQTMHGQGDGESGTDNGIAEQGFAGIGAWILGRNMFGPVRGPWPDANWKGWWGDEPPYHAPVFVLTHHRRAPLPMAGGTEFHFVTGGIRDAYDRAMEAAGGLDVRVGGGVSTIRQYLQAGLIDELHLAVRPVLLGRGENLFQGLDLDALGYECGPFVPGERAVHMFLRQRA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
222 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
223 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
227 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
228 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 4.5
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022621 3300001979 Bacteria 2160
2 JGI24737J22298_10044449 3300001990 Bacteria 1358
3 JGI24735J21928_10021736 3300002067 Bacteria 1957
4 JGI25406J46586_10087553 3300003203 Bacteria 944
5 rootH2_10037647 3300003320 Bacteria 7156
6 Ga0065712_10161511 3300005290 Bacteria 1299
7 Ga0070658_10000960 3300005327 Bacteria 24674
8 Ga0070676_10009642 3300005328 Bacteria 5220
9 Ga0070690_100779805 3300005330 Bacteria 740
10 Ga0070670_100001648 3300005331 Bacteria 18088
11 Ga0070670_100009312 3300005331 Bacteria 8390
12 Ga0070670_100012745 3300005331 Bacteria 7195
13 Ga0070670_100061114 3300005331 Bacteria 3234
14 Ga0070677_10013217 3300005333 Bacteria 2883
15 Ga0068869_100003631 3300005334 Bacteria 9466
16 Ga0068869_100075175 3300005334 Bacteria 2509
17 Ga0068869_100253831 3300005334 Bacteria 1405
18 Ga0070666_10000883 3300005335 Bacteria 18203
19 Ga0070666_10011620 3300005335 Bacteria 5532
20 Ga0070666_10033401 3300005335 Bacteria 3404
21 Ga0070666_10146480 3300005335 Bacteria 1646
22 Ga0070666_10555969 3300005335 Bacteria 835
23 Ga0070680_100031707 3300005336 Bacteria 4249
24 Ga0070680_100112412 3300005336 Bacteria 2268
25 Ga0068868_100024734 3300005338 Bacteria 4559
26 Ga0068868_100044045 3300005338 Bacteria 3488
27 Ga0068868_100186069 3300005338 Bacteria 1725
28 Ga0070660_100005482 3300005339 Bacteria 8790
29 Ga0070660_100073845 3300005339 Bacteria 2667
30 Ga0070660_100400349 3300005339 Bacteria 1135
31 Ga0070660_100660730 3300005339 Bacteria 875
32 Ga0070689_100000405 3300005340 Bacteria 25370
33 Ga0070687_100049781 3300005343 Bacteria 2161
34 Ga0070687_100234630 3300005343 Bacteria 1131
35 Ga0070661_100002335 3300005344 Bacteria 13013
36 Ga0070661_100035283 3300005344 Bacteria 3631
37 Ga0070661_100207255 3300005344 Bacteria 1500
38 Ga0070661_100322795 3300005344 Bacteria 1206
39 Ga0070661_100592225 3300005344 Bacteria 896
40 Ga0070692_10290225 3300005345 Bacteria 995
41 Ga0070668_100033665 3300005347 Bacteria 3903
42 Ga0070668_100081514 3300005347 Bacteria 2537
43 Ga0070669_100149724 3300005353 Bacteria 1806
44 Ga0070669_100207865 3300005353 Bacteria 1543
45 Ga0070669_100213917 3300005353 Bacteria 1522
46 Ga0070675_100029260 3300005354 Bacteria 4441
47 Ga0070675_100492206 3300005354 Bacteria 1104
48 Ga0070671_100028890 3300005355 Bacteria 4569
49 Ga0070671_100257189 3300005355 Bacteria 1484
50 Ga0070671_100464423 3300005355 Bacteria 1087
51 Ga0070674_100000708 3300005356 Bacteria 16973
52 Ga0070674_100129232 3300005356 Bacteria 1881
53 Ga0070674_100259001 3300005356 Bacteria 1370
54 Ga0070673_100002708 3300005364 Bacteria 10862
55 Ga0070673_100373988 3300005364 Bacteria 1269
56 Ga0070673_100463812 3300005364 Bacteria 1141
57 Ga0070688_100002477 3300005365 Bacteria 9339
58 Ga0070659_100006550 3300005366 Bacteria 8411
59 Ga0070659_100069221 3300005366 Bacteria 2801
60 Ga0070659_100141592 3300005366 Bacteria 1958
61 Ga0070667_100000070 3300005367 Bacteria 126321
62 Ga0070667_100004034 3300005367 Bacteria 12425
63 Ga0070667_100007792 3300005367 Bacteria 8878
64 Ga0070667_100043123 3300005367 Bacteria 3786
65 Ga0070667_100144266 3300005367 Bacteria 2087
66 Ga0070667_100155755 3300005367 Bacteria 2009
67 Ga0070714_100000954 3300005435 Bacteria 20605
68 Ga0070714_100190455 3300005435 Bacteria 1871
69 Ga0070713_100034884 3300005436 Bacteria 4046
70 Ga0070713_100216895 3300005436 Bacteria 1734
71 Ga0070710_10005351 3300005437 Bacteria 6088
72 Ga0070701_10186042 3300005438 Bacteria 1219
73 Ga0070711_100002923 3300005439 Bacteria 9845
74 Ga0070705_100231817 3300005440 Bacteria 1285
75 Ga0070700_100040841 3300005441 Bacteria 2842
76 Ga0070663_100115168 3300005455 Bacteria 2025
77 Ga0070663_100227824 3300005455 Bacteria 1466
78 Ga0070678_100035786 3300005456 Bacteria 3470
79 Ga0070678_100908091 3300005456 Bacteria 805
80 Ga0070662_100020585 3300005457 Bacteria 4496
81 Ga0070662_100068743 3300005457 Bacteria 2605
82 Ga0070662_100205312 3300005457 Bacteria 1565
83 Ga0068867_100004004 3300005459 Bacteria 10362
84 Ga0068867_100044544 3300005459 Bacteria 3251
85 Ga0068867_100080291 3300005459 Bacteria 2456
86 Ga0068867_100129727 3300005459 Bacteria 1958
87 Ga0070685_10000781 3300005466 Bacteria 17262
88 Ga0070685_10054797 3300005466 Bacteria 2315
89 Ga0070707_100081984 3300005468 Bacteria 3115
90 Ga0070707_100368654 3300005468 Bacteria 1395
91 Ga0070679_100350049 3300005530 Bacteria 1425
92 Ga0070679_100432899 3300005530 Bacteria 1260
93 Ga0070684_100078053 3300005535 Bacteria 2925
94 Ga0070684_100100487 3300005535 Bacteria 2583
95 Ga0070697_100475732 3300005536 Bacteria 1090
96 Ga0068853_100012867 3300005539 Bacteria 6819
97 Ga0068853_100016601 3300005539 Bacteria 6062
98 Ga0068853_100261502 3300005539 Bacteria 1591
99 Ga0068853_100342657 3300005539 Bacteria 1389
100 Ga0070672_100029879 3300005543 Bacteria 4090
101 Ga0070672_100107727 3300005543 Bacteria 2268
102 Ga0070672_100174684 3300005543 Bacteria 1788
103 Ga0070672_100512162 3300005543 Bacteria 1039
104 Ga0070686_100009269 3300005544 Bacteria 5527
105 Ga0070696_100002515 3300005546 Bacteria 12139
106 Ga0070696_100027759 3300005546 Bacteria 3860
107 Ga0070696_100317235 3300005546 Bacteria 1198
108 Ga0070693_100004506 3300005547 Bacteria 6594
109 Ga0070693_100077002 3300005547 Bacteria 1978
110 Ga0070665_100012399 3300005548 Bacteria 8591
111 Ga0070665_100035492 3300005548 Bacteria 5014
112 Ga0070704_100296117 3300005549 Unclassified 1346
113 Ga0070704_100775592 3300005549 Bacteria 855
114 Ga0068855_100008716 3300005563 Bacteria 12261
115 Ga0068855_100033228 3300005563 Bacteria 6158
116 Ga0068855_100116020 3300005563 Bacteria 3069
117 Ga0070664_100005045 3300005564 Bacteria 10584
118 Ga0070664_100040329 3300005564 Bacteria 3935
119 Ga0070664_100388901 3300005564 Bacteria 1274
120 Ga0068857_100003573 3300005577 Bacteria 13005
121 Ga0068857_100004795 3300005577 Bacteria 11462
122 Ga0068857_100029378 3300005577 Bacteria 4851
123 Ga0068854_100000351 3300005578 Bacteria 29668
124 Ga0068854_100004788 3300005578 Bacteria 8535
125 Ga0068854_100018892 3300005578 Bacteria 4635
126 Ga0068854_100143794 3300005578 Bacteria 1833
127 Ga0068854_100239851 3300005578 Bacteria 1443
128 Ga0068854_100523802 3300005578 Bacteria 1002
129 Ga0068856_100016485 3300005614 Bacteria 7152
130 Ga0068856_100023023 3300005614 Bacteria 6056
131 Ga0068856_100071577 3300005614 Bacteria 3433
132 Ga0068856_100083131 3300005614 Bacteria 3179
133 Ga0068856_100099014 3300005614 Bacteria 2906
134 Ga0070702_100021363 3300005615 Bacteria 3404
135 Ga0068852_100024598 3300005616 Bacteria 4870
136 Ga0068852_100032787 3300005616 Bacteria 4305
137 Ga0068852_100034850 3300005616 Bacteria 4192
138 Ga0068852_100397247 3300005616 Bacteria 1355
139 Ga0068852_100434409 3300005616 Bacteria 1297
140 Ga0068852_100750496 3300005616 Bacteria 988
141 Ga0068859_100001347 3300005617 Bacteria 25058
142 Ga0068859_100009913 3300005617 Bacteria 9622
143 Ga0068859_100062429 3300005617 Bacteria 3756
144 Ga0068859_100077063 3300005617 Bacteria 3375
145 Ga0068864_100010584 3300005618 Bacteria 7626
146 Ga0068864_100017409 3300005618 Bacteria 5991
147 Ga0068864_100018003 3300005618 Bacteria 5895
148 Ga0068864_100035436 3300005618 Bacteria 4248
149 Ga0068866_10007029 3300005718 Bacteria 4705
150 Ga0068866_10074224 3300005718 Bacteria 1808
151 Ga0068861_100014002 3300005719 Bacteria 5623
152 Ga0068861_100087995 3300005719 Bacteria 2445
153 Ga0068861_100114982 3300005719 Bacteria 2161
154 Ga0068851_10006735 3300005834 Bacteria 5256
155 Ga0068851_10099648 3300005834 Bacteria 1540
156 Ga0068870_10009728 3300005840 Bacteria 4384
157 Ga0068870_10107234 3300005840 Bacteria 1589
158 Ga0068863_100013951 3300005841 Bacteria 7745
159 Ga0068863_100026288 3300005841 Bacteria 5553
160 Ga0068863_100374528 3300005841 Bacteria 1390
161 Ga0068863_100460961 3300005841 Bacteria 1248
162 Ga0068863_100605580 3300005841 Bacteria 1085
163 Ga0068858_100003331 3300005842 Bacteria 15997
164 Ga0068858_100036483 3300005842 Bacteria 4559
165 Ga0068858_100058263 3300005842 Bacteria 3571
166 Ga0068858_100860432 3300005842 Bacteria 886
167 Ga0068860_100006411 3300005843 Bacteria 11811
168 Ga0068860_100030495 3300005843 Bacteria 5186
169 Ga0068860_100031074 3300005843 Bacteria 5135
170 Ga0068860_100063672 3300005843 Bacteria 3502
171 Ga0068860_100086234 3300005843 Bacteria 2988
172 Ga0068860_100101809 3300005843 Bacteria 2740
173 Ga0068860_100243006 3300005843 Bacteria 1751
174 Ga0068862_100004281 3300005844 Bacteria 12075
175 Ga0068862_100036178 3300005844 Bacteria 4184
176 Ga0068862_100094264 3300005844 Bacteria 2611
177 Ga0081539_10003560 3300005985 Bacteria 18916
178 Ga0081539_10010113 3300005985 Bacteria 7739
179 Ga0070715_10054981 3300006163 Bacteria 1726
180 Ga0070715_10196118 3300006163 Bacteria 1023
181 Ga0070712_100016494 3300006175 Bacteria 4774
182 Ga0070712_100809659 3300006175 Bacteria 804
183 Ga0097621_100026284 3300006237 Bacteria 4564
184 Ga0097621_100037602 3300006237 Bacteria 3880
185 Ga0068871_100029400 3300006358 Bacteria 4316
186 Ga0068871_100064326 3300006358 Bacteria 3003
187 Ga0068871_100092803 3300006358 Bacteria 2518
188 Ga0068871_100108507 3300006358 Bacteria 2333
189 Ga0075430_100924021 3300006846 Bacteria 719
190 Ga0075433_10346127 3300006852 Bacteria 1314
191 Ga0068865_100038324 3300006881 Bacteria 3243
192 Ga0068865_100048848 3300006881 Bacteria 2914
193 Ga0068865_100147208 3300006881 Bacteria 1783
194 Ga0097620_100001347 3300006931 Bacteria 25058
195 Ga0097620_100009913 3300006931 Bacteria 9622
196 Ga0097620_100062426 3300006931 Bacteria 3756
197 Ga0097620_100077064 3300006931 Bacteria 3375
198 Ga0097620_100122140 3300006931 Bacteria 2671
199 Ga0075435_100067875 3300007076 Bacteria 2904
200 Ga0075435_100315408 3300007076 Bacteria 1338
201 Ga0075435_100582374 3300007076 Bacteria 970
202 Ga0099794_10016035 3300007265 Bacteria 3316
203 Ga0105244_10004531 3300009036 Bacteria 9527
204 Ga0105240_10003598 3300009093 Bacteria 24007
205 Ga0105240_10015820 3300009093 Bacteria 10235
206 Ga0105240_10040583 3300009093 Bacteria 5950
207 Ga0105240_10090577 3300009093 Bacteria 3738
208 Ga0105240_10104545 3300009093 Bacteria 3439
209 Ga0105240_10301933 3300009093 Bacteria 1831
210 Ga0111539_10006635 3300009094 Bacteria 14908
211 Ga0111539_10033069 3300009094 Bacteria 6279
212 Ga0111539_10055709 3300009094 Unclassified 4700
213 Ga0105245_10001706 3300009098 Bacteria 20010
214 Ga0105245_10004524 3300009098 Bacteria 12279
215 Ga0105245_10128767 3300009098 Bacteria 2372
216 Ga0105247_10001753 3300009101 Bacteria 15274
217 Ga0105247_10003347 3300009101 Bacteria 10492
218 Ga0105247_10006032 3300009101 Bacteria 7538
219 Ga0114129_10246825 3300009147 Bacteria 2398
220 Ga0105243_10019788 3300009148 Bacteria 5103
221 Ga0105241_10032952 3300009174 Bacteria 3886
222 Ga0105241_10053418 3300009174 Bacteria 3089
223 Ga0105241_10326953 3300009174 Bacteria 1324
224 Ga0105241_10399357 3300009174 Bacteria 1205
225 Ga0105241_10410591 3300009174 Bacteria 1190
226 Ga0105241_10616428 3300009174 Bacteria 982
227 Ga0105242_10006602 3300009176 Bacteria 8936
228 Ga0105242_10026457 3300009176 Bacteria 4599
229 Ga0105248_10003961 3300009177 Bacteria 16379
230 Ga0105248_10007310 3300009177 Bacteria 12118
231 Ga0105248_10032837 3300009177 Bacteria 5799
232 Ga0105248_10081849 3300009177 Bacteria 3629
233 Ga0105248_10283874 3300009177 Bacteria 1864
234 Ga0105237_10000568 3300009545 Bacteria 51589
235 Ga0105237_10013037 3300009545 Bacteria 8728
236 Ga0105237_10150764 3300009545 Bacteria 2322
237 Ga0105237_10378771 3300009545 Bacteria 1420
238 Ga0105237_11062671 3300009545 Bacteria 816
239 Ga0105238_10003097 3300009551 Bacteria 16583
240 Ga0105238_10014903 3300009551 Bacteria 7866
241 Ga0105238_10022895 3300009551 Bacteria 6369
242 Ga0105238_10159418 3300009551 Bacteria 2232
243 Ga0105238_10315307 3300009551 Bacteria 1549
244 Ga0105238_10512987 3300009551 Bacteria 1201
245 Ga0105249_10022284 3300009553 Bacteria 5674
246 Ga0105249_10039088 3300009553 Bacteria 4307
247 Ga0105249_10688461 3300009553 Bacteria 1082
248 Ga0105249_10858970 3300009553 Bacteria 973
249 Ga0105239_10007023 3300010375 Bacteria 12960
250 Ga0105239_10025591 3300010375 Bacteria 6497
251 Ga0105239_10112639 3300010375 Bacteria 3016
252 Ga0105239_10230480 3300010375 Bacteria 2078
253 Ga0105239_10279455 3300010375 Bacteria 1879
254 Ga0105246_10030657 3300011119 Bacteria 3553
255 Ga0157314_1000326 3300012500 Bacteria 5014
256 Ga0157373_10012155 3300013100 Bacteria 6329
257 Ga0157373_10084243 3300013100 Bacteria 2241
258 Ga0157373_10243308 3300013100 Bacteria 1272
259 Ga0157371_10062807 3300013102 Bacteria 2632
260 Ga0157370_10060564 3300013104 Bacteria 3594
261 Ga0157369_10003187 3300013105 Bacteria 19569
262 Ga0157369_10168551 3300013105 Bacteria 2308
263 Ga0157369_10652521 3300013105 Bacteria 1085
264 Ga0157374_10019920 3300013296 Bacteria 5946
265 Ga0157374_10192892 3300013296 Unclassified 1993
266 Ga0157374_10560234 3300013296 Bacteria 1151
267 Ga0157378_10020320 3300013297 Bacteria 5841
268 Ga0157378_10062016 3300013297 Bacteria 3338
269 Ga0157378_10521596 3300013297 Bacteria 1190
270 Ga0163162_10005971 3300013306 Bacteria 11787
271 Ga0163162_10024462 3300013306 Bacteria 5962
272 Ga0163162_10058014 3300013306 Bacteria 3899
273 Ga0163162_10088120 3300013306 Bacteria 3183
274 Ga0163162_10112768 3300013306 Bacteria 2818
275 Ga0163162_10136794 3300013306 Bacteria 2561
276 Ga0157372_10002205 3300013307 Bacteria 21152
277 Ga0157372_10008580 3300013307 Bacteria 10859
278 Ga0157372_11238964 3300013307 Bacteria 862
279 Ga0157375_10005247 3300013308 Bacteria 11248
280 Ga0157375_10037335 3300013308 Bacteria 4654
281 Ga0157375_10038253 3300013308 Bacteria 4606
282 Ga0157375_10184938 3300013308 Bacteria 2236
283 Ga0157375_10513323 3300013308 Unclassified 1362
284 Ga0157375_10792393 3300013308 Unclassified 1097
285 Ga0157375_11447407 3300013308 Bacteria 810
286 Ga0163163_10000419 3300014325 Bacteria 39366
287 Ga0163163_10008697 3300014325 Bacteria 9030
288 Ga0163163_10104973 3300014325 Bacteria 2851
289 Ga0163163_10117183 3300014325 Bacteria 2695
290 Ga0157380_10006058 3300014326 Bacteria 8473
291 Ga0182008_10009166 3300014497 Bacteria 5354
292 Ga0157379_10000468 3300014968 Bacteria 32782
293 Ga0157379_10002075 3300014968 Bacteria 16642
294 Ga0157379_10026687 3300014968 Bacteria 5141
295 Ga0157376_10001151 3300014969 Bacteria 17372
296 Ga0157376_10015295 3300014969 Bacteria 5793
297 Ga0157376_10063420 3300014969 Bacteria 3113
298 Ga0157376_10305672 3300014969 Bacteria 1507
299 Ga0157376_10948747 3300014969 Bacteria 881
300 Ga0182006_1039066 3300015261 Bacteria 1875
301 Ga0182007_10003164 3300015262 Bacteria 7886
302 Ga0182005_1009509 3300015265 Bacteria 2828
303 Ga0163161_10026834 3300017792 Bacteria 4083
304 Ga0163161_10030598 3300017792 Bacteria 3833
305 Ga0163161_10115289 3300017792 Bacteria 2013
306 Ga0163161_10171649 3300017792 Bacteria 1658
307 Ga0163161_10331662 3300017792 Bacteria 1205
308 Ga0209758_1050042 3300025297 Bacteria 1469
309 Ga0207697_10027886 3300025315 Bacteria 2308
310 Ga0207697_10135798 3300025315 Bacteria 1065
311 Ga0207655_1015566 3300025728 Bacteria 4217
312 Ga0207682_10020033 3300025893 Bacteria 2623
313 Ga0207692_10156829 3300025898 Bacteria 1308
314 Ga0207642_10025498 3300025899 Bacteria 2393
315 Ga0207642_10106899 3300025899 Bacteria 1417
316 Ga0207710_10003077 3300025900 Bacteria 7493
317 Ga0207710_10101516 3300025900 Bacteria 1357
318 Ga0207688_10272398 3300025901 Bacteria 1030
319 Ga0207680_10000440 3300025903 Bacteria 19637
320 Ga0207680_10019916 3300025903 Bacteria 3599
321 Ga0207680_10023317 3300025903 Bacteria 3378
322 Ga0207680_10100749 3300025903 Bacteria 1855
323 Ga0207680_10154888 3300025903 Bacteria 1531
324 Ga0207680_10172638 3300025903 Bacteria 1457
325 Ga0207647_10029287 3300025904 Bacteria 3565
326 Ga0207685_10009453 3300025905 Bacteria 2833
327 Ga0207645_10013709 3300025907 Bacteria 5448
328 Ga0207645_10038352 3300025907 Bacteria 3073
329 Ga0207645_10265210 3300025907 Bacteria 1138
330 Ga0207643_10003322 3300025908 Bacteria 8671
331 Ga0207643_10328033 3300025908 Bacteria 957
332 Ga0207705_10012447 3300025909 Bacteria 6145
333 Ga0207705_10071909 3300025909 Bacteria 2508
334 Ga0207705_10137909 3300025909 Bacteria 1820
335 Ga0207654_10080201 3300025911 Bacteria 1962
336 Ga0207654_10126932 3300025911 Bacteria 1610
337 Ga0207654_10153447 3300025911 Bacteria 1481
338 Ga0207654_10211411 3300025911 Bacteria 1282
339 Ga0207654_10274196 3300025911 Bacteria 1139
340 Ga0207695_10003722 3300025913 Bacteria 21227
341 Ga0207695_10004423 3300025913 Bacteria 19193
342 Ga0207695_10006828 3300025913 Bacteria 14698
343 Ga0207695_10031401 3300025913 Bacteria 5825
344 Ga0207695_10070211 3300025913 Bacteria 3582
345 Ga0207671_10000037 3300025914 Bacteria 230395
346 Ga0207671_10002300 3300025914 Bacteria 20631
347 Ga0207671_10373785 3300025914 Bacteria 1132
348 Ga0207693_10000325 3300025915 Bacteria 44161
349 Ga0207693_10064198 3300025915 Bacteria 2876
350 Ga0207663_10001645 3300025916 Bacteria 10535
351 Ga0207662_10011038 3300025918 Bacteria 4999
352 Ga0207657_10035541 3300025919 Bacteria 4467
353 Ga0207657_10370933 3300025919 Bacteria 1128
354 Ga0207649_10004472 3300025920 Bacteria 7587
355 Ga0207649_10065595 3300025920 Bacteria 2299
356 Ga0207649_10510067 3300025920 Bacteria 916
357 Ga0207652_10247307 3300025921 Bacteria 1608
358 Ga0207646_10037033 3300025922 Bacteria 4400
359 Ga0207646_10120309 3300025922 Bacteria 2359
360 Ga0207646_10276750 3300025922 Bacteria 1517
361 Ga0207646_10294966 3300025922 Bacteria 1465
362 Ga0207681_10042262 3300025923 Bacteria 3044
363 Ga0207681_10375181 3300025923 Bacteria 1144
364 Ga0207694_10042190 3300025924 Bacteria 3518
365 Ga0207694_10208215 3300025924 Bacteria 1593
366 Ga0207650_10088594 3300025925 Bacteria 2360
367 Ga0207650_10107882 3300025925 Bacteria 2151
368 Ga0207650_10170456 3300025925 Bacteria 1729
369 Ga0207650_10259718 3300025925 Bacteria 1409
370 Ga0207659_10010560 3300025926 Bacteria 5807
371 Ga0207659_10140884 3300025926 Bacteria 1872
372 Ga0207687_10002556 3300025927 Bacteria 12360
373 Ga0207687_10103818 3300025927 Bacteria 2097
374 Ga0207687_10413500 3300025927 Bacteria 1112
375 Ga0207700_10010506 3300025928 Bacteria 5846
376 Ga0207664_10258077 3300025929 Bacteria 1523
377 Ga0207664_10300326 3300025929 Bacteria 1412
378 Ga0207644_10003120 3300025931 Bacteria 10665
379 Ga0207644_10059832 3300025931 Bacteria 2756
380 Ga0207644_10585121 3300025931 Bacteria 926
381 Ga0207690_10139991 3300025932 Bacteria 1782
382 Ga0207690_10296588 3300025932 Bacteria 1264
383 Ga0207706_10021523 3300025933 Bacteria 5789
384 Ga0207706_10035277 3300025933 Bacteria 4447
385 Ga0207706_10091789 3300025933 Bacteria 2670
386 Ga0207706_10122495 3300025933 Bacteria 2287
387 Ga0207686_10001142 3300025934 Bacteria 15331
388 Ga0207686_10017354 3300025934 Bacteria 4055
389 Ga0207709_10123926 3300025935 Bacteria 1750
390 Ga0207670_10004331 3300025936 Bacteria 7625
391 Ga0207669_10007901 3300025937 Bacteria 4959
392 Ga0207669_10022493 3300025937 Bacteria 3350
393 Ga0207704_10057363 3300025938 Bacteria 2392
394 Ga0207665_10447370 3300025939 Bacteria 991
395 Ga0207691_10009974 3300025940 Bacteria 9123
396 Ga0207691_10047774 3300025940 Bacteria 3926
397 Ga0207691_10060832 3300025940 Bacteria 3431
398 Ga0207691_10097780 3300025940 Bacteria 2623
399 Ga0207691_10105000 3300025940 Bacteria 2517
400 Ga0207691_10518885 3300025940 Bacteria 1011
401 Ga0207711_10000206 3300025941 Bacteria 62928
402 Ga0207711_10041780 3300025941 Bacteria 3905
403 Ga0207711_10694106 3300025941 Bacteria 949
404 Ga0207689_10000042 3300025942 Bacteria 93077
405 Ga0207689_10034225 3300025942 Bacteria 4219
406 Ga0207689_10041601 3300025942 Bacteria 3803
407 Ga0207661_10108914 3300025944 Bacteria 2340
408 Ga0207679_10253958 3300025945 Bacteria 1496
409 Ga0207679_10416478 3300025945 Bacteria 1185
410 Ga0207667_10003980 3300025949 Bacteria 18160
411 Ga0207667_10043195 3300025949 Bacteria 4784
412 Ga0207667_10117769 3300025949 Bacteria 2737
413 Ga0207651_10001984 3300025960 Bacteria 9623
414 Ga0207651_10313059 3300025960 Bacteria 1310
415 Ga0207712_10003603 3300025961 Bacteria 9769
416 Ga0207712_10007987 3300025961 Bacteria 6690
417 Ga0207712_10186473 3300025961 Bacteria 1634
418 Ga0207712_10307219 3300025961 Bacteria 1304
419 Ga0207668_10082092 3300025972 Bacteria 2340
420 Ga0207668_10141605 3300025972 Bacteria 1850
421 Ga0207668_10301551 3300025972 Bacteria 1322
422 Ga0207640_10000315 3300025981 Bacteria 32394
423 Ga0207640_10012908 3300025981 Bacteria 4772
424 Ga0207640_10026979 3300025981 Bacteria 3495
425 Ga0207640_10205867 3300025981 Bacteria 1495
426 Ga0207658_10000035 3300025986 Bacteria 154818
427 Ga0207658_10017499 3300025986 Bacteria 4940
428 Ga0207658_10030509 3300025986 Bacteria 3818
429 Ga0207658_10054823 3300025986 Bacteria 2951
430 Ga0207658_10253494 3300025986 Bacteria 1496
431 Ga0207658_10676543 3300025986 Bacteria 931
432 Ga0207658_10700490 3300025986 Bacteria 915
433 Ga0207677_10004097 3300026023 Bacteria 7795
434 Ga0207677_10032562 3300026023 Bacteria 3353
435 Ga0207677_10089299 3300026023 Bacteria 2237
436 Ga0207677_10137262 3300026023 Bacteria 1867
437 Ga0207703_10001548 3300026035 Bacteria 20841
438 Ga0207703_10001771 3300026035 Bacteria 19284
439 Ga0207639_10006857 3300026041 Bacteria 7761
440 Ga0207639_10023140 3300026041 Bacteria 4484
441 Ga0207639_10108211 3300026041 Bacteria 2260
442 Ga0207639_10111387 3300026041 Bacteria 2231
443 Ga0207639_10193220 3300026041 Bacteria 1740
444 Ga0207639_10206112 3300026041 Bacteria 1690
445 Ga0207678_10259577 3300026067 Bacteria 1489
446 Ga0207678_10267074 3300026067 Bacteria 1467
447 Ga0207678_10396925 3300026067 Bacteria 1194
448 Ga0207678_10698709 3300026067 Bacteria 892
449 Ga0207708_10038249 3300026075 Bacteria 3655
450 Ga0207702_10030647 3300026078 Bacteria 4481
451 Ga0207702_10074138 3300026078 Bacteria 2937
452 Ga0207702_10099904 3300026078 Bacteria 2559
453 Ga0207641_10005413 3300026088 Bacteria 10900
454 Ga0207641_10023799 3300026088 Bacteria 5047
455 Ga0207641_10207230 3300026088 Bacteria 1811
456 Ga0207641_10286084 3300026088 Bacteria 1552
457 Ga0207641_10435132 3300026088 Bacteria 1265
458 Ga0207641_10521523 3300026088 Unclassified 1156
459 Ga0207641_10561490 3300026088 Bacteria 1114
460 Ga0207648_10001802 3300026089 Bacteria 23480
461 Ga0207648_10038418 3300026089 Bacteria 4212
462 Ga0207648_10115237 3300026089 Bacteria 2361
463 Ga0207648_10116436 3300026089 Bacteria 2349
464 Ga0207676_10032664 3300026095 Bacteria 3924
465 Ga0207676_10119664 3300026095 Bacteria 2218
466 Ga0207676_10163635 3300026095 Bacteria 1930
467 Ga0207676_10208943 3300026095 Bacteria 1730
468 Ga0207676_10519215 3300026095 Bacteria 1134
469 Ga0207674_10002494 3300026116 Bacteria 23211
470 Ga0207674_10002673 3300026116 Bacteria 22237
471 Ga0207675_100001457 3300026118 Bacteria 23724
472 Ga0207675_100012967 3300026118 Bacteria 7783
473 Ga0207675_100165849 3300026118 Bacteria 2109
474 Ga0207675_100479577 3300026118 Bacteria 1236
475 Ga0207683_10000671 3300026121 Bacteria 31464
476 Ga0207683_10000805 3300026121 Bacteria 28690
477 Ga0207683_10022091 3300026121 Bacteria 5460
478 Ga0207683_10037366 3300026121 Bacteria 4228
479 Ga0207698_10032964 3300026142 Bacteria 3758
480 Ga0207698_10150601 3300026142 Bacteria 2018
481 Ga0207698_10324180 3300026142 Bacteria 1444
482 Ga0209588_1017642 3300027671 Bacteria 2214
483 Ga0209966_1011891 3300027695 Bacteria 1591
484 Ga0209974_10054267 3300027876 Bacteria 1350
485 Ga0207428_10000177 3300027907 Bacteria 89397
486 Ga0207428_10057018 3300027907 Bacteria 3102
487 Ga0268266_10021020 3300028379 Bacteria 5563
488 Ga0268266_10153889 3300028379 Bacteria 2075
489 Ga0268266_10406490 3300028379 Bacteria 1288
490 Ga0268265_10014380 3300028380 Bacteria 5392
491 Ga0268265_10086581 3300028380 Bacteria 2490
492 Ga0268265_10314041 3300028380 Unclassified 1416
493 Ga0268264_10000781 3300028381 Bacteria 34982
494 Ga0268264_10001973 3300028381 Bacteria 18439
495 Ga0268264_10005556 3300028381 Bacteria 10685
496 Ga0268264_10046554 3300028381 Bacteria 3602
497 Ga0268264_10075190 3300028381 Bacteria 2872
498 Ga0268264_10129862 3300028381 Bacteria 2232
499 Ga0268264_10136761 3300028381 Bacteria 2179
500 Ga0265337_1013871 3300028556 Bacteria 2688
501 Ga0265336_10025031 3300028666 Bacteria 1881
502 Ga0265338_10041038 3300028800 Bacteria 4334
503 Ga0265338_10047050 3300028800 Bacteria 3944
504 Ga0265324_10008509 3300029957 Bacteria 4072
505 Ga0265324_10015980 3300029957 Bacteria 2753
506 Ga0265320_10016611 3300031240 Bacteria 4119
507 Ga0265327_10029520 3300031251 Bacteria 3118
508 Ga0265316_10108486 3300031344 Bacteria 2104
509 Ga0265314_10024247 3300031711 Bacteria 4602
510 Ga0265342_10194466 3300031712 Bacteria 1105
511 Ga0307516_10142021 3300031730 Bacteria 2169
512 Ga0307405_10013967 3300031731 Bacteria 4303
513 Ga0307413_10000419 3300031824 Bacteria 13717
514 Ga0307410_10005053 3300031852 Bacteria 6932
515 Ga0307410_10326513 3300031852 Bacteria 1219
516 Ga0307406_10162675 3300031901 Bacteria 1606
517 Ga0307407_10010554 3300031903 Bacteria 4363
518 Ga0307412_10121479 3300031911 Bacteria 1881
519 Ga0307409_100017446 3300031995 Bacteria 4786
520 Ga0307409_100044483 3300031995 Bacteria 3344
521 Ga0307414_10004222 3300032004 Bacteria 7783
522 Ga0307411_10000976 3300032005 Bacteria 10986
523 Ga0373926_0028696 3300035083 Unclassified 1954
524 Ga0373928_0036873 3300035084 Bacteria 1107
525 Ga0373923_0001607 3300035111 Bacteria 6585
526 Ga0373932_0010037 3300035112 Bacteria 2285
527 Ga0373939_0006137 3300035114 Bacteria 2889
528 Ga0373945_0019264 3300035116 Bacteria 2329
529 Ga0373954_0009331 3300035118 Bacteria 4316
530 Ga0373957_0021100 3300035120 Bacteria 2308
531 Ga0373955_0001122 3300035172 Bacteria 11355
532 Ga0373931_0007204 3300035691 Bacteria 5235
533 Ga0373931_0199590 3300035691 Bacteria 1194
534 Ga0373935_0472755 3300035692 Bacteria 907
535 Ga0373933_0260264 3300035724 Bacteria 1118
536 Ga0373947_0008671 3300035725 Bacteria 5850
537 Ga0373947_0077549 3300035725 Bacteria 2049
538 Ga0373937_0151265 3300036401 Bacteria 2174
539 Ga0373937_0175992 3300036401 Bacteria 2009
540 Ga0373937_0367182 3300036401 Bacteria 1364
541 Ga0373925_0011050 3300037068 Bacteria 6557
542 Ga0373925_0399798 3300037068 Bacteria 1120
543 Ga0395901_0266020 3300038443 Bacteria 1784
544 Ga0451845_0270843 3300041501 Unclassified 2954
545 Ga0451851_0924877 3300041507 Bacteria 1230
546 Ga0451843_0918627 3300041509 Bacteria 1771
547 Ga0451853_2102187 3300041512 Bacteria 1086
548 Ga0451577_0001644 3300042876 Bacteria 28947
549 Ga0451577_0019299 3300042876 Bacteria 6270
550 Ga0451577_0090372 3300042876 Bacteria 2733
551 Ga0466988_0126519 3300044536 Bacteria 1501
552 Ga0466969_0034122 3300044656 Bacteria 2579
553 Ga0453683_0000001 3300044673 Bacteria 1384965
554 Ga0466966_0032201 3300044684 Bacteria 3399
555 Ga0453684_0030888 3300044712 Bacteria 7552
556 Ga0451576_0004852 3300045051 Bacteria 17226
557 Ga0451576_0023585 3300045051 Bacteria 6661
558 Ga0451576_0396355 3300045051 Bacteria 1447
559 Ga0451576_0801066 3300045051 Bacteria 989
560 Ga0495629_0030534 3300046459 Bacteria 3819
561 Ga0495629_0221763 3300046459 Bacteria 1304
562 Ga0495651_0074188 3300046462 Bacteria 2582
563 Ga0495653_0086422 3300046463 Bacteria 2305
564 Ga0495580_0106700 3300046472 Bacteria 1945
565 Ga0495582_0010846 3300046473 Bacteria 5014
566 Ga0495582_0515502 3300046473 Bacteria 691
567 Ga0495639_0001749 3300046475 Bacteria 9638
568 Ga0495639_0008129 3300046475 Bacteria 4505
569 Ga0495662_0063012 3300046476 Bacteria 1791
570 Ga0495664_0027013 3300046477 Bacteria 3345
571 Ga0495594_0034587 3300046499 Bacteria 2749
572 Ga0495618_0245372 3300046514 Bacteria 1125
573 Ga0495652_0346811 3300046529 Bacteria 1065
574 Ga0495586_0093022 3300046535 Bacteria 1667
575 Ga0495587_0011541 3300046536 Bacteria 5594
576 Ga0495621_0014825 3300046539 Bacteria 2475
577 Ga0495621_0017826 3300046539 Bacteria 2300
578 Ga0495621_0029129 3300046539 Bacteria 1881
579 Ga0495645_0019130 3300046543 Bacteria 4930
580 Ga0495656_0002334 3300046615 Bacteria 6276
581 Ga0495659_0048431 3300046664 Bacteria 1540
582 Ga0495588_0005354 3300046674 Bacteria 5705
583 Ga0495588_0015765 3300046674 Bacteria 3644
584 Ga0495588_0239637 3300046674 Bacteria 957
585 Ga0495657_0220648 3300046675 Bacteria 1149
586 Ga0495599_0159261 3300046678 Bacteria 1396
587 Ga0495646_0151812 3300046680 Bacteria 1288
588 Ga0495647_0004918 3300046681 Bacteria 4373
589 Ga0495647_0051944 3300046681 Bacteria 1594
590 Ga0495658_0162085 3300046683 Bacteria 1380
591 Ga0495624_0201550 3300046690 Bacteria 1209
592 Ga0495670_0007312 3300046691 Bacteria 5427
593 Ga0495600_0009079 3300046809 Bacteria 6132
594 Ga0495581_0000884 3300047315 Bacteria 16023
595 Ga0495581_0093324 3300047315 Bacteria 1747
596 Ga0495674_0297422 3300047319 Bacteria 1319
597 Ga0495674_0338409 3300047319 Bacteria 1223
598 Ga0495676_0023077 3300047321 Bacteria 5404
599 Ga0495680_0097145 3300047322 Bacteria 2199
600 Ga0495675_0066492 3300047444 Bacteria 2279
601 Ga0495614_0376891 3300048089 Bacteria 664
602 Ga0496100_0008854 3300048903 Bacteria 5630
603 Ga0496100_0095849 3300048903 Bacteria 2035
604 Ga0496100_0154433 3300048903 Bacteria 1640
605 Ga0496101_0006811 3300048904 Bacteria 7371
606 Ga0496102_0024354 3300048905 Bacteria 5381
607 Ga0496102_0299290 3300048905 Bacteria 1516
608 Ga0496102_0304204 3300048905 Bacteria 1503
609 Ga0496102_0864825 3300048905 Bacteria 826
610 Ga0496103_0014115 3300048906 Bacteria 4742
611 Ga0496104_0008062 3300048907 Bacteria 9345
612 Ga0496105_0002846 3300048908 Bacteria 12657
613 Ga0496105_0007694 3300048908 Bacteria 8356
614 Ga0496106_0049828 3300048909 Bacteria 3156
615 Ga0496106_0298797 3300048909 Bacteria 1291
616 Ga0496107_0109918 3300048910 Bacteria 2025
617 Ga0496107_0543856 3300048910 Bacteria 860
618 Ga0496107_0642817 3300048910 Bacteria 782
619 Ga0496108_0133437 3300048911 Bacteria 2134
620 Ga0496109_0052691 3300048912 Bacteria 3710
621 Ga0496109_0463833 3300048912 Bacteria 1196
622 Ga0496110_0050474 3300048913 Bacteria 3652
623 Ga0496110_0076385 3300048913 Bacteria 2978
624 Ga0496111_0174964 3300048914 Bacteria 1595
625 Ga0496112_0003976 3300048915 Bacteria 12383
626 Ga0496113_1047041 3300048916 Bacteria 641
627 Ga0496114_0036130 3300048917 Bacteria 4084
628 Ga0496114_0065046 3300048917 Bacteria 3055
629 Ga0496114_0323851 3300048917 Bacteria 1362
630 Ga0496115_0016079 3300048918 Bacteria 5691
631 Ga0496116_0013262 3300048919 Bacteria 6662
632 Ga0496117_0007447 3300048920 Bacteria 10692
633 Ga0496118_0005503 3300048921 Bacteria 14373
634 Ga0501033_0094641 3300049570 Bacteria 2184
635 Ga0501044_0079154 3300049823 Bacteria 3331
636 nmdc:mga05p37_228905_c1 3300050507 Bacteria 2241
637 nmdc:mga06r32_178022_c1 3300050510 Bacteria 2112
638 nmdc:mga08y16_134879_c1 3300050511 Bacteria 2566
639 nmdc:mga08y16_247782_c1 3300050511 Bacteria 1841
640 nmdc:mga08y16_2942_c1 3300050511 Bacteria 17539
641 nmdc:mga0rr50_177103_c1 3300050513 Bacteria 1741
642 nmdc:mga0rr50_425891_c1 3300050513 Bacteria 1123
643 nmdc:mga0a205_324629_c1 3300050515 Bacteria 1410
644 Ga0495619_0001956 3300053085 Bacteria 13738

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048916 Ga0496113_1047041 Ga0496113_1047041_75_617 179
2 3300013308 Ga0157375_10792393 Ga0157375_107923932 203
3 3300048089 Ga0495614_0376891 Ga0495614_0376891_24_635 203
4 3300013105 Ga0157369_10168551 Ga0157369_101685514 204
5 3300025923 Ga0207681_10042262 Ga0207681_100422623 204
6 3300027695 Ga0209966_1011891 Ga0209966_10118912 206
7 3300005339 Ga0070660_100400349 Ga0070660_1004003492 212
8 3300005530 Ga0070679_100350049 Ga0070679_1003500492 212
9 3300005539 Ga0068853_100261502 Ga0068853_1002615022 212
10 3300013100 Ga0157373_10012155 Ga0157373_100121557 212
11 3300025919 Ga0207657_10370933 Ga0207657_103709332 212
12 3300035114 Ga0373939_0006137 Ga0373939_0006137_2174_2818 212
13 3300005355 Ga0070671_100464423 Ga0070671_1004644231 213
14 3300005841 Ga0068863_100460961 Ga0068863_1004609612 213
15 3300005985 Ga0081539_10010113 Ga0081539_100101139 213
16 3300026088 Ga0207641_10435132 Ga0207641_104351322 213
17 3300036401 Ga0373937_0151265 Ga0373937_0151265_27_677 213
18 3300001979 JGI24740J21852_10022621 JGI24740J21852_100226212 214
19 3300001990 JGI24737J22298_10044449 JGI24737J22298_100444491 214
20 3300002067 JGI24735J21928_10021736 JGI24735J21928_100217362 214
21 3300003203 JGI25406J46586_10087553 JGI25406J46586_100875532 214
22 3300003320 rootH2_10037647 rootH2_100376479 214
23 3300005290 Ga0065712_10161511 Ga0065712_101615111 214
24 3300005327 Ga0070658_10000960 Ga0070658_100009608 214
25 3300005328 Ga0070676_10009642 Ga0070676_100096422 214
26 3300005330 Ga0070690_100779805 Ga0070690_1007798051 214
27 3300005331 Ga0070670_100001648 Ga0070670_1000016484 214
28 3300005331 Ga0070670_100009312 Ga0070670_1000093122 214
29 3300005331 Ga0070670_100012745 Ga0070670_1000127454 214
30 3300005331 Ga0070670_100061114 Ga0070670_1000611143 214
31 3300005333 Ga0070677_10013217 Ga0070677_100132173 214
32 3300005334 Ga0068869_100003631 Ga0068869_1000036318 214
33 3300005334 Ga0068869_100075175 Ga0068869_1000751753 214
34 3300005334 Ga0068869_100253831 Ga0068869_1002538311 214
35 3300005335 Ga0070666_10000883 Ga0070666_100008837 214
36 3300005335 Ga0070666_10011620 Ga0070666_100116203 214
37 3300005335 Ga0070666_10033401 Ga0070666_100334015 214
38 3300005335 Ga0070666_10146480 Ga0070666_101464802 214
39 3300005335 Ga0070666_10555969 Ga0070666_105559691 214
40 3300005336 Ga0070680_100031707 Ga0070680_1000317074 214
41 3300005336 Ga0070680_100112412 Ga0070680_1001124124 214
42 3300005338 Ga0068868_100024734 Ga0068868_1000247343 214
43 3300005338 Ga0068868_100044045 Ga0068868_1000440452 214
44 3300005338 Ga0068868_100186069 Ga0068868_1001860693 214
45 3300005339 Ga0070660_100005482 Ga0070660_1000054828 214
46 3300005339 Ga0070660_100073845 Ga0070660_1000738453 214
47 3300005339 Ga0070660_100660730 Ga0070660_1006607301 214
48 3300005340 Ga0070689_100000405 Ga0070689_10000040521 214
49 3300005343 Ga0070687_100049781 Ga0070687_1000497812 214
50 3300005343 Ga0070687_100234630 Ga0070687_1002346302 214
51 3300005344 Ga0070661_100002335 Ga0070661_1000023353 214
52 3300005344 Ga0070661_100035283 Ga0070661_1000352836 214
53 3300005344 Ga0070661_100207255 Ga0070661_1002072552 214
54 3300005344 Ga0070661_100322795 Ga0070661_1003227952 214
55 3300005344 Ga0070661_100592225 Ga0070661_1005922251 214
56 3300005345 Ga0070692_10290225 Ga0070692_102902251 214
57 3300005347 Ga0070668_100033665 Ga0070668_1000336653 214
58 3300005347 Ga0070668_100081514 Ga0070668_1000815142 214
59 3300005353 Ga0070669_100149724 Ga0070669_1001497242 214
60 3300005353 Ga0070669_100207865 Ga0070669_1002078652 214
61 3300005353 Ga0070669_100213917 Ga0070669_1002139172 214
62 3300005354 Ga0070675_100029260 Ga0070675_1000292602 214
63 3300005354 Ga0070675_100492206 Ga0070675_1004922061 214
64 3300005355 Ga0070671_100028890 Ga0070671_1000288903 214
65 3300005355 Ga0070671_100257189 Ga0070671_1002571893 214
66 3300005356 Ga0070674_100000708 Ga0070674_1000007086 214
67 3300005356 Ga0070674_100129232 Ga0070674_1001292322 214
68 3300005356 Ga0070674_100259001 Ga0070674_1002590012 214
69 3300005364 Ga0070673_100002708 Ga0070673_10000270811 214
70 3300005364 Ga0070673_100373988 Ga0070673_1003739881 214
71 3300005364 Ga0070673_100463812 Ga0070673_1004638122 214
72 3300005365 Ga0070688_100002477 Ga0070688_1000024778 214
73 3300005366 Ga0070659_100006550 Ga0070659_1000065501 214
74 3300005366 Ga0070659_100069221 Ga0070659_1000692212 214
75 3300005366 Ga0070659_100141592 Ga0070659_1001415922 214
76 3300005367 Ga0070667_100000070 Ga0070667_10000007079 214
77 3300005367 Ga0070667_100004034 Ga0070667_10000403413 214
78 3300005367 Ga0070667_100007792 Ga0070667_10000779215 214
79 3300005367 Ga0070667_100043123 Ga0070667_1000431233 214
80 3300005367 Ga0070667_100144266 Ga0070667_1001442662 214
81 3300005367 Ga0070667_100155755 Ga0070667_1001557553 214
82 3300005435 Ga0070714_100000954 Ga0070714_1000009545 214
83 3300005435 Ga0070714_100190455 Ga0070714_1001904552 214
84 3300005436 Ga0070713_100034884 Ga0070713_1000348842 214
85 3300005436 Ga0070713_100216895 Ga0070713_1002168953 214
86 3300005437 Ga0070710_10005351 Ga0070710_100053512 214
87 3300005438 Ga0070701_10186042 Ga0070701_101860422 214
88 3300005439 Ga0070711_100002923 Ga0070711_1000029233 214
89 3300005440 Ga0070705_100231817 Ga0070705_1002318171 214
90 3300005441 Ga0070700_100040841 Ga0070700_1000408412 214
91 3300005455 Ga0070663_100115168 Ga0070663_1001151682 214
92 3300005455 Ga0070663_100227824 Ga0070663_1002278242 214
93 3300005456 Ga0070678_100035786 Ga0070678_1000357863 214
94 3300005456 Ga0070678_100908091 Ga0070678_1009080911 214
95 3300005457 Ga0070662_100020585 Ga0070662_1000205857 214
96 3300005457 Ga0070662_100068743 Ga0070662_1000687432 214
97 3300005457 Ga0070662_100205312 Ga0070662_1002053122 214
98 3300005459 Ga0068867_100004004 Ga0068867_10000400410 214
99 3300005459 Ga0068867_100044544 Ga0068867_1000445441 214
100 3300005459 Ga0068867_100080291 Ga0068867_1000802912 214
101 3300005459 Ga0068867_100129727 Ga0068867_1001297271 214
102 3300005466 Ga0070685_10000781 Ga0070685_1000078120 214
103 3300005466 Ga0070685_10054797 Ga0070685_100547973 214
104 3300005468 Ga0070707_100081984 Ga0070707_1000819843 214
105 3300005468 Ga0070707_100368654 Ga0070707_1003686541 214
106 3300005530 Ga0070679_100432899 Ga0070679_1004328992 214
107 3300005535 Ga0070684_100078053 Ga0070684_1000780534 214
108 3300005535 Ga0070684_100100487 Ga0070684_1001004873 214
109 3300005536 Ga0070697_100475732 Ga0070697_1004757322 214
110 3300005539 Ga0068853_100012867 Ga0068853_1000128678 214
111 3300005539 Ga0068853_100016601 Ga0068853_1000166014 214
112 3300005539 Ga0068853_100342657 Ga0068853_1003426572 214
113 3300005543 Ga0070672_100029879 Ga0070672_1000298794 214
114 3300005543 Ga0070672_100107727 Ga0070672_1001077273 214
115 3300005543 Ga0070672_100174684 Ga0070672_1001746842 214
116 3300005543 Ga0070672_100512162 Ga0070672_1005121622 214
117 3300005544 Ga0070686_100009269 Ga0070686_1000092698 214
118 3300005546 Ga0070696_100002515 Ga0070696_10000251517 214
119 3300005546 Ga0070696_100027759 Ga0070696_1000277596 214
120 3300005546 Ga0070696_100317235 Ga0070696_1003172352 214
121 3300005547 Ga0070693_100004506 Ga0070693_1000045063 214
122 3300005547 Ga0070693_100077002 Ga0070693_1000770022 214
123 3300005548 Ga0070665_100012399 Ga0070665_10001239913 214
124 3300005548 Ga0070665_100035492 Ga0070665_1000354922 214
125 3300005549 Ga0070704_100296117 Ga0070704_1002961172 214
126 3300005549 Ga0070704_100775592 Ga0070704_1007755922 214
127 3300005563 Ga0068855_100008716 Ga0068855_1000087166 214
128 3300005563 Ga0068855_100033228 Ga0068855_1000332286 214
129 3300005563 Ga0068855_100116020 Ga0068855_1001160202 214
130 3300005564 Ga0070664_100005045 Ga0070664_1000050452 214
131 3300005564 Ga0070664_100040329 Ga0070664_1000403294 214
132 3300005564 Ga0070664_100388901 Ga0070664_1003889012 214
133 3300005577 Ga0068857_100003573 Ga0068857_1000035739 214
134 3300005577 Ga0068857_100004795 Ga0068857_1000047954 214
135 3300005577 Ga0068857_100029378 Ga0068857_1000293782 214
136 3300005578 Ga0068854_100000351 Ga0068854_1000003516 214
137 3300005578 Ga0068854_100004788 Ga0068854_1000047889 214
138 3300005578 Ga0068854_100018892 Ga0068854_1000188922 214
139 3300005578 Ga0068854_100143794 Ga0068854_1001437942 214
140 3300005578 Ga0068854_100239851 Ga0068854_1002398512 214
141 3300005578 Ga0068854_100523802 Ga0068854_1005238022 214
142 3300005614 Ga0068856_100016485 Ga0068856_1000164853 214
143 3300005614 Ga0068856_100023023 Ga0068856_10002302310 214
144 3300005614 Ga0068856_100071577 Ga0068856_1000715773 214
145 3300005614 Ga0068856_100083131 Ga0068856_1000831314 214
146 3300005614 Ga0068856_100099014 Ga0068856_1000990142 214
147 3300005615 Ga0070702_100021363 Ga0070702_1000213635 214
148 3300005616 Ga0068852_100024598 Ga0068852_1000245984 214
149 3300005616 Ga0068852_100032787 Ga0068852_1000327876 214
150 3300005616 Ga0068852_100034850 Ga0068852_1000348502 214
151 3300005616 Ga0068852_100397247 Ga0068852_1003972472 214
152 3300005616 Ga0068852_100434409 Ga0068852_1004344092 214
153 3300005616 Ga0068852_100750496 Ga0068852_1007504961 214
154 3300005617 Ga0068859_100001347 Ga0068859_10000134728 214
155 3300005617 Ga0068859_100009913 Ga0068859_1000099132 214
156 3300005617 Ga0068859_100062429 Ga0068859_1000624292 214
157 3300005617 Ga0068859_100077063 Ga0068859_1000770633 214
158 3300005618 Ga0068864_100010584 Ga0068864_1000105846 214
159 3300005618 Ga0068864_100017409 Ga0068864_10001740910 214
160 3300005618 Ga0068864_100018003 Ga0068864_1000180034 214
161 3300005618 Ga0068864_100035436 Ga0068864_1000354364 214
162 3300005718 Ga0068866_10007029 Ga0068866_100070296 214
163 3300005718 Ga0068866_10074224 Ga0068866_100742242 214
164 3300005719 Ga0068861_100014002 Ga0068861_1000140024 214
165 3300005719 Ga0068861_100087995 Ga0068861_1000879952 214
166 3300005719 Ga0068861_100114982 Ga0068861_1001149824 214
167 3300005834 Ga0068851_10006735 Ga0068851_100067352 214
168 3300005834 Ga0068851_10099648 Ga0068851_100996482 214
169 3300005840 Ga0068870_10009728 Ga0068870_100097287 214
170 3300005840 Ga0068870_10107234 Ga0068870_101072342 214
171 3300005841 Ga0068863_100013951 Ga0068863_1000139514 214
172 3300005841 Ga0068863_100026288 Ga0068863_10002628811 214
173 3300005841 Ga0068863_100374528 Ga0068863_1003745282 214
174 3300005841 Ga0068863_100605580 Ga0068863_1006055802 214
175 3300005842 Ga0068858_100003331 Ga0068858_1000033316 214
176 3300005842 Ga0068858_100036483 Ga0068858_1000364833 214
177 3300005842 Ga0068858_100058263 Ga0068858_1000582632 214
178 3300005842 Ga0068858_100860432 Ga0068858_1008604321 214
179 3300005843 Ga0068860_100006411 Ga0068860_1000064112 214
180 3300005843 Ga0068860_100030495 Ga0068860_1000304957 214
181 3300005843 Ga0068860_100031074 Ga0068860_1000310743 214
182 3300005843 Ga0068860_100063672 Ga0068860_1000636722 214
183 3300005843 Ga0068860_100086234 Ga0068860_1000862346 214
184 3300005843 Ga0068860_100101809 Ga0068860_1001018094 214
185 3300005843 Ga0068860_100243006 Ga0068860_1002430061 214
186 3300005844 Ga0068862_100004281 Ga0068862_1000042819 214
187 3300005844 Ga0068862_100036178 Ga0068862_1000361784 214
188 3300005844 Ga0068862_100094264 Ga0068862_1000942642 214
189 3300005985 Ga0081539_10003560 Ga0081539_100035609 214
190 3300006163 Ga0070715_10054981 Ga0070715_100549813 214
191 3300006163 Ga0070715_10196118 Ga0070715_101961182 214
192 3300006175 Ga0070712_100016494 Ga0070712_1000164943 214
193 3300006175 Ga0070712_100809659 Ga0070712_1008096591 214
194 3300006237 Ga0097621_100026284 Ga0097621_1000262844 214
195 3300006237 Ga0097621_100037602 Ga0097621_1000376026 214
196 3300006358 Ga0068871_100029400 Ga0068871_1000294007 214
197 3300006358 Ga0068871_100064326 Ga0068871_1000643264 214
198 3300006358 Ga0068871_100092803 Ga0068871_1000928033 214
199 3300006358 Ga0068871_100108507 Ga0068871_1001085073 214
200 3300006846 Ga0075430_100924021 Ga0075430_1009240211 214
201 3300006852 Ga0075433_10346127 Ga0075433_103461271 214
202 3300006881 Ga0068865_100038324 Ga0068865_1000383241 214
203 3300006881 Ga0068865_100048848 Ga0068865_1000488484 214
204 3300006881 Ga0068865_100147208 Ga0068865_1001472083 214
205 3300006931 Ga0097620_100001347 Ga0097620_10000134728 214
206 3300006931 Ga0097620_100009913 Ga0097620_1000099132 214
207 3300006931 Ga0097620_100062426 Ga0097620_1000624262 214
208 3300006931 Ga0097620_100077064 Ga0097620_1000770643 214
209 3300006931 Ga0097620_100122140 Ga0097620_1001221403 214
210 3300007076 Ga0075435_100067875 Ga0075435_1000678752 214
211 3300007076 Ga0075435_100315408 Ga0075435_1003154082 214
212 3300007076 Ga0075435_100582374 Ga0075435_1005823741 214
213 3300007265 Ga0099794_10016035 Ga0099794_100160354 214
214 3300009036 Ga0105244_10004531 Ga0105244_100045318 214
215 3300009093 Ga0105240_10003598 Ga0105240_1000359823 214
216 3300009093 Ga0105240_10015820 Ga0105240_100158209 214
217 3300009093 Ga0105240_10040583 Ga0105240_100405835 214
218 3300009093 Ga0105240_10090577 Ga0105240_100905772 214
219 3300009093 Ga0105240_10104545 Ga0105240_101045453 214
220 3300009093 Ga0105240_10301933 Ga0105240_103019332 214
221 3300009094 Ga0111539_10006635 Ga0111539_100066356 214
222 3300009094 Ga0111539_10033069 Ga0111539_100330692 214
223 3300009094 Ga0111539_10055709 Ga0111539_100557091 214
224 3300009098 Ga0105245_10001706 Ga0105245_1000170624 214
225 3300009098 Ga0105245_10004524 Ga0105245_1000452416 214
226 3300009098 Ga0105245_10128767 Ga0105245_101287672 214
227 3300009101 Ga0105247_10001753 Ga0105247_1000175327 214
228 3300009101 Ga0105247_10003347 Ga0105247_1000334710 214
229 3300009101 Ga0105247_10006032 Ga0105247_100060323 214
230 3300009147 Ga0114129_10246825 Ga0114129_102468252 214
231 3300009148 Ga0105243_10019788 Ga0105243_100197886 214
232 3300009174 Ga0105241_10032952 Ga0105241_100329522 214
233 3300009174 Ga0105241_10053418 Ga0105241_100534185 214
234 3300009174 Ga0105241_10326953 Ga0105241_103269532 214
235 3300009174 Ga0105241_10399357 Ga0105241_103993571 214
236 3300009174 Ga0105241_10410591 Ga0105241_104105912 214
237 3300009174 Ga0105241_10616428 Ga0105241_106164282 214
238 3300009176 Ga0105242_10006602 Ga0105242_100066025 214
239 3300009176 Ga0105242_10026457 Ga0105242_100264574 214
240 3300009177 Ga0105248_10003961 Ga0105248_1000396113 214
241 3300009177 Ga0105248_10007310 Ga0105248_100073107 214
242 3300009177 Ga0105248_10032837 Ga0105248_100328376 214
243 3300009177 Ga0105248_10081849 Ga0105248_100818492 214
244 3300009177 Ga0105248_10283874 Ga0105248_102838742 214
245 3300009545 Ga0105237_10000568 Ga0105237_1000056834 214
246 3300009545 Ga0105237_10013037 Ga0105237_100130376 214
247 3300009545 Ga0105237_10150764 Ga0105237_101507642 214
248 3300009545 Ga0105237_10378771 Ga0105237_103787712 214
249 3300009545 Ga0105237_11062671 Ga0105237_110626711 214
250 3300009551 Ga0105238_10003097 Ga0105238_100030972 214
251 3300009551 Ga0105238_10014903 Ga0105238_100149034 214
252 3300009551 Ga0105238_10022895 Ga0105238_100228952 214
253 3300009551 Ga0105238_10159418 Ga0105238_101594183 214
254 3300009551 Ga0105238_10315307 Ga0105238_103153071 214
255 3300009551 Ga0105238_10512987 Ga0105238_105129871 214
256 3300009553 Ga0105249_10022284 Ga0105249_100222845 214
257 3300009553 Ga0105249_10039088 Ga0105249_100390883 214
258 3300009553 Ga0105249_10688461 Ga0105249_106884612 214
259 3300009553 Ga0105249_10858970 Ga0105249_108589701 214
260 3300010375 Ga0105239_10007023 Ga0105239_100070232 214
261 3300010375 Ga0105239_10025591 Ga0105239_100255914 214
262 3300010375 Ga0105239_10112639 Ga0105239_101126392 214
263 3300010375 Ga0105239_10230480 Ga0105239_102304802 214
264 3300010375 Ga0105239_10279455 Ga0105239_102794553 214
265 3300011119 Ga0105246_10030657 Ga0105246_100306575 214
266 3300012500 Ga0157314_1000326 Ga0157314_10003264 214
267 3300013100 Ga0157373_10084243 Ga0157373_100842431 214
268 3300013100 Ga0157373_10243308 Ga0157373_102433082 214
269 3300013102 Ga0157371_10062807 Ga0157371_100628071 214
270 3300013104 Ga0157370_10060564 Ga0157370_100605644 214
271 3300013105 Ga0157369_10003187 Ga0157369_1000318712 214
272 3300013105 Ga0157369_10652521 Ga0157369_106525211 214
273 3300013296 Ga0157374_10019920 Ga0157374_1001992011 214
274 3300013296 Ga0157374_10192892 Ga0157374_101928922 214
275 3300013296 Ga0157374_10560234 Ga0157374_105602342 214
276 3300013297 Ga0157378_10020320 Ga0157378_100203207 214
277 3300013297 Ga0157378_10062016 Ga0157378_100620162 214
278 3300013297 Ga0157378_10521596 Ga0157378_105215962 214
279 3300013306 Ga0163162_10005971 Ga0163162_1000597115 214
280 3300013306 Ga0163162_10024462 Ga0163162_100244625 214
281 3300013306 Ga0163162_10058014 Ga0163162_100580143 214
282 3300013306 Ga0163162_10088120 Ga0163162_100881203 214
283 3300013306 Ga0163162_10112768 Ga0163162_101127683 214
284 3300013306 Ga0163162_10136794 Ga0163162_101367944 214
285 3300013307 Ga0157372_10002205 Ga0157372_100022056 214
286 3300013307 Ga0157372_10008580 Ga0157372_100085805 214
287 3300013307 Ga0157372_11238964 Ga0157372_112389642 214
288 3300013308 Ga0157375_10005247 Ga0157375_1000524711 214
289 3300013308 Ga0157375_10037335 Ga0157375_100373353 214
290 3300013308 Ga0157375_10038253 Ga0157375_100382533 214
291 3300013308 Ga0157375_10184938 Ga0157375_101849382 214
292 3300013308 Ga0157375_10513323 Ga0157375_105133231 214
293 3300013308 Ga0157375_11447407 Ga0157375_114474071 214
294 3300014325 Ga0163163_10000419 Ga0163163_1000041913 214
295 3300014325 Ga0163163_10008697 Ga0163163_1000869715 214
296 3300014325 Ga0163163_10104973 Ga0163163_101049734 214
297 3300014325 Ga0163163_10117183 Ga0163163_101171832 214
298 3300014326 Ga0157380_10006058 Ga0157380_100060583 214
299 3300014497 Ga0182008_10009166 Ga0182008_100091665 214
300 3300014968 Ga0157379_10000468 Ga0157379_1000046810 214
301 3300014968 Ga0157379_10002075 Ga0157379_1000207511 214
302 3300014968 Ga0157379_10026687 Ga0157379_100266873 214
303 3300014969 Ga0157376_10001151 Ga0157376_100011515 214
304 3300014969 Ga0157376_10015295 Ga0157376_100152955 214
305 3300014969 Ga0157376_10063420 Ga0157376_100634205 214
306 3300014969 Ga0157376_10305672 Ga0157376_103056722 214
307 3300014969 Ga0157376_10948747 Ga0157376_109487471 214
308 3300015261 Ga0182006_1039066 Ga0182006_10390662 214
309 3300015262 Ga0182007_10003164 Ga0182007_100031644 214
310 3300015265 Ga0182005_1009509 Ga0182005_10095093 214
311 3300017792 Ga0163161_10026834 Ga0163161_100268344 214
312 3300017792 Ga0163161_10030598 Ga0163161_100305982 214
313 3300017792 Ga0163161_10115289 Ga0163161_101152892 214
314 3300017792 Ga0163161_10171649 Ga0163161_101716492 214
315 3300017792 Ga0163161_10331662 Ga0163161_103316622 214
316 3300025297 Ga0209758_1050042 Ga0209758_10500422 214
317 3300025315 Ga0207697_10027886 Ga0207697_100278862 214
318 3300025315 Ga0207697_10135798 Ga0207697_101357981 214
319 3300025728 Ga0207655_1015566 Ga0207655_10155661 214
320 3300025893 Ga0207682_10020033 Ga0207682_100200333 214
321 3300025898 Ga0207692_10156829 Ga0207692_101568292 214
322 3300025899 Ga0207642_10025498 Ga0207642_100254983 214
323 3300025899 Ga0207642_10106899 Ga0207642_101068992 214
324 3300025900 Ga0207710_10003077 Ga0207710_100030772 214
325 3300025900 Ga0207710_10101516 Ga0207710_101015162 214
326 3300025901 Ga0207688_10272398 Ga0207688_102723982 214
327 3300025903 Ga0207680_10000440 Ga0207680_100004409 214
328 3300025903 Ga0207680_10019916 Ga0207680_100199166 214
329 3300025903 Ga0207680_10023317 Ga0207680_100233173 214
330 3300025903 Ga0207680_10100749 Ga0207680_101007492 214
331 3300025903 Ga0207680_10154888 Ga0207680_101548882 214
332 3300025903 Ga0207680_10172638 Ga0207680_101726383 214
333 3300025904 Ga0207647_10029287 Ga0207647_100292872 214
334 3300025905 Ga0207685_10009453 Ga0207685_100094533 214
335 3300025907 Ga0207645_10013709 Ga0207645_100137095 214
336 3300025907 Ga0207645_10038352 Ga0207645_100383522 214
337 3300025907 Ga0207645_10265210 Ga0207645_102652101 214
338 3300025908 Ga0207643_10003322 Ga0207643_100033226 214
339 3300025908 Ga0207643_10328033 Ga0207643_103280332 214
340 3300025909 Ga0207705_10012447 Ga0207705_100124474 214
341 3300025909 Ga0207705_10071909 Ga0207705_100719092 214
342 3300025909 Ga0207705_10137909 Ga0207705_101379092 214
343 3300025911 Ga0207654_10080201 Ga0207654_100802014 214
344 3300025911 Ga0207654_10126932 Ga0207654_101269322 214
345 3300025911 Ga0207654_10153447 Ga0207654_101534471 214
346 3300025911 Ga0207654_10211411 Ga0207654_102114112 214
347 3300025911 Ga0207654_10274196 Ga0207654_102741962 214
348 3300025913 Ga0207695_10003722 Ga0207695_100037228 214
349 3300025913 Ga0207695_10004423 Ga0207695_1000442327 214
350 3300025913 Ga0207695_10006828 Ga0207695_1000682820 214
351 3300025913 Ga0207695_10031401 Ga0207695_100314012 214
352 3300025913 Ga0207695_10070211 Ga0207695_100702112 214
353 3300025914 Ga0207671_10000037 Ga0207671_1000003734 214
354 3300025914 Ga0207671_10002300 Ga0207671_100023002 214
355 3300025914 Ga0207671_10373785 Ga0207671_103737852 214
356 3300025915 Ga0207693_10000325 Ga0207693_100003257 214
357 3300025915 Ga0207693_10064198 Ga0207693_100641983 214
358 3300025916 Ga0207663_10001645 Ga0207663_1000164511 214
359 3300025918 Ga0207662_10011038 Ga0207662_100110382 214
360 3300025919 Ga0207657_10035541 Ga0207657_100355412 214
361 3300025920 Ga0207649_10004472 Ga0207649_100044722 214
362 3300025920 Ga0207649_10065595 Ga0207649_100655953 214
363 3300025920 Ga0207649_10510067 Ga0207649_105100672 214
364 3300025921 Ga0207652_10247307 Ga0207652_102473072 214
365 3300025922 Ga0207646_10037033 Ga0207646_100370332 214
366 3300025922 Ga0207646_10120309 Ga0207646_101203094 214
367 3300025922 Ga0207646_10276750 Ga0207646_102767502 214
368 3300025922 Ga0207646_10294966 Ga0207646_102949662 214
369 3300025923 Ga0207681_10375181 Ga0207681_103751811 214
370 3300025924 Ga0207694_10042190 Ga0207694_100421903 214
371 3300025924 Ga0207694_10208215 Ga0207694_102082152 214
372 3300025925 Ga0207650_10088594 Ga0207650_100885943 214
373 3300025925 Ga0207650_10107882 Ga0207650_101078824 214
374 3300025925 Ga0207650_10170456 Ga0207650_101704562 214
375 3300025925 Ga0207650_10259718 Ga0207650_102597182 214
376 3300025926 Ga0207659_10010560 Ga0207659_100105605 214
377 3300025926 Ga0207659_10140884 Ga0207659_101408843 214
378 3300025927 Ga0207687_10002556 Ga0207687_1000255620 214
379 3300025927 Ga0207687_10103818 Ga0207687_101038183 214
380 3300025927 Ga0207687_10413500 Ga0207687_104135002 214
381 3300025928 Ga0207700_10010506 Ga0207700_100105068 214
382 3300025929 Ga0207664_10258077 Ga0207664_102580772 214
383 3300025929 Ga0207664_10300326 Ga0207664_103003263 214
384 3300025931 Ga0207644_10003120 Ga0207644_1000312014 214
385 3300025931 Ga0207644_10059832 Ga0207644_100598324 214
386 3300025931 Ga0207644_10585121 Ga0207644_105851211 214
387 3300025932 Ga0207690_10139991 Ga0207690_101399912 214
388 3300025932 Ga0207690_10296588 Ga0207690_102965881 214
389 3300025933 Ga0207706_10021523 Ga0207706_100215234 214
390 3300025933 Ga0207706_10035277 Ga0207706_100352777 214
391 3300025933 Ga0207706_10091789 Ga0207706_100917892 214
392 3300025933 Ga0207706_10122495 Ga0207706_101224952 214
393 3300025934 Ga0207686_10001142 Ga0207686_1000114229 214
394 3300025934 Ga0207686_10017354 Ga0207686_100173542 214
395 3300025935 Ga0207709_10123926 Ga0207709_101239262 214
396 3300025936 Ga0207670_10004331 Ga0207670_100043316 214
397 3300025937 Ga0207669_10007901 Ga0207669_100079019 214
398 3300025937 Ga0207669_10022493 Ga0207669_100224932 214
399 3300025938 Ga0207704_10057363 Ga0207704_100573633 214
400 3300025939 Ga0207665_10447370 Ga0207665_104473702 214
401 3300025940 Ga0207691_10009974 Ga0207691_100099745 214
402 3300025940 Ga0207691_10047774 Ga0207691_100477743 214
403 3300025940 Ga0207691_10060832 Ga0207691_100608321 214
404 3300025940 Ga0207691_10097780 Ga0207691_100977802 214
405 3300025940 Ga0207691_10105000 Ga0207691_101050003 214
406 3300025940 Ga0207691_10518885 Ga0207691_105188852 214
407 3300025941 Ga0207711_10000206 Ga0207711_1000020660 214
408 3300025941 Ga0207711_10041780 Ga0207711_100417805 214
409 3300025941 Ga0207711_10694106 Ga0207711_106941062 214
410 3300025942 Ga0207689_10000042 Ga0207689_1000004210 214
411 3300025942 Ga0207689_10034225 Ga0207689_100342253 214
412 3300025942 Ga0207689_10041601 Ga0207689_100416012 214
413 3300025944 Ga0207661_10108914 Ga0207661_101089144 214
414 3300025945 Ga0207679_10253958 Ga0207679_102539583 214
415 3300025945 Ga0207679_10416478 Ga0207679_104164782 214
416 3300025949 Ga0207667_10003980 Ga0207667_1000398010 214
417 3300025949 Ga0207667_10043195 Ga0207667_100431955 214
418 3300025949 Ga0207667_10117769 Ga0207667_101177692 214
419 3300025960 Ga0207651_10001984 Ga0207651_100019843 214
420 3300025960 Ga0207651_10313059 Ga0207651_103130592 214
421 3300025961 Ga0207712_10003603 Ga0207712_100036036 214
422 3300025961 Ga0207712_10007987 Ga0207712_100079872 214
423 3300025961 Ga0207712_10186473 Ga0207712_101864732 214
424 3300025961 Ga0207712_10307219 Ga0207712_103072192 214
425 3300025972 Ga0207668_10082092 Ga0207668_100820922 214
426 3300025972 Ga0207668_10141605 Ga0207668_101416052 214
427 3300025972 Ga0207668_10301551 Ga0207668_103015511 214
428 3300025981 Ga0207640_10000315 Ga0207640_1000031511 214
429 3300025981 Ga0207640_10012908 Ga0207640_100129083 214
430 3300025981 Ga0207640_10026979 Ga0207640_100269794 214
431 3300025981 Ga0207640_10205867 Ga0207640_102058672 214
432 3300025986 Ga0207658_10000035 Ga0207658_1000003533 214
433 3300025986 Ga0207658_10017499 Ga0207658_100174996 214
434 3300025986 Ga0207658_10030509 Ga0207658_100305093 214
435 3300025986 Ga0207658_10054823 Ga0207658_100548234 214
436 3300025986 Ga0207658_10253494 Ga0207658_102534943 214
437 3300025986 Ga0207658_10676543 Ga0207658_106765431 214
438 3300025986 Ga0207658_10700490 Ga0207658_107004901 214
439 3300026023 Ga0207677_10004097 Ga0207677_1000409711 214
440 3300026023 Ga0207677_10032562 Ga0207677_100325623 214
441 3300026023 Ga0207677_10089299 Ga0207677_100892992 214
442 3300026023 Ga0207677_10137262 Ga0207677_101372623 214
443 3300026035 Ga0207703_10001548 Ga0207703_1000154810 214
444 3300026035 Ga0207703_10001771 Ga0207703_1000177120 214
445 3300026041 Ga0207639_10006857 Ga0207639_100068573 214
446 3300026041 Ga0207639_10023140 Ga0207639_100231402 214
447 3300026041 Ga0207639_10108211 Ga0207639_101082112 214
448 3300026041 Ga0207639_10111387 Ga0207639_101113874 214
449 3300026041 Ga0207639_10193220 Ga0207639_101932202 214
450 3300026041 Ga0207639_10206112 Ga0207639_102061123 214
451 3300026067 Ga0207678_10259577 Ga0207678_102595772 214
452 3300026067 Ga0207678_10267074 Ga0207678_102670743 214
453 3300026067 Ga0207678_10396925 Ga0207678_103969251 214
454 3300026067 Ga0207678_10698709 Ga0207678_106987091 214
455 3300026075 Ga0207708_10038249 Ga0207708_100382493 214
456 3300026078 Ga0207702_10030647 Ga0207702_100306475 214
457 3300026078 Ga0207702_10074138 Ga0207702_100741384 214
458 3300026078 Ga0207702_10099904 Ga0207702_100999043 214
459 3300026088 Ga0207641_10005413 Ga0207641_100054137 214
460 3300026088 Ga0207641_10023799 Ga0207641_100237995 214
461 3300026088 Ga0207641_10207230 Ga0207641_102072302 214
462 3300026088 Ga0207641_10286084 Ga0207641_102860842 214
463 3300026088 Ga0207641_10521523 Ga0207641_105215232 214
464 3300026088 Ga0207641_10561490 Ga0207641_105614901 214
465 3300026089 Ga0207648_10001802 Ga0207648_1000180218 214
466 3300026089 Ga0207648_10038418 Ga0207648_100384187 214
467 3300026089 Ga0207648_10115237 Ga0207648_101152372 214
468 3300026089 Ga0207648_10116436 Ga0207648_101164363 214
469 3300026095 Ga0207676_10032664 Ga0207676_100326644 214
470 3300026095 Ga0207676_10119664 Ga0207676_101196642 214
471 3300026095 Ga0207676_10163635 Ga0207676_101636353 214
472 3300026095 Ga0207676_10208943 Ga0207676_102089431 214
473 3300026095 Ga0207676_10519215 Ga0207676_105192152 214
474 3300026116 Ga0207674_10002494 Ga0207674_1000249412 214
475 3300026116 Ga0207674_10002673 Ga0207674_100026733 214
476 3300026118 Ga0207675_100001457 Ga0207675_10000145726 214
477 3300026118 Ga0207675_100012967 Ga0207675_1000129674 214
478 3300026118 Ga0207675_100165849 Ga0207675_1001658492 214
479 3300026118 Ga0207675_100479577 Ga0207675_1004795772 214
480 3300026121 Ga0207683_10000671 Ga0207683_1000067144 214
481 3300026121 Ga0207683_10000805 Ga0207683_1000080524 214
482 3300026121 Ga0207683_10022091 Ga0207683_100220917 214
483 3300026121 Ga0207683_10037366 Ga0207683_100373662 214
484 3300026142 Ga0207698_10032964 Ga0207698_100329642 214
485 3300026142 Ga0207698_10150601 Ga0207698_101506014 214
486 3300026142 Ga0207698_10324180 Ga0207698_103241802 214
487 3300027671 Ga0209588_1017642 Ga0209588_10176423 214
488 3300027876 Ga0209974_10054267 Ga0209974_100542672 214
489 3300027907 Ga0207428_10000177 Ga0207428_1000017721 214
490 3300027907 Ga0207428_10057018 Ga0207428_100570184 214
491 3300028379 Ga0268266_10021020 Ga0268266_100210205 214
492 3300028379 Ga0268266_10153889 Ga0268266_101538892 214
493 3300028379 Ga0268266_10406490 Ga0268266_104064902 214
494 3300028380 Ga0268265_10014380 Ga0268265_100143807 214
495 3300028380 Ga0268265_10086581 Ga0268265_100865814 214
496 3300028380 Ga0268265_10314041 Ga0268265_103140412 214
497 3300028381 Ga0268264_10000781 Ga0268264_1000078138 214
498 3300028381 Ga0268264_10001973 Ga0268264_1000197317 214
499 3300028381 Ga0268264_10005556 Ga0268264_100055564 214
500 3300028381 Ga0268264_10046554 Ga0268264_100465542 214
501 3300028381 Ga0268264_10075190 Ga0268264_100751902 214
502 3300028381 Ga0268264_10129862 Ga0268264_101298623 214
503 3300028381 Ga0268264_10136761 Ga0268264_101367613 214
504 3300028556 Ga0265337_1013871 Ga0265337_10138712 214
505 3300028666 Ga0265336_10025031 Ga0265336_100250313 214
506 3300028800 Ga0265338_10041038 Ga0265338_100410385 214
507 3300028800 Ga0265338_10047050 Ga0265338_100470503 214
508 3300029957 Ga0265324_10008509 Ga0265324_100085092 214
509 3300029957 Ga0265324_10015980 Ga0265324_100159803 214
510 3300031240 Ga0265320_10016611 Ga0265320_100166114 214
511 3300031251 Ga0265327_10029520 Ga0265327_100295202 214
512 3300031344 Ga0265316_10108486 Ga0265316_101084862 214
513 3300031711 Ga0265314_10024247 Ga0265314_100242472 214
514 3300031712 Ga0265342_10194466 Ga0265342_101944662 214
515 3300031730 Ga0307516_10142021 Ga0307516_101420211 214
516 3300031731 Ga0307405_10013967 Ga0307405_100139672 214
517 3300031824 Ga0307413_10000419 Ga0307413_1000041911 214
518 3300031852 Ga0307410_10005053 Ga0307410_100050533 214
519 3300031852 Ga0307410_10326513 Ga0307410_103265132 214
520 3300031901 Ga0307406_10162675 Ga0307406_101626752 214
521 3300031903 Ga0307407_10010554 Ga0307407_100105543 214
522 3300031911 Ga0307412_10121479 Ga0307412_101214792 214
523 3300031995 Ga0307409_100017446 Ga0307409_1000174462 214
524 3300031995 Ga0307409_100044483 Ga0307409_1000444833 214
525 3300032004 Ga0307414_10004222 Ga0307414_100042223 214
526 3300032005 Ga0307411_10000976 Ga0307411_1000097610 214
527 3300035083 Ga0373926_0028696 Ga0373926_0028696_855_1502 214
528 3300035084 Ga0373928_0036873 Ga0373928_0036873_215_862 214
529 3300035111 Ga0373923_0001607 Ga0373923_0001607_4421_5074 214
530 3300035112 Ga0373932_0010037 Ga0373932_0010037_33_680 214
531 3300035116 Ga0373945_0019264 Ga0373945_0019264_1575_2228 214
532 3300035118 Ga0373954_0009331 Ga0373954_0009331_3370_4023 214
533 3300035120 Ga0373957_0021100 Ga0373957_0021100_1387_2040 214
534 3300035172 Ga0373955_0001122 Ga0373955_0001122_4799_5452 214
535 3300035691 Ga0373931_0007204 Ga0373931_0007204_3167_3814 214
536 3300035691 Ga0373931_0199590 Ga0373931_0199590_212_865 214
537 3300035692 Ga0373935_0472755 Ga0373935_0472755_53_706 214
538 3300035724 Ga0373933_0260264 Ga0373933_0260264_279_932 214
539 3300035725 Ga0373947_0008671 Ga0373947_0008671_4778_5431 214
540 3300035725 Ga0373947_0077549 Ga0373947_0077549_803_1456 214
541 3300036401 Ga0373937_0175992 Ga0373937_0175992_1033_1677 214
542 3300036401 Ga0373937_0367182 Ga0373937_0367182_571_1224 214
543 3300037068 Ga0373925_0011050 Ga0373925_0011050_2123_2776 214
544 3300037068 Ga0373925_0399798 Ga0373925_0399798_402_1046 214
545 3300038443 Ga0395901_0266020 Ga0395901_0266020_771_1418 214
546 3300041501 Ga0451845_0270843 Ga0451845_0270843_2065_2715 214
547 3300041507 Ga0451851_0924877 Ga0451851_0924877_21_671 214
548 3300041509 Ga0451843_0918627 Ga0451843_0918627_626_1276 214
549 3300041512 Ga0451853_2102187 Ga0451853_2102187_294_944 214
550 3300042876 Ga0451577_0001644 Ga0451577_0001644_25468_26115 214
551 3300042876 Ga0451577_0019299 Ga0451577_0019299_821_1471 214
552 3300042876 Ga0451577_0090372 Ga0451577_0090372_966_1613 214
553 3300044536 Ga0466988_0126519 Ga0466988_0126519_529_1176 214
554 3300044656 Ga0466969_0034122 Ga0466969_0034122_1647_2294 214
555 3300044673 Ga0453683_0000001 Ga0453683_0000001_397583_398230 214
556 3300044684 Ga0466966_0032201 Ga0466966_0032201_163_810 214
557 3300044712 Ga0453684_0030888 Ga0453684_0030888_3989_4639 214
558 3300045051 Ga0451576_0004852 Ga0451576_0004852_3567_4217 214
559 3300045051 Ga0451576_0023585 Ga0451576_0023585_3263_3910 214
560 3300045051 Ga0451576_0396355 Ga0451576_0396355_408_1055 214
561 3300045051 Ga0451576_0801066 Ga0451576_0801066_169_816 214
562 3300046459 Ga0495629_0030534 Ga0495629_0030534_2925_3578 214
563 3300046459 Ga0495629_0221763 Ga0495629_0221763_437_1084 214
564 3300046462 Ga0495651_0074188 Ga0495651_0074188_1326_1979 214
565 3300046463 Ga0495653_0086422 Ga0495653_0086422_440_1093 214
566 3300046472 Ga0495580_0106700 Ga0495580_0106700_736_1389 214
567 3300046473 Ga0495582_0010846 Ga0495582_0010846_1518_2171 214
568 3300046473 Ga0495582_0515502 Ga0495582_0515502_11_664 214
569 3300046475 Ga0495639_0001749 Ga0495639_0001749_2133_2780 214
570 3300046475 Ga0495639_0008129 Ga0495639_0008129_1196_1849 214
571 3300046476 Ga0495662_0063012 Ga0495662_0063012_35_688 214
572 3300046477 Ga0495664_0027013 Ga0495664_0027013_607_1260 214
573 3300046499 Ga0495594_0034587 Ga0495594_0034587_684_1331 214
574 3300046514 Ga0495618_0245372 Ga0495618_0245372_161_808 214
575 3300046529 Ga0495652_0346811 Ga0495652_0346811_96_749 214
576 3300046535 Ga0495586_0093022 Ga0495586_0093022_277_930 214
577 3300046536 Ga0495587_0011541 Ga0495587_0011541_1078_1731 214
578 3300046539 Ga0495621_0014825 Ga0495621_0014825_647_1300 214
579 3300046539 Ga0495621_0017826 Ga0495621_0017826_490_1137 214
580 3300046539 Ga0495621_0029129 Ga0495621_0029129_680_1327 214
581 3300046543 Ga0495645_0019130 Ga0495645_0019130_103_756 214
582 3300046615 Ga0495656_0002334 Ga0495656_0002334_3299_3946 214
583 3300046664 Ga0495659_0048431 Ga0495659_0048431_742_1395 214
584 3300046674 Ga0495588_0005354 Ga0495588_0005354_2785_3432 214
585 3300046674 Ga0495588_0015765 Ga0495588_0015765_999_1646 214
586 3300046674 Ga0495588_0239637 Ga0495588_0239637_121_768 214
587 3300046675 Ga0495657_0220648 Ga0495657_0220648_409_1062 214
588 3300046678 Ga0495599_0159261 Ga0495599_0159261_10_663 214
589 3300046680 Ga0495646_0151812 Ga0495646_0151812_393_1046 214
590 3300046681 Ga0495647_0004918 Ga0495647_0004918_1827_2474 214
591 3300046681 Ga0495647_0051944 Ga0495647_0051944_399_1052 214
592 3300046683 Ga0495658_0162085 Ga0495658_0162085_303_950 214
593 3300046690 Ga0495624_0201550 Ga0495624_0201550_19_672 214
594 3300046691 Ga0495670_0007312 Ga0495670_0007312_3002_3649 214
595 3300046809 Ga0495600_0009079 Ga0495600_0009079_4507_5160 214
596 3300047315 Ga0495581_0000884 Ga0495581_0000884_6457_7110 214
597 3300047315 Ga0495581_0093324 Ga0495581_0093324_958_1605 214
598 3300047319 Ga0495674_0297422 Ga0495674_0297422_628_1281 214
599 3300047319 Ga0495674_0338409 Ga0495674_0338409_412_1065 214
600 3300047321 Ga0495676_0023077 Ga0495676_0023077_4360_5007 214
601 3300047322 Ga0495680_0097145 Ga0495680_0097145_1419_2072 214
602 3300047444 Ga0495675_0066492 Ga0495675_0066492_41_694 214
603 3300048903 Ga0496100_0008854 Ga0496100_0008854_2289_2936 214
604 3300048903 Ga0496100_0095849 Ga0496100_0095849_149_802 214
605 3300048903 Ga0496100_0154433 Ga0496100_0154433_263_916 214
606 3300048904 Ga0496101_0006811 Ga0496101_0006811_1938_2585 214
607 3300048905 Ga0496102_0024354 Ga0496102_0024354_1990_2637 214
608 3300048905 Ga0496102_0299290 Ga0496102_0299290_120_767 214
609 3300048905 Ga0496102_0304204 Ga0496102_0304204_172_825 214
610 3300048905 Ga0496102_0864825 Ga0496102_0864825_116_763 214
611 3300048906 Ga0496103_0014115 Ga0496103_0014115_2261_2908 214
612 3300048907 Ga0496104_0008062 Ga0496104_0008062_303_956 214
613 3300048908 Ga0496105_0002846 Ga0496105_0002846_9526_10173 214
614 3300048908 Ga0496105_0007694 Ga0496105_0007694_7507_8160 214
615 3300048909 Ga0496106_0049828 Ga0496106_0049828_737_1384 214
616 3300048909 Ga0496106_0298797 Ga0496106_0298797_16_669 214
617 3300048910 Ga0496107_0109918 Ga0496107_0109918_1219_1866 214
618 3300048910 Ga0496107_0543856 Ga0496107_0543856_122_775 214
619 3300048910 Ga0496107_0642817 Ga0496107_0642817_44_697 214
620 3300048911 Ga0496108_0133437 Ga0496108_0133437_183_836 214
621 3300048912 Ga0496109_0052691 Ga0496109_0052691_395_1048 214
622 3300048912 Ga0496109_0463833 Ga0496109_0463833_200_847 214
623 3300048913 Ga0496110_0050474 Ga0496110_0050474_1126_1773 214
624 3300048913 Ga0496110_0076385 Ga0496110_0076385_1826_2473 214
625 3300048914 Ga0496111_0174964 Ga0496111_0174964_657_1304 214
626 3300048915 Ga0496112_0003976 Ga0496112_0003976_5545_6198 214
627 3300048917 Ga0496114_0036130 Ga0496114_0036130_747_1400 214
628 3300048917 Ga0496114_0065046 Ga0496114_0065046_1079_1726 214
629 3300048917 Ga0496114_0323851 Ga0496114_0323851_319_966 214
630 3300048918 Ga0496115_0016079 Ga0496115_0016079_4769_5422 214
631 3300048919 Ga0496116_0013262 Ga0496116_0013262_2925_3581 214
632 3300048920 Ga0496117_0007447 Ga0496117_0007447_9782_10438 214
633 3300048921 Ga0496118_0005503 Ga0496118_0005503_3713_4369 214
634 3300049570 Ga0501033_0094641 Ga0501033_0094641_197_847 214
635 3300049823 Ga0501044_0079154 Ga0501044_0079154_1284_1949 214
636 3300050507 nmdc:mga05p37_228905_c1 nmdc:mga05p37_228905_c1_1009_1656 214
637 3300050510 nmdc:mga06r32_178022_c1 nmdc:mga06r32_178022_c1_757_1404 214
638 3300050511 nmdc:mga08y16_134879_c1 nmdc:mga08y16_134879_c1_1061_1708 214
639 3300050511 nmdc:mga08y16_247782_c1 nmdc:mga08y16_247782_c1_1088_1738 214
640 3300050511 nmdc:mga08y16_2942_c1 nmdc:mga08y16_2942_c1_1604_2251 214
641 3300050513 nmdc:mga0rr50_177103_c1 nmdc:mga0rr50_177103_c1_877_1524 214
642 3300050513 nmdc:mga0rr50_425891_c1 nmdc:mga0rr50_425891_c1_421_1071 214
643 3300050515 nmdc:mga0a205_324629_c1 nmdc:mga0a205_324629_c1_119_766 214
644 3300053085 Ga0495619_0001956 Ga0495619_0001956_4471_5124 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

29

225

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8593 1 214
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8479 1 214
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7927 1 214
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7813 1 214
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7601 1 214
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8366 2 214 3.40.430.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8101 2 214 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7927 1 214 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7813 1 214 3.40.430.10
3zutA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7471 196 212 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A536TPP6-F1-model_v4 Dihydrofolate reductase 0.9834 141 214 GO:0008703
GO:0009231
AF-A0A533J7Y1-F1-model_v4 deleted 0.981 2 214
AF-A0A536U3N6-F1-model_v4 Dihydrofolate reductase 0.9806 1 214 GO:0008703
GO:0009231
AF-A0A546Y8P0-F1-model_v4 Dihydrofolate reductase 0.9793 1 214 GO:0008703
GO:0009231
AF-A0A1E3EWY2-F1-model_v4 deleted 0.9782 1 214

Feature Viewer

pLDDT pTM Quality
92.3 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map