F471994

General Info

Members Datasets Scaffolds Average Seq Length
643 255 1286 329

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0002785|Ga0500622_0002785_1274_2377
Length 367
Sequence MNVTAGDISRFLRGGGLDPSPFIFYWHFLYFFAIVKSDGEMKKRIALVTGGYSGEAEISYKSVVTVANNIDTDKFLVYKIDINPSGWYYLPANGDQLPVDKSDFTITDNGQKITFDAVLLCIHGTPGEDGKLQGYFDLLGLPYTSCDAATSALTFNKRYTVAVVAFGGIHVARSVLLIKDRFENAEELVKELQFPVFIKPNNGGSSIGMSRVNQPSEELGNAIEKAFKEDDQVLVEEFIQGREFTIGVFRSKGKIMTLPMTEVISKNEFFDFEAKYLGKSEEITPAKVDEAIAEKIRKAAERIYEILNCRGIVRIDFIYNEAKGEPYMLEVNTVPGQSEASIVPQQVKAMGWTLKDFYTAVIEEALA

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
213 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
214 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
215 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
218 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
219 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
220 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
221 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
222 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
223 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
224 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
225 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
226 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
227 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
228 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
232 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
245 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
246 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
251 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
252 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
254 2738541278 Niastella sp. CF465 Isolate Unclassified
255 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 0
Rhizoplane 0.31
Rhizosphere 92.07
Stem 0
Stem Tuber 0
Unclassified 9.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0002785 3300053156 Bacteria 12290
2 JGI25406J46586_10003879 3300003203 Bacteria 6989
3 rootH1_10035049 3300003316 Bacteria 2403
4 rootH2_10000085 3300003320 Bacteria 19837
5 rootH2_10000087 3300003320 Bacteria 18613
6 rootH2_10037716 3300003320 Bacteria 9066
7 rootH2_10123085 3300003320 Bacteria 1154
8 rootH2_10172890 3300003320 Bacteria 7005
9 rootH2_10179671 3300003320 Bacteria 1527
10 rootL2_10084205 3300003322 Unclassified 1401
11 rootL2_10144132 3300003322 Bacteria 2012
12 rootH1_10045695 3300003323 Bacteria 15711
13 JGI25160J50197_1002200 3300003354 Bacteria 9166
14 Ga0070658_10166585 3300005327 Bacteria 1850
15 Ga0070658_10232684 3300005327 Bacteria 1560
16 Ga0070676_10020427 3300005328 Bacteria 3697
17 Ga0070676_10266592 3300005328 Unclassified 1149
18 Ga0070683_100000400 3300005329 Bacteria 29886
19 Ga0070683_100001255 3300005329 Bacteria 19307
20 Ga0070683_100025684 3300005329 Bacteria 5294
21 Ga0070683_100236960 3300005329 Bacteria 1735
22 Ga0070690_100032894 3300005330 Bacteria 3242
23 Ga0070670_100034630 3300005331 Bacteria 4346
24 Ga0070670_100182681 3300005331 Unclassified 1821
25 Ga0070677_10025358 3300005333 Bacteria 2213
26 Ga0070677_10063901 3300005333 Bacteria 1527
27 Ga0068869_100005895 3300005334 Bacteria 7737
28 Ga0068869_100011637 3300005334 Bacteria 5780
29 Ga0068869_100048976 3300005334 Bacteria 3058
30 Ga0068869_100054407 3300005334 Bacteria 2913
31 Ga0070666_10000131 3300005335 Bacteria 52822
32 Ga0070666_10105668 3300005335 Bacteria 1945
33 Ga0070680_100000390 3300005336 Bacteria 29749
34 Ga0070682_100002004 3300005337 Bacteria 11372
35 Ga0070682_100018566 3300005337 Bacteria 4070
36 Ga0070682_100128056 3300005337 Bacteria 1714
37 Ga0068868_100047496 3300005338 Bacteria 3365
38 Ga0068868_100106538 3300005338 Bacteria 2274
39 Ga0070660_100016553 3300005339 Bacteria 5353
40 Ga0070689_100007636 3300005340 Bacteria 7573
41 Ga0070689_100032629 3300005340 Bacteria 3962
42 Ga0070689_100120634 3300005340 Bacteria 2094
43 Ga0070691_10000447 3300005341 Bacteria 15259
44 Ga0070691_10072428 3300005341 Bacteria 1674
45 Ga0070691_10090351 3300005341 Bacteria 1509
46 Ga0070687_100049084 3300005343 Bacteria 2174
47 Ga0070661_100016523 3300005344 Bacteria 5220
48 Ga0070668_100086575 3300005347 Bacteria 2464
49 Ga0070669_100049866 3300005353 Bacteria 3057
50 Ga0070675_100007389 3300005354 Bacteria 8486
51 Ga0070675_100034196 3300005354 Bacteria 4123
52 Ga0070675_100047572 3300005354 Bacteria 3514
53 Ga0070675_100079638 3300005354 Bacteria 2730
54 Ga0070675_100080620 3300005354 Bacteria 2713
55 Ga0070675_100083343 3300005354 Bacteria 2669
56 Ga0070671_100051228 3300005355 Bacteria 3433
57 Ga0070671_100151075 3300005355 Unclassified 1961
58 Ga0070671_100361492 3300005355 Bacteria 1239
59 Ga0070674_100049227 3300005356 Bacteria 2897
60 Ga0070674_100063085 3300005356 Bacteria 2592
61 Ga0070673_100056257 3300005364 Bacteria 3103
62 Ga0070673_100063719 3300005364 Bacteria 2934
63 Ga0070673_100170059 3300005364 Bacteria 1859
64 Ga0070688_100108462 3300005365 Unclassified 1842
65 Ga0070659_100007127 3300005366 Bacteria 8110
66 Ga0070659_100086478 3300005366 Bacteria 2509
67 Ga0070667_100003934 3300005367 Bacteria 12618
68 Ga0070667_100006801 3300005367 Bacteria 9500
69 Ga0070667_100009024 3300005367 Bacteria 8252
70 Ga0070667_100221922 3300005367 Bacteria 1682
71 Ga0070667_100351143 3300005367 Bacteria 1335
72 Ga0070700_100158495 3300005441 Bacteria 1555
73 Ga0070700_100166345 3300005441 Bacteria 1523
74 Ga0070678_100049383 3300005456 Bacteria 3036
75 Ga0070678_100113031 3300005456 Unclassified 2128
76 Ga0070662_100019394 3300005457 Bacteria 4616
77 Ga0070662_100019478 3300005457 Bacteria 4606
78 Ga0070662_100304744 3300005457 Unclassified 1295
79 Ga0070681_10119292 3300005458 Unclassified 2574
80 Ga0068867_100022701 3300005459 Bacteria 4488
81 Ga0068867_100080509 3300005459 Bacteria 2453
82 Ga0068867_100105048 3300005459 Unclassified 2162
83 Ga0068867_100155200 3300005459 Bacteria 1801
84 Ga0068867_100156228 3300005459 Bacteria 1796
85 Ga0070685_10024548 3300005466 Unclassified 3312
86 Ga0070698_100000219 3300005471 Bacteria 56179
87 Ga0070698_100001176 3300005471 Bacteria 29035
88 Ga0070698_100012636 3300005471 Bacteria 8940
89 Ga0070679_100000978 3300005530 Bacteria 24898
90 Ga0070679_100003533 3300005530 Bacteria 14315
91 Ga0070679_100132564 3300005530 Bacteria 2473
92 Ga0070684_100006302 3300005535 Bacteria 9168
93 Ga0070684_100013840 3300005535 Bacteria 6515
94 Ga0070684_100067038 3300005535 Bacteria 3151
95 Ga0070684_100148132 3300005535 Bacteria 2125
96 Ga0068853_100004745 3300005539 Bacteria 10564
97 Ga0068853_100005079 3300005539 Bacteria 10268
98 Ga0068853_100038178 3300005539 Bacteria 4090
99 Ga0068853_100059890 3300005539 Bacteria 3289
100 Ga0068853_100191786 3300005539 Unclassified 1857
101 Ga0068853_100438681 3300005539 Bacteria 1227
102 Ga0070672_100123986 3300005543 Bacteria 2118
103 Ga0070672_100212867 3300005543 Bacteria 1619
104 Ga0070672_100332746 3300005543 Bacteria 1292
105 Ga0070686_100112117 3300005544 Bacteria 1860
106 Ga0070693_100034122 3300005547 Bacteria 2814
107 Ga0070693_100060405 3300005547 Bacteria 2200
108 Ga0070693_100193559 3300005547 Bacteria 1316
109 Ga0070665_100000013 3300005548 Bacteria 484927
110 Ga0070665_100334214 3300005548 Bacteria 1520
111 Ga0068855_100006383 3300005563 Bacteria 14369
112 Ga0068855_100024391 3300005563 Bacteria 7236
113 Ga0068855_100025397 3300005563 Bacteria 7089
114 Ga0068855_100276197 3300005563 Bacteria 1867
115 Ga0068855_100684839 3300005563 Unclassified 1098
116 Ga0070664_100043469 3300005564 Bacteria 3791
117 Ga0070664_100076792 3300005564 Bacteria 2871
118 Ga0070664_100100070 3300005564 Bacteria 2520
119 Ga0070664_100237884 3300005564 Bacteria 1634
120 Ga0070664_100507741 3300005564 Bacteria 1112
121 Ga0068857_100016474 3300005577 Bacteria 6476
122 Ga0068857_100022194 3300005577 Bacteria 5584
123 Ga0068857_100028172 3300005577 Bacteria 4956
124 Ga0068854_100119692 3300005578 Bacteria 1997
125 Ga0068856_100033441 3300005614 Bacteria 5034
126 Ga0068856_100042396 3300005614 Bacteria 4476
127 Ga0068856_100049615 3300005614 Bacteria 4137
128 Ga0068856_100060221 3300005614 Bacteria 3751
129 Ga0068856_100303100 3300005614 Bacteria 1615
130 Ga0068852_100000841 3300005616 Bacteria 20362
131 Ga0068852_100007666 3300005616 Bacteria 7895
132 Ga0068852_100010853 3300005616 Bacteria 6826
133 Ga0068852_100039549 3300005616 Bacteria 3971
134 Ga0068852_100043264 3300005616 Bacteria 3819
135 Ga0068852_100058305 3300005616 Bacteria 3344
136 Ga0068852_100251663 3300005616 Bacteria 1693
137 Ga0068859_100001063 3300005617 Bacteria 28112
138 Ga0068859_100010717 3300005617 Bacteria 9224
139 Ga0068859_100013679 3300005617 Bacteria 8134
140 Ga0068859_100163116 3300005617 Bacteria 2308
141 Ga0068859_100546998 3300005617 Bacteria 1252
142 Ga0068864_100002583 3300005618 Bacteria 14954
143 Ga0068864_100021697 3300005618 Bacteria 5379
144 Ga0068864_100150935 3300005618 Bacteria 2105
145 Ga0068866_10012212 3300005718 Bacteria 3741
146 Ga0068866_10221768 3300005718 Bacteria 1141
147 Ga0068861_100102913 3300005719 Unclassified 2275
148 Ga0068861_100121392 3300005719 Bacteria 2109
149 Ga0068861_100190082 3300005719 Unclassified 1716
150 Ga0068861_100233276 3300005719 Bacteria 1562
151 Ga0068861_100252623 3300005719 Unclassified 1505
152 Ga0068863_100018196 3300005841 Bacteria 6728
153 Ga0068863_100044241 3300005841 Bacteria 4227
154 Ga0068863_100082900 3300005841 Bacteria 3038
155 Ga0068863_100154487 3300005841 Bacteria 2197
156 Ga0068863_100166852 3300005841 Unclassified 2111
157 Ga0068863_100363229 3300005841 Bacteria 1412
158 Ga0068863_100494741 3300005841 Bacteria 1204
159 Ga0068863_100501556 3300005841 Bacteria 1195
160 Ga0068858_100032273 3300005842 Bacteria 4864
161 Ga0068858_100225996 3300005842 Unclassified 1773
162 Ga0068860_100000060 3300005843 Bacteria 195631
163 Ga0068860_100001033 3300005843 Bacteria 30635
164 Ga0068860_100007422 3300005843 Bacteria 10964
165 Ga0068860_100007709 3300005843 Bacteria 10765
166 Ga0068860_100009079 3300005843 Bacteria 9893
167 Ga0068860_100030246 3300005843 Bacteria 5208
168 Ga0068860_100059325 3300005843 Bacteria 3638
169 Ga0068860_100149470 3300005843 Bacteria 2249
170 Ga0068860_100296295 3300005843 Unclassified 1584
171 Ga0068860_100392203 3300005843 Bacteria 1372
172 Ga0068860_100580648 3300005843 Unclassified 1125
173 Ga0081539_10000338 3300005985 Bacteria 103849
174 Ga0070715_10069368 3300006163 Bacteria 1570
175 Ga0075366_10028648 3300006195 Bacteria 3269
176 Ga0075366_10038423 3300006195 Bacteria 2827
177 Ga0097621_100000224 3300006237 Bacteria 37801
178 Ga0097621_100018734 3300006237 Bacteria 5296
179 Ga0097621_100056797 3300006237 Bacteria 3198
180 Ga0097621_100105024 3300006237 Bacteria 2381
181 Ga0068871_100000332 3300006358 Bacteria 32762
182 Ga0068871_100224234 3300006358 Bacteria 1629
183 Ga0068871_100350335 3300006358 Unclassified 1306
184 Ga0075428_100003660 3300006844 Bacteria 16850
185 Ga0075428_100076912 3300006844 Bacteria 3644
186 Ga0075430_100046805 3300006846 Bacteria 3652
187 Ga0075430_100142445 3300006846 Bacteria 1996
188 Ga0075431_100040770 3300006847 Bacteria 4786
189 Ga0075431_100054947 3300006847 Bacteria 4106
190 Ga0075434_100065140 3300006871 Bacteria 3629
191 Ga0075429_100014332 3300006880 Bacteria 6875
192 Ga0075429_100021570 3300006880 Bacteria 5584
193 Ga0075429_100072409 3300006880 Bacteria 3001
194 Ga0068865_100116690 3300006881 Bacteria 1978
195 Ga0097620_100001063 3300006931 Bacteria 28112
196 Ga0097620_100010717 3300006931 Bacteria 9224
197 Ga0097620_100013679 3300006931 Bacteria 8134
198 Ga0097620_100163122 3300006931 Bacteria 2308
199 Ga0097620_100546951 3300006931 Bacteria 1252
200 Ga0105240_10000716 3300009093 Bacteria 60717
201 Ga0105240_10001832 3300009093 Bacteria 35593
202 Ga0105240_10002222 3300009093 Bacteria 31574
203 Ga0105240_10002441 3300009093 Bacteria 29891
204 Ga0105240_10003315 3300009093 Bacteria 25162
205 Ga0105240_10024073 3300009093 Bacteria 8039
206 Ga0105240_10026196 3300009093 Bacteria 7651
207 Ga0105240_10084202 3300009093 Bacteria 3899
208 Ga0105240_10087201 3300009093 Bacteria 3822
209 Ga0111539_10056336 3300009094 Bacteria 4672
210 Ga0111539_10148620 3300009094 Bacteria 2743
211 Ga0105247_10010405 3300009101 Bacteria 5625
212 Ga0114129_10010756 3300009147 Bacteria 13042
213 Ga0114129_10038918 3300009147 Bacteria 6703
214 Ga0114129_10185693 3300009147 Bacteria 2826
215 Ga0105241_10000638 3300009174 Bacteria 26414
216 Ga0105241_10000663 3300009174 Bacteria 25854
217 Ga0105241_10000951 3300009174 Bacteria 21901
218 Ga0105241_10179485 3300009174 Bacteria 1755
219 Ga0105242_10023643 3300009176 Bacteria 4844
220 Ga0105242_10101036 3300009176 Bacteria 2444
221 Ga0105242_10259781 3300009176 Bacteria 1568
222 Ga0105248_10062283 3300009177 Bacteria 4189
223 Ga0105248_10231012 3300009177 Bacteria 2082
224 Ga0105237_10004518 3300009545 Bacteria 16074
225 Ga0105237_10006836 3300009545 Bacteria 12574
226 Ga0105237_10012641 3300009545 Bacteria 8887
227 Ga0105237_10018930 3300009545 Bacteria 7116
228 Ga0105237_10050183 3300009545 Bacteria 4193
229 Ga0105237_10060695 3300009545 Bacteria 3782
230 Ga0105237_10247069 3300009545 Bacteria 1786
231 Ga0105238_10001000 3300009551 Bacteria 28850
232 Ga0105238_10043348 3300009551 Bacteria 4553
233 Ga0105249_10009926 3300009553 Bacteria 8347
234 Ga0105249_10016990 3300009553 Bacteria 6455
235 Ga0105249_10255424 3300009553 Bacteria 1739
236 Ga0105239_10000457 3300010375 Bacteria 59635
237 Ga0105239_10001641 3300010375 Bacteria 29489
238 Ga0105239_10001821 3300010375 Bacteria 27926
239 Ga0105239_10003232 3300010375 Bacteria 20139
240 Ga0105239_10045274 3300010375 Bacteria 4822
241 Ga0105239_10060506 3300010375 Bacteria 4157
242 Ga0105239_10078913 3300010375 Bacteria 3623
243 Ga0105239_10668041 3300010375 Bacteria 1187
244 Ga0157373_10056080 3300013100 Bacteria 2798
245 Ga0157373_10085899 3300013100 Bacteria 2217
246 Ga0157373_10114970 3300013100 Bacteria 1892
247 Ga0157373_10128997 3300013100 Unclassified 1778
248 Ga0157371_10007803 3300013102 Bacteria 8600
249 Ga0157371_10012641 3300013102 Bacteria 6442
250 Ga0157371_10123916 3300013102 Bacteria 1838
251 Ga0157371_10131248 3300013102 Bacteria 1782
252 Ga0157371_10178856 3300013102 Bacteria 1517
253 Ga0157371_10326456 3300013102 Bacteria 1114
254 Ga0157370_10001459 3300013104 Bacteria 29237
255 Ga0157370_10005908 3300013104 Bacteria 13644
256 Ga0157370_10041274 3300013104 Bacteria 4453
257 Ga0157370_10264894 3300013104 Bacteria 1588
258 Ga0157369_10007843 3300013105 Bacteria 12282
259 Ga0157369_10044314 3300013105 Bacteria 4843
260 Ga0157369_10101317 3300013105 Bacteria 3069
261 Ga0157369_10126804 3300013105 Bacteria 2706
262 Ga0157369_10220148 3300013105 Unclassified 1987
263 Ga0157369_10386331 3300013105 Bacteria 1453
264 Ga0157374_10000007 3300013296 Bacteria 595643
265 Ga0157374_10002698 3300013296 Bacteria 14920
266 Ga0157374_10035877 3300013296 Bacteria 4539
267 Ga0157374_10228364 3300013296 Bacteria 1828
268 Ga0157374_10248334 3300013296 Unclassified 1751
269 Ga0157374_10252400 3300013296 Bacteria 1736
270 Ga0157374_10284226 3300013296 Bacteria 1634
271 Ga0157374_10421978 3300013296 Bacteria 1333
272 Ga0157378_10001566 3300013297 Bacteria 20661
273 Ga0157378_10004338 3300013297 Bacteria 12476
274 Ga0157378_10015870 3300013297 Bacteria 6595
275 Ga0157378_10044439 3300013297 Bacteria 3945
276 Ga0157378_10203487 3300013297 Unclassified 1873
277 Ga0163162_10002272 3300013306 Bacteria 18040
278 Ga0163162_10002720 3300013306 Bacteria 16777
279 Ga0163162_10004931 3300013306 Bacteria 12864
280 Ga0163162_10012600 3300013306 Bacteria 8258
281 Ga0163162_10030449 3300013306 Bacteria 5347
282 Ga0163162_10057971 3300013306 Unclassified 3901
283 Ga0163162_10122932 3300013306 Bacteria 2700
284 Ga0163162_10243034 3300013306 Bacteria 1931
285 Ga0163162_10419164 3300013306 Bacteria 1471
286 Ga0163162_10607531 3300013306 Bacteria 1219
287 Ga0157372_10001489 3300013307 Bacteria 25446
288 Ga0157372_10002526 3300013307 Bacteria 19845
289 Ga0157372_10018798 3300013307 Bacteria 7434
290 Ga0157372_10045235 3300013307 Bacteria 4882
291 Ga0157372_10074427 3300013307 Bacteria 3830
292 Ga0157372_10098568 3300013307 Unclassified 3334
293 Ga0157372_10116283 3300013307 Unclassified 3066
294 Ga0157372_10164498 3300013307 Bacteria 2565
295 Ga0157372_10181766 3300013307 Bacteria 2435
296 Ga0157372_10195354 3300013307 Bacteria 2344
297 Ga0157372_10199128 3300013307 Bacteria 2320
298 Ga0157372_10214405 3300013307 Bacteria 2231
299 Ga0157372_10463302 3300013307 Bacteria 1477
300 Ga0157375_10003126 3300013308 Bacteria 14379
301 Ga0157375_10060581 3300013308 Bacteria 3754
302 Ga0157375_10092711 3300013308 Bacteria 3085
303 Ga0157375_10094990 3300013308 Bacteria 3051
304 Ga0157375_10264045 3300013308 Bacteria 1883
305 Ga0157375_10391094 3300013308 Bacteria 1557
306 Ga0163163_10000614 3300014325 Bacteria 30837
307 Ga0163163_10000975 3300014325 Bacteria 24280
308 Ga0163163_10010980 3300014325 Bacteria 8185
309 Ga0163163_10059021 3300014325 Bacteria 3794
310 Ga0163163_10143601 3300014325 Bacteria 2430
311 Ga0163163_10275027 3300014325 Bacteria 1735
312 Ga0157380_10027888 3300014326 Bacteria 4300
313 Ga0157380_10033885 3300014326 Bacteria 3934
314 Ga0157377_10019788 3300014745 Bacteria 3520
315 Ga0157377_10019977 3300014745 Bacteria 3503
316 Ga0157377_10052101 3300014745 Bacteria 2310
317 Ga0157377_10084732 3300014745 Bacteria 1859
318 Ga0157379_10027846 3300014968 Bacteria 5030
319 Ga0157379_10092388 3300014968 Bacteria 2715
320 Ga0157379_10111687 3300014968 Bacteria 2455
321 Ga0157376_10003332 3300014969 Bacteria 11051
322 Ga0157376_10116987 3300014969 Bacteria 2356
323 Ga0157376_10227720 3300014969 Bacteria 1730
324 Ga0163161_10009952 3300017792 Bacteria 6587
325 Ga0163161_10019608 3300017792 Bacteria 4744
326 Ga0163161_10392166 3300017792 Bacteria 1112
327 Ga0207426_1000230 3300025302 Bacteria 128357
328 Ga0207697_10035615 3300025315 Bacteria 2038
329 Ga0207682_10020597 3300025893 Unclassified 2589
330 Ga0207642_10006319 3300025899 Bacteria 3929
331 Ga0207710_10002831 3300025900 Bacteria 7905
332 Ga0207688_10084418 3300025901 Bacteria 1818
333 Ga0207680_10000211 3300025903 Bacteria 28081
334 Ga0207680_10045259 3300025903 Bacteria 2593
335 Ga0207680_10323678 3300025903 Unclassified 1078
336 Ga0207647_10028230 3300025904 Unclassified 3648
337 Ga0207647_10226302 3300025904 Unclassified 1077
338 Ga0207645_10011191 3300025907 Bacteria 6137
339 Ga0207705_10013019 3300025909 Bacteria 6004
340 Ga0207705_10205129 3300025909 Bacteria 1494
341 Ga0207654_10000832 3300025911 Bacteria 16989
342 Ga0207654_10000989 3300025911 Bacteria 15563
343 Ga0207654_10122194 3300025911 Unclassified 1637
344 Ga0207707_10001200 3300025912 Bacteria 24391
345 Ga0207707_10110849 3300025912 Unclassified 2399
346 Ga0207695_10000130 3300025913 Bacteria 224214
347 Ga0207695_10000170 3300025913 Bacteria 192469
348 Ga0207695_10000862 3300025913 Bacteria 55457
349 Ga0207695_10003201 3300025913 Bacteria 23318
350 Ga0207695_10010277 3300025913 Bacteria 11466
351 Ga0207695_10060482 3300025913 Bacteria 3921
352 Ga0207695_10101575 3300025913 Unclassified 2870
353 Ga0207695_10110650 3300025913 Bacteria 2727
354 Ga0207671_10001678 3300025914 Bacteria 25122
355 Ga0207671_10005137 3300025914 Bacteria 12192
356 Ga0207671_10006115 3300025914 Bacteria 10827
357 Ga0207671_10008056 3300025914 Bacteria 9007
358 Ga0207671_10028140 3300025914 Bacteria 4201
359 Ga0207671_10044381 3300025914 Bacteria 3288
360 Ga0207671_10144141 3300025914 Bacteria 1837
361 Ga0207671_10152500 3300025914 Bacteria 1786
362 Ga0207671_10245135 3300025914 Bacteria 1408
363 Ga0207660_10000111 3300025917 Bacteria 46780
364 Ga0207660_10033982 3300025917 Bacteria 3531
365 Ga0207662_10081461 3300025918 Bacteria 1976
366 Ga0207657_10011713 3300025919 Bacteria 8689
367 Ga0207649_10007160 3300025920 Bacteria 6062
368 Ga0207649_10018394 3300025920 Bacteria 3974
369 Ga0207652_10000460 3300025921 Bacteria 42038
370 Ga0207652_10019639 3300025921 Bacteria 5560
371 Ga0207681_10197403 3300025923 Bacteria 1543
372 Ga0207694_10038576 3300025924 Bacteria 3673
373 Ga0207650_10013502 3300025925 Bacteria 5659
374 Ga0207650_10023614 3300025925 Bacteria 4363
375 Ga0207650_10166649 3300025925 Unclassified 1749
376 Ga0207650_10476314 3300025925 Bacteria 1041
377 Ga0207659_10019500 3300025926 Bacteria 4466
378 Ga0207659_10020457 3300025926 Bacteria 4376
379 Ga0207659_10047844 3300025926 Bacteria 3026
380 Ga0207659_10288537 3300025926 Unclassified 1344
381 Ga0207644_10144289 3300025931 Bacteria 1836
382 Ga0207644_10454088 3300025931 Bacteria 1053
383 Ga0207690_10044302 3300025932 Bacteria 2932
384 Ga0207706_10001784 3300025933 Bacteria 21146
385 Ga0207686_10005476 3300025934 Bacteria 6813
386 Ga0207686_10151299 3300025934 Bacteria 1616
387 Ga0207670_10178382 3300025936 Bacteria 1598
388 Ga0207669_10008284 3300025937 Bacteria 4871
389 Ga0207669_10106985 3300025937 Bacteria 1864
390 Ga0207704_10064329 3300025938 Bacteria 2291
391 Ga0207691_10014629 3300025940 Bacteria 7480
392 Ga0207691_10034399 3300025940 Bacteria 4712
393 Ga0207691_10088442 3300025940 Bacteria 2778
394 Ga0207691_10102501 3300025940 Bacteria 2553
395 Ga0207691_10328777 3300025940 Bacteria 1310
396 Ga0207711_10131212 3300025941 Bacteria 2247
397 Ga0207689_10009728 3300025942 Bacteria 8280
398 Ga0207689_10033496 3300025942 Unclassified 4269
399 Ga0207689_10063117 3300025942 Bacteria 3047
400 Ga0207689_10161880 3300025942 Bacteria 1844
401 Ga0207689_10172922 3300025942 Bacteria 1781
402 Ga0207689_10241637 3300025942 Unclassified 1493
403 Ga0207661_10002005 3300025944 Bacteria 14029
404 Ga0207679_10009832 3300025945 Bacteria 6140
405 Ga0207679_10045920 3300025945 Bacteria 3163
406 Ga0207679_10046617 3300025945 Bacteria 3143
407 Ga0207679_10116782 3300025945 Bacteria 2116
408 Ga0207679_10168953 3300025945 Bacteria 1798
409 Ga0207679_10235281 3300025945 Bacteria 1549
410 Ga0207667_10000131 3300025949 Bacteria 115088
411 Ga0207667_10000915 3300025949 Bacteria 37602
412 Ga0207667_10015105 3300025949 Bacteria 8779
413 Ga0207667_10085346 3300025949 Bacteria 3268
414 Ga0207667_10170699 3300025949 Bacteria 2235
415 Ga0207651_10052740 3300025960 Bacteria 2775
416 Ga0207651_10179899 3300025960 Bacteria 1677
417 Ga0207712_10005772 3300025961 Bacteria 7798
418 Ga0207712_10008099 3300025961 Bacteria 6648
419 Ga0207712_10021586 3300025961 Bacteria 4228
420 Ga0207712_10032988 3300025961 Unclassified 3498
421 Ga0207640_10097090 3300025981 Bacteria 2056
422 Ga0207640_10188019 3300025981 Unclassified 1554
423 Ga0207658_10015530 3300025986 Bacteria 5224
424 Ga0207658_10071470 3300025986 Bacteria 2628
425 Ga0207658_10214814 3300025986 Bacteria 1614
426 Ga0207658_10343397 3300025986 Bacteria 1298
427 Ga0207677_10029949 3300026023 Bacteria 3467
428 Ga0207677_10046500 3300026023 Bacteria 2906
429 Ga0207677_10455831 3300026023 Bacteria 1097
430 Ga0207703_10056415 3300026035 Bacteria 3199
431 Ga0207639_10126655 3300026041 Bacteria 2107
432 Ga0207639_10136706 3300026041 Bacteria 2036
433 Ga0207708_10188478 3300026075 Bacteria 1641
434 Ga0207702_10034739 3300026078 Bacteria 4217
435 Ga0207702_10200616 3300026078 Bacteria 1849
436 Ga0207641_10000299 3300026088 Bacteria 62004
437 Ga0207641_10039341 3300026088 Bacteria 3955
438 Ga0207641_10124013 3300026088 Unclassified 2310
439 Ga0207641_10137777 3300026088 Bacteria 2198
440 Ga0207648_10026160 3300026089 Bacteria 5188
441 Ga0207648_10031074 3300026089 Bacteria 4723
442 Ga0207648_10034165 3300026089 Bacteria 4484
443 Ga0207648_10100306 3300026089 Bacteria 2536
444 Ga0207648_10122426 3300026089 Bacteria 2287
445 Ga0207676_10006593 3300026095 Bacteria 8212
446 Ga0207676_10044594 3300026095 Bacteria 3422
447 Ga0207676_10061287 3300026095 Unclassified 2978
448 Ga0207676_10153658 3300026095 Bacteria 1985
449 Ga0207676_10183407 3300026095 Bacteria 1835
450 Ga0207676_10200057 3300026095 Unclassified 1765
451 Ga0207674_10011272 3300026116 Bacteria 10047
452 Ga0207674_10028571 3300026116 Bacteria 5885
453 Ga0207674_10036031 3300026116 Bacteria 5160
454 Ga0207674_10083573 3300026116 Bacteria 3192
455 Ga0207674_10111291 3300026116 Bacteria 2713
456 Ga0207675_100060296 3300026118 Bacteria 3542
457 Ga0207675_100078728 3300026118 Unclassified 3089
458 Ga0207675_100182793 3300026118 Bacteria 2008
459 Ga0207675_100186418 3300026118 Unclassified 1989
460 Ga0207675_100230279 3300026118 Unclassified 1788
461 Ga0207683_10011258 3300026121 Bacteria 7625
462 Ga0207683_10171577 3300026121 Bacteria 1964
463 Ga0207683_10258147 3300026121 Bacteria 1591
464 Ga0207698_10009265 3300026142 Bacteria 6265
465 Ga0207698_10011547 3300026142 Bacteria 5733
466 Ga0207698_10017479 3300026142 Bacteria 4867
467 Ga0207698_10019122 3300026142 Bacteria 4682
468 Ga0207698_10042460 3300026142 Bacteria 3398
469 Ga0207698_10044597 3300026142 Bacteria 3333
470 Ga0207698_10201476 3300026142 Bacteria 1782
471 Ga0207698_10313375 3300026142 Bacteria 1466
472 Ga0207698_10390682 3300026142 Bacteria 1326
473 Ga0268266_10000024 3300028379 Bacteria 490820
474 Ga0268266_10268472 3300028379 Bacteria 1583
475 Ga0268264_10000915 3300028381 Bacteria 30897
476 Ga0268264_10002496 3300028381 Bacteria 16173
477 Ga0268264_10007415 3300028381 Bacteria 9158
478 Ga0268264_10009106 3300028381 Bacteria 8232
479 Ga0268264_10013812 3300028381 Bacteria 6642
480 Ga0268264_10015007 3300028381 Bacteria 6355
481 Ga0268264_10029510 3300028381 Bacteria 4493
482 Ga0268264_10614260 3300028381 Bacteria 1073
483 Ga0307517_10002909 3300028786 Bacteria 27119
484 Ga0307511_10003880 3300030521 Bacteria 15274
485 Ga0265327_10000107 3300031251 Bacteria 183770
486 Ga0307513_10149095 3300031456 Bacteria 2251
487 Ga0307509_10053115 3300031507 Bacteria 4323
488 Ga0307509_10111172 3300031507 Bacteria 2743
489 Ga0307508_10010090 3300031616 Bacteria 8654
490 Ga0307516_10030501 3300031730 Bacteria 5439
491 Ga0307516_10242125 3300031730 Unclassified 1502
492 Ga0307407_10176265 3300031903 Bacteria 1413
493 Ga0307414_10048201 3300032004 Bacteria 2938
494 Ga0307414_10195332 3300032004 Bacteria 1641
495 Ga0307411_10060442 3300032005 Bacteria 2517
496 Ga0307510_10067772 3300033180 Bacteria 3588
497 Ga0373961_0060783 3300035241 Bacteria 1146
498 Ga0373937_0015761 3300036401 Bacteria 6695
499 Ga0373937_0178519 3300036401 Bacteria 1994
500 Ga0373925_0256422 3300037068 Unclassified 1404
501 Ga0395900_0178528 3300037418 Bacteria 2159
502 Ga0395900_0638564 3300037418 Unclassified 1002
503 Ga0395905_0001101 3300037471 Bacteria 33997
504 Ga0395905_0299003 3300037471 Bacteria 1497
505 Ga0436365_0577581 3300039437 Bacteria 30054
506 Ga0436365_1377856 3300039437 Bacteria 10058
507 Ga0439439_0012279 3300041406 Bacteria 2070
508 Ga0451791_1580852 3300041451 Bacteria 1383
509 Ga0451800_1271054 3300041459 Bacteria 1185
510 Ga0451853_0641177 3300041512 Bacteria 1698
511 Ga0439433_0008668 3300041999 Bacteria 2208
512 Ga0439449_0004466 3300042007 Bacteria 5400
513 Ga0439449_0004488 3300042007 Bacteria 5391
514 Ga0439457_000424 3300042014 Bacteria 12137
515 Ga0439462_0001182 3300042015 Bacteria 5702
516 Ga0466969_0000947 3300044656 Bacteria 15637
517 Ga0466972_0000003 3300044658 Bacteria 391452
518 Ga0466972_0000028 3300044658 Bacteria 171140
519 Ga0466972_0043134 3300044658 Bacteria 2191
520 Ga0466966_0001580 3300044684 Bacteria 14628
521 Ga0466961_0007419 3300044693 Bacteria 6981
522 Ga0453684_0019974 3300044712 Bacteria 10155
523 Ga0453684_0163878 3300044712 Bacteria 2626
524 Ga0453684_0167918 3300044712 Bacteria 2589
525 Ga0453684_0197287 3300044712 Bacteria 2349
526 Ga0453684_0401664 3300044712 Bacteria 1535
527 Ga0466971_0050137 3300044719 Bacteria 1878
528 Ga0466970_0001690 3300044765 Bacteria 10612
529 Ga0466957_0001474 3300044842 Bacteria 12340
530 Ga0466957_0011296 3300044842 Bacteria 5148
531 Ga0466957_0073998 3300044842 Unclassified 2112
532 Ga0466959_0000002 3300045049 Bacteria 362671
533 Ga0466959_0071277 3300045049 Bacteria 2516
534 Ga0466959_0106080 3300045049 Unclassified 2009
535 Ga0451576_0085615 3300045051 Bacteria 3279
536 Ga0495629_0051562 3300046459 Unclassified 2880
537 Ga0495580_0051484 3300046472 Unclassified 2911
538 Ga0495585_0165866 3300046492 Unclassified 1144
539 Ga0495606_0035048 3300046507 Bacteria 3436
540 Ga0495648_0021915 3300046524 Bacteria 4413
541 Ga0495645_0068706 3300046543 Bacteria 2558
542 Ga0495668_0001333 3300046616 Bacteria 24264
543 Ga0495668_0074123 3300046616 Bacteria 1869
544 Ga0495611_0002030 3300046648 Bacteria 9563
545 Ga0495658_0010281 3300046683 Bacteria 4681
546 Ga0495672_0016092 3300047320 Bacteria 5055
547 Ga0495672_0027063 3300047320 Bacteria 3650
548 Ga0495672_0054948 3300047320 Bacteria 2325
549 Ga0495687_000014 3300047443 Bacteria 366896
550 Ga0495684_0188725 3300047471 Bacteria 1525
551 Ga0495686_0000034 3300047472 Bacteria 325038
552 Ga0501297_001834 3300049520 Bacteria 2004
553 Ga0501032_0022185 3300049569 Bacteria 4404
554 Ga0501032_0053508 3300049569 Bacteria 2718
555 Ga0501033_0064563 3300049570 Bacteria 2694
556 Ga0501034_0017264 3300049571 Bacteria 7403
557 Ga0501034_0025402 3300049571 Bacteria 6030
558 Ga0501034_0067125 3300049571 Bacteria 3600
559 Ga0501034_0107142 3300049571 Bacteria 2787
560 Ga0501036_0007264 3300049572 Bacteria 9019
561 Ga0501036_0161768 3300049572 Bacteria 1887
562 Ga0501037_0022715 3300049573 Bacteria 4638
563 Ga0501037_0192611 3300049573 Bacteria 1443
564 Ga0501037_0277233 3300049573 Bacteria 1169
565 Ga0501038_0007417 3300049574 Bacteria 10118
566 Ga0501038_0035011 3300049574 Bacteria 4412
567 Ga0501043_0026826 3300049579 Bacteria 4520
568 Ga0501043_0093399 3300049579 Bacteria 2365
569 Ga0501046_0087155 3300049580 Bacteria 2406
570 Ga0501046_0203162 3300049580 Bacteria 1474
571 Ga0501047_0029383 3300049581 Bacteria 5301
572 Ga0501047_0041858 3300049581 Bacteria 4426
573 Ga0501047_0155354 3300049581 Bacteria 2162
574 Ga0501047_0209379 3300049581 Bacteria 1809
575 Ga0501048_0210278 3300049582 Unclassified 1380
576 Ga0501070_0036750 3300049586 Bacteria 4090
577 Ga0501198_000448 3300049649 Bacteria 5096
578 Ga0501201_000222 3300049651 Bacteria 5060
579 Ga0501202_000501 3300049652 Bacteria 5617
580 Ga0501202_004296 3300049652 Bacteria 2493
581 Ga0501209_001603 3300049656 Bacteria 3248
582 Ga0501217_002995 3300049661 Bacteria 3382
583 Ga0501222_002485 3300049662 Bacteria 2550
584 Ga0501243_002463 3300049675 Bacteria 2715
585 Ga0501250_002483 3300049680 Bacteria 1674
586 Ga0501252_000221 3300049682 Bacteria 3838
587 Ga0501253_003250 3300049683 Bacteria 1929
588 Ga0501257_003526 3300049686 Bacteria 3366
589 Ga0501259_000049 3300049688 Bacteria 16645
590 Ga0501261_002547 3300049690 Bacteria 2236
591 Ga0501219_000441 3300049703 Bacteria 6685
592 Ga0501221_000948 3300049704 Bacteria 4762
593 Ga0501225_0000714 3300049705 Bacteria 10454
594 Ga0501225_0002274 3300049705 Bacteria 5938
595 Ga0501225_0005245 3300049705 Bacteria 3815
596 Ga0501234_003372 3300049707 Bacteria 2514
597 Ga0501080_0284790 3300049742 Bacteria 1501
598 Ga0501080_0300139 3300049742 Bacteria 1457
599 Ga0501083_0045728 3300049744 Unclassified 2960
600 Ga0501266_005062 3300049763 Bacteria 1641
601 Ga0501283_002902 3300049779 Bacteria 2247
602 Ga0501035_0217982 3300049822 Bacteria 1630
603 Ga0501044_0006233 3300049823 Bacteria 13185
604 Ga0501044_0022953 3300049823 Bacteria 6642
605 Ga0501044_0044246 3300049823 Bacteria 4621
606 Ga0501044_0072159 3300049823 Bacteria 3511
607 Ga0501044_0314377 3300049823 Bacteria 1492
608 nmdc:mga0k408_13457_c1 3300050493 Bacteria 4487
609 nmdc:mga0k408_19180_c1 3300050493 Bacteria 3820
610 nmdc:mga0k408_29705_c1 3300050493 Bacteria 3113
611 nmdc:mga0k408_29853_c1 3300050493 Bacteria 3106
612 nmdc:mga0k408_45723_c1 3300050493 Bacteria 2526
613 nmdc:mga07m45_79978_c1 3300050496 Bacteria 1866
614 nmdc:mga05p37_1013_c1 3300050507 Bacteria 8348
615 nmdc:mga05p37_291256_c1 3300050507 Unclassified 1943
616 nmdc:mga05p37_44816_c1 3300050507 Bacteria 5441
617 nmdc:mga09592_328852_c1 3300050508 Bacteria 1324
618 nmdc:mga09592_52737_c1 3300050508 Bacteria 3433
619 nmdc:mga0qj67_134147_c1 3300050509 Bacteria 2006
620 nmdc:mga0qj67_91138_c1 3300050509 Bacteria 2450
621 nmdc:mga06r32_4027_c1 3300050510 Bacteria 3988
622 nmdc:mga06r32_47364_c1 3300050510 Bacteria 4106
623 nmdc:mga08y16_126689_c1 3300050511 Bacteria 2656
624 nmdc:mga08y16_51885_c1 3300050511 Bacteria 4291
625 nmdc:mga0n895_48775_c1 3300050512 Bacteria 4146
626 Ga0500578_0000131 3300053086 Bacteria 89434
627 Ga0500578_0039950 3300053086 Bacteria 3015
628 Ga0500646_0008902 3300053090 Bacteria 2570
629 Ga0500583_0000059 3300053092 Bacteria 68222
630 Ga0500583_0000404 3300053092 Bacteria 13793
631 Ga0500583_0033424 3300053092 Bacteria 2276
632 Ga0500562_000029 3300053108 Bacteria 94705
633 Ga0500652_010852 3300053131 Bacteria 3139
634 Ga0500559_0014862 3300053136 Unclassified 3289
635 Ga0500604_0007054 3300053151 Bacteria 2973
636 Ga0500622_0001805 3300053156 Bacteria 16320
637 Ga0500639_087949 3300053163 Bacteria 1553
638 Ga0500611_001481 3300053727 Bacteria 2592
639 Ga0500661_008722 3300055283 Bacteria 1865
640 Ga0466962_0034522 3300061719 Bacteria 2421
641 Ga0466962_0126782 3300061719 Bacteria 1233
642 2738727019 2738541278 Bacteria 9755573
643 2929157652 2929154850 Bacteria 6753285
644 Ga0500622_0002785
645 JGI25406J46586_10003879
646 rootH1_10035049
647 rootH2_10000085
648 rootH2_10000087
649 rootH2_10037716
650 rootH2_10123085
651 rootH2_10172890
652 rootH2_10179671
653 rootL2_10084205
654 rootL2_10144132
655 rootH1_10045695
656 JGI25160J50197_1002200
657 Ga0070658_10166585
658 Ga0070658_10232684
659 Ga0070676_10020427
660 Ga0070676_10266592
661 Ga0070683_100000400
662 Ga0070683_100001255
663 Ga0070683_100025684
664 Ga0070683_100236960
665 Ga0070690_100032894
666 Ga0070670_100034630
667 Ga0070670_100182681
668 Ga0070677_10025358
669 Ga0070677_10063901
670 Ga0068869_100005895
671 Ga0068869_100011637
672 Ga0068869_100048976
673 Ga0068869_100054407
674 Ga0070666_10000131
675 Ga0070666_10105668
676 Ga0070680_100000390
677 Ga0070682_100002004
678 Ga0070682_100018566
679 Ga0070682_100128056
680 Ga0068868_100047496
681 Ga0068868_100106538
682 Ga0070660_100016553
683 Ga0070689_100007636
684 Ga0070689_100032629
685 Ga0070689_100120634
686 Ga0070691_10000447
687 Ga0070691_10072428
688 Ga0070691_10090351
689 Ga0070687_100049084
690 Ga0070661_100016523
691 Ga0070668_100086575
692 Ga0070669_100049866
693 Ga0070675_100007389
694 Ga0070675_100034196
695 Ga0070675_100047572
696 Ga0070675_100079638
697 Ga0070675_100080620
698 Ga0070675_100083343
699 Ga0070671_100051228
700 Ga0070671_100151075
701 Ga0070671_100361492
702 Ga0070674_100049227
703 Ga0070674_100063085
704 Ga0070673_100056257
705 Ga0070673_100063719
706 Ga0070673_100170059
707 Ga0070688_100108462
708 Ga0070659_100007127
709 Ga0070659_100086478
710 Ga0070667_100003934
711 Ga0070667_100006801
712 Ga0070667_100009024
713 Ga0070667_100221922
714 Ga0070667_100351143
715 Ga0070700_100158495
716 Ga0070700_100166345
717 Ga0070678_100049383
718 Ga0070678_100113031
719 Ga0070662_100019394
720 Ga0070662_100019478
721 Ga0070662_100304744
722 Ga0070681_10119292
723 Ga0068867_100022701
724 Ga0068867_100080509
725 Ga0068867_100105048
726 Ga0068867_100155200
727 Ga0068867_100156228
728 Ga0070685_10024548
729 Ga0070698_100000219
730 Ga0070698_100001176
731 Ga0070698_100012636
732 Ga0070679_100000978
733 Ga0070679_100003533
734 Ga0070679_100132564
735 Ga0070684_100006302
736 Ga0070684_100013840
737 Ga0070684_100067038
738 Ga0070684_100148132
739 Ga0068853_100004745
740 Ga0068853_100005079
741 Ga0068853_100038178
742 Ga0068853_100059890
743 Ga0068853_100191786
744 Ga0068853_100438681
745 Ga0070672_100123986
746 Ga0070672_100212867
747 Ga0070672_100332746
748 Ga0070686_100112117
749 Ga0070693_100034122
750 Ga0070693_100060405
751 Ga0070693_100193559
752 Ga0070665_100000013
753 Ga0070665_100334214
754 Ga0068855_100006383
755 Ga0068855_100024391
756 Ga0068855_100025397
757 Ga0068855_100276197
758 Ga0068855_100684839
759 Ga0070664_100043469
760 Ga0070664_100076792
761 Ga0070664_100100070
762 Ga0070664_100237884
763 Ga0070664_100507741
764 Ga0068857_100016474
765 Ga0068857_100022194
766 Ga0068857_100028172
767 Ga0068854_100119692
768 Ga0068856_100033441
769 Ga0068856_100042396
770 Ga0068856_100049615
771 Ga0068856_100060221
772 Ga0068856_100303100
773 Ga0068852_100000841
774 Ga0068852_100007666
775 Ga0068852_100010853
776 Ga0068852_100039549
777 Ga0068852_100043264
778 Ga0068852_100058305
779 Ga0068852_100251663
780 Ga0068859_100001063
781 Ga0068859_100010717
782 Ga0068859_100013679
783 Ga0068859_100163116
784 Ga0068859_100546998
785 Ga0068864_100002583
786 Ga0068864_100021697
787 Ga0068864_100150935
788 Ga0068866_10012212
789 Ga0068866_10221768
790 Ga0068861_100102913
791 Ga0068861_100121392
792 Ga0068861_100190082
793 Ga0068861_100233276
794 Ga0068861_100252623
795 Ga0068863_100018196
796 Ga0068863_100044241
797 Ga0068863_100082900
798 Ga0068863_100154487
799 Ga0068863_100166852
800 Ga0068863_100363229
801 Ga0068863_100494741
802 Ga0068863_100501556
803 Ga0068858_100032273
804 Ga0068858_100225996
805 Ga0068860_100000060
806 Ga0068860_100001033
807 Ga0068860_100007422
808 Ga0068860_100007709
809 Ga0068860_100009079
810 Ga0068860_100030246
811 Ga0068860_100059325
812 Ga0068860_100149470
813 Ga0068860_100296295
814 Ga0068860_100392203
815 Ga0068860_100580648
816 Ga0081539_10000338
817 Ga0070715_10069368
818 Ga0075366_10028648
819 Ga0075366_10038423
820 Ga0097621_100000224
821 Ga0097621_100018734
822 Ga0097621_100056797
823 Ga0097621_100105024
824 Ga0068871_100000332
825 Ga0068871_100224234
826 Ga0068871_100350335
827 Ga0075428_100003660
828 Ga0075428_100076912
829 Ga0075430_100046805
830 Ga0075430_100142445
831 Ga0075431_100040770
832 Ga0075431_100054947
833 Ga0075434_100065140
834 Ga0075429_100014332
835 Ga0075429_100021570
836 Ga0075429_100072409
837 Ga0068865_100116690
838 Ga0097620_100001063
839 Ga0097620_100010717
840 Ga0097620_100013679
841 Ga0097620_100163122
842 Ga0097620_100546951
843 Ga0105240_10000716
844 Ga0105240_10001832
845 Ga0105240_10002222
846 Ga0105240_10002441
847 Ga0105240_10003315
848 Ga0105240_10024073
849 Ga0105240_10026196
850 Ga0105240_10084202
851 Ga0105240_10087201
852 Ga0111539_10056336
853 Ga0111539_10148620
854 Ga0105247_10010405
855 Ga0114129_10010756
856 Ga0114129_10038918
857 Ga0114129_10185693
858 Ga0105241_10000638
859 Ga0105241_10000663
860 Ga0105241_10000951
861 Ga0105241_10179485
862 Ga0105242_10023643
863 Ga0105242_10101036
864 Ga0105242_10259781
865 Ga0105248_10062283
866 Ga0105248_10231012
867 Ga0105237_10004518
868 Ga0105237_10006836
869 Ga0105237_10012641
870 Ga0105237_10018930
871 Ga0105237_10050183
872 Ga0105237_10060695
873 Ga0105237_10247069
874 Ga0105238_10001000
875 Ga0105238_10043348
876 Ga0105249_10009926
877 Ga0105249_10016990
878 Ga0105249_10255424
879 Ga0105239_10000457
880 Ga0105239_10001641
881 Ga0105239_10001821
882 Ga0105239_10003232
883 Ga0105239_10045274
884 Ga0105239_10060506
885 Ga0105239_10078913
886 Ga0105239_10668041
887 Ga0157373_10056080
888 Ga0157373_10085899
889 Ga0157373_10114970
890 Ga0157373_10128997
891 Ga0157371_10007803
892 Ga0157371_10012641
893 Ga0157371_10123916
894 Ga0157371_10131248
895 Ga0157371_10178856
896 Ga0157371_10326456
897 Ga0157370_10001459
898 Ga0157370_10005908
899 Ga0157370_10041274
900 Ga0157370_10264894
901 Ga0157369_10007843
902 Ga0157369_10044314
903 Ga0157369_10101317
904 Ga0157369_10126804
905 Ga0157369_10220148
906 Ga0157369_10386331
907 Ga0157374_10000007
908 Ga0157374_10002698
909 Ga0157374_10035877
910 Ga0157374_10228364
911 Ga0157374_10248334
912 Ga0157374_10252400
913 Ga0157374_10284226
914 Ga0157374_10421978
915 Ga0157378_10001566
916 Ga0157378_10004338
917 Ga0157378_10015870
918 Ga0157378_10044439
919 Ga0157378_10203487
920 Ga0163162_10002272
921 Ga0163162_10002720
922 Ga0163162_10004931
923 Ga0163162_10012600
924 Ga0163162_10030449
925 Ga0163162_10057971
926 Ga0163162_10122932
927 Ga0163162_10243034
928 Ga0163162_10419164
929 Ga0163162_10607531
930 Ga0157372_10001489
931 Ga0157372_10002526
932 Ga0157372_10018798
933 Ga0157372_10045235
934 Ga0157372_10074427
935 Ga0157372_10098568
936 Ga0157372_10116283
937 Ga0157372_10164498
938 Ga0157372_10181766
939 Ga0157372_10195354
940 Ga0157372_10199128
941 Ga0157372_10214405
942 Ga0157372_10463302
943 Ga0157375_10003126
944 Ga0157375_10060581
945 Ga0157375_10092711
946 Ga0157375_10094990
947 Ga0157375_10264045
948 Ga0157375_10391094
949 Ga0163163_10000614
950 Ga0163163_10000975
951 Ga0163163_10010980
952 Ga0163163_10059021
953 Ga0163163_10143601
954 Ga0163163_10275027
955 Ga0157380_10027888
956 Ga0157380_10033885
957 Ga0157377_10019788
958 Ga0157377_10019977
959 Ga0157377_10052101
960 Ga0157377_10084732
961 Ga0157379_10027846
962 Ga0157379_10092388
963 Ga0157379_10111687
964 Ga0157376_10003332
965 Ga0157376_10116987
966 Ga0157376_10227720
967 Ga0163161_10009952
968 Ga0163161_10019608
969 Ga0163161_10392166
970 Ga0207426_1000230
971 Ga0207697_10035615
972 Ga0207682_10020597
973 Ga0207642_10006319
974 Ga0207710_10002831
975 Ga0207688_10084418
976 Ga0207680_10000211
977 Ga0207680_10045259
978 Ga0207680_10323678
979 Ga0207647_10028230
980 Ga0207647_10226302
981 Ga0207645_10011191
982 Ga0207705_10013019
983 Ga0207705_10205129
984 Ga0207654_10000832
985 Ga0207654_10000989
986 Ga0207654_10122194
987 Ga0207707_10001200
988 Ga0207707_10110849
989 Ga0207695_10000130
990 Ga0207695_10000170
991 Ga0207695_10000862
992 Ga0207695_10003201
993 Ga0207695_10010277
994 Ga0207695_10060482
995 Ga0207695_10101575
996 Ga0207695_10110650
997 Ga0207671_10001678
998 Ga0207671_10005137
999 Ga0207671_10006115
1000 Ga0207671_10008056
1001 Ga0207671_10028140
1002 Ga0207671_10044381
1003 Ga0207671_10144141
1004 Ga0207671_10152500
1005 Ga0207671_10245135
1006 Ga0207660_10000111
1007 Ga0207660_10033982
1008 Ga0207662_10081461
1009 Ga0207657_10011713
1010 Ga0207649_10007160
1011 Ga0207649_10018394
1012 Ga0207652_10000460
1013 Ga0207652_10019639
1014 Ga0207681_10197403
1015 Ga0207694_10038576
1016 Ga0207650_10013502
1017 Ga0207650_10023614
1018 Ga0207650_10166649
1019 Ga0207650_10476314
1020 Ga0207659_10019500
1021 Ga0207659_10020457
1022 Ga0207659_10047844
1023 Ga0207659_10288537
1024 Ga0207644_10144289
1025 Ga0207644_10454088
1026 Ga0207690_10044302
1027 Ga0207706_10001784
1028 Ga0207686_10005476
1029 Ga0207686_10151299
1030 Ga0207670_10178382
1031 Ga0207669_10008284
1032 Ga0207669_10106985
1033 Ga0207704_10064329
1034 Ga0207691_10014629
1035 Ga0207691_10034399
1036 Ga0207691_10088442
1037 Ga0207691_10102501
1038 Ga0207691_10328777
1039 Ga0207711_10131212
1040 Ga0207689_10009728
1041 Ga0207689_10033496
1042 Ga0207689_10063117
1043 Ga0207689_10161880
1044 Ga0207689_10172922
1045 Ga0207689_10241637
1046 Ga0207661_10002005
1047 Ga0207679_10009832
1048 Ga0207679_10045920
1049 Ga0207679_10046617
1050 Ga0207679_10116782
1051 Ga0207679_10168953
1052 Ga0207679_10235281
1053 Ga0207667_10000131
1054 Ga0207667_10000915
1055 Ga0207667_10015105
1056 Ga0207667_10085346
1057 Ga0207667_10170699
1058 Ga0207651_10052740
1059 Ga0207651_10179899
1060 Ga0207712_10005772
1061 Ga0207712_10008099
1062 Ga0207712_10021586
1063 Ga0207712_10032988
1064 Ga0207640_10097090
1065 Ga0207640_10188019
1066 Ga0207658_10015530
1067 Ga0207658_10071470
1068 Ga0207658_10214814
1069 Ga0207658_10343397
1070 Ga0207677_10029949
1071 Ga0207677_10046500
1072 Ga0207677_10455831
1073 Ga0207703_10056415
1074 Ga0207639_10126655
1075 Ga0207639_10136706
1076 Ga0207708_10188478
1077 Ga0207702_10034739
1078 Ga0207702_10200616
1079 Ga0207641_10000299
1080 Ga0207641_10039341
1081 Ga0207641_10124013
1082 Ga0207641_10137777
1083 Ga0207648_10026160
1084 Ga0207648_10031074
1085 Ga0207648_10034165
1086 Ga0207648_10100306
1087 Ga0207648_10122426
1088 Ga0207676_10006593
1089 Ga0207676_10044594
1090 Ga0207676_10061287
1091 Ga0207676_10153658
1092 Ga0207676_10183407
1093 Ga0207676_10200057
1094 Ga0207674_10011272
1095 Ga0207674_10028571
1096 Ga0207674_10036031
1097 Ga0207674_10083573
1098 Ga0207674_10111291
1099 Ga0207675_100060296
1100 Ga0207675_100078728
1101 Ga0207675_100182793
1102 Ga0207675_100186418
1103 Ga0207675_100230279
1104 Ga0207683_10011258
1105 Ga0207683_10171577
1106 Ga0207683_10258147
1107 Ga0207698_10009265
1108 Ga0207698_10011547
1109 Ga0207698_10017479
1110 Ga0207698_10019122
1111 Ga0207698_10042460
1112 Ga0207698_10044597
1113 Ga0207698_10201476
1114 Ga0207698_10313375
1115 Ga0207698_10390682
1116 Ga0268266_10000024
1117 Ga0268266_10268472
1118 Ga0268264_10000915
1119 Ga0268264_10002496
1120 Ga0268264_10007415
1121 Ga0268264_10009106
1122 Ga0268264_10013812
1123 Ga0268264_10015007
1124 Ga0268264_10029510
1125 Ga0268264_10614260
1126 Ga0307517_10002909
1127 Ga0307511_10003880
1128 Ga0265327_10000107
1129 Ga0307513_10149095
1130 Ga0307509_10053115
1131 Ga0307509_10111172
1132 Ga0307508_10010090
1133 Ga0307516_10030501
1134 Ga0307516_10242125
1135 Ga0307407_10176265
1136 Ga0307414_10048201
1137 Ga0307414_10195332
1138 Ga0307411_10060442
1139 Ga0307510_10067772
1140 Ga0373961_0060783
1141 Ga0373937_0015761
1142 Ga0373937_0178519
1143 Ga0373925_0256422
1144 Ga0395900_0178528
1145 Ga0395900_0638564
1146 Ga0395905_0001101
1147 Ga0395905_0299003
1148 Ga0436365_0577581
1149 Ga0436365_1377856
1150 Ga0439439_0012279
1151 Ga0451791_1580852
1152 Ga0451800_1271054
1153 Ga0451853_0641177
1154 Ga0439433_0008668
1155 Ga0439449_0004466
1156 Ga0439449_0004488
1157 Ga0439457_000424
1158 Ga0439462_0001182
1159 Ga0466969_0000947
1160 Ga0466972_0000003
1161 Ga0466972_0000028
1162 Ga0466972_0043134
1163 Ga0466966_0001580
1164 Ga0466961_0007419
1165 Ga0453684_0019974
1166 Ga0453684_0163878
1167 Ga0453684_0167918
1168 Ga0453684_0197287
1169 Ga0453684_0401664
1170 Ga0466971_0050137
1171 Ga0466970_0001690
1172 Ga0466957_0001474
1173 Ga0466957_0011296
1174 Ga0466957_0073998
1175 Ga0466959_0000002
1176 Ga0466959_0071277
1177 Ga0466959_0106080
1178 Ga0451576_0085615
1179 Ga0495629_0051562
1180 Ga0495580_0051484
1181 Ga0495585_0165866
1182 Ga0495606_0035048
1183 Ga0495648_0021915
1184 Ga0495645_0068706
1185 Ga0495668_0001333
1186 Ga0495668_0074123
1187 Ga0495611_0002030
1188 Ga0495658_0010281
1189 Ga0495672_0016092
1190 Ga0495672_0027063
1191 Ga0495672_0054948
1192 Ga0495687_000014
1193 Ga0495684_0188725
1194 Ga0495686_0000034
1195 Ga0501297_001834
1196 Ga0501032_0022185
1197 Ga0501032_0053508
1198 Ga0501033_0064563
1199 Ga0501034_0017264
1200 Ga0501034_0025402
1201 Ga0501034_0067125
1202 Ga0501034_0107142
1203 Ga0501036_0007264
1204 Ga0501036_0161768
1205 Ga0501037_0022715
1206 Ga0501037_0192611
1207 Ga0501037_0277233
1208 Ga0501038_0007417
1209 Ga0501038_0035011
1210 Ga0501043_0026826
1211 Ga0501043_0093399
1212 Ga0501046_0087155
1213 Ga0501046_0203162
1214 Ga0501047_0029383
1215 Ga0501047_0041858
1216 Ga0501047_0155354
1217 Ga0501047_0209379
1218 Ga0501048_0210278
1219 Ga0501070_0036750
1220 Ga0501198_000448
1221 Ga0501201_000222
1222 Ga0501202_000501
1223 Ga0501202_004296
1224 Ga0501209_001603
1225 Ga0501217_002995
1226 Ga0501222_002485
1227 Ga0501243_002463
1228 Ga0501250_002483
1229 Ga0501252_000221
1230 Ga0501253_003250
1231 Ga0501257_003526
1232 Ga0501259_000049
1233 Ga0501261_002547
1234 Ga0501219_000441
1235 Ga0501221_000948
1236 Ga0501225_0000714
1237 Ga0501225_0002274
1238 Ga0501225_0005245
1239 Ga0501234_003372
1240 Ga0501080_0284790
1241 Ga0501080_0300139
1242 Ga0501083_0045728
1243 Ga0501266_005062
1244 Ga0501283_002902
1245 Ga0501035_0217982
1246 Ga0501044_0006233
1247 Ga0501044_0022953
1248 Ga0501044_0044246
1249 Ga0501044_0072159
1250 Ga0501044_0314377
1251 nmdc:mga0k408_13457_c1
1252 nmdc:mga0k408_19180_c1
1253 nmdc:mga0k408_29705_c1
1254 nmdc:mga0k408_29853_c1
1255 nmdc:mga0k408_45723_c1
1256 nmdc:mga07m45_79978_c1
1257 nmdc:mga05p37_1013_c1
1258 nmdc:mga05p37_291256_c1
1259 nmdc:mga05p37_44816_c1
1260 nmdc:mga09592_328852_c1
1261 nmdc:mga09592_52737_c1
1262 nmdc:mga0qj67_134147_c1
1263 nmdc:mga0qj67_91138_c1
1264 nmdc:mga06r32_4027_c1
1265 nmdc:mga06r32_47364_c1
1266 nmdc:mga08y16_126689_c1
1267 nmdc:mga08y16_51885_c1
1268 nmdc:mga0n895_48775_c1
1269 Ga0500578_0000131
1270 Ga0500578_0039950
1271 Ga0500646_0008902
1272 Ga0500583_0000059
1273 Ga0500583_0000404
1274 Ga0500583_0033424
1275 Ga0500562_000029
1276 Ga0500652_010852
1277 Ga0500559_0014862
1278 Ga0500604_0007054
1279 Ga0500622_0001805
1280 Ga0500639_087949
1281 Ga0500611_001481
1282 Ga0500661_008722
1283 Ga0466962_0034522
1284 Ga0466962_0126782
1285 2738727019
1286 2929157652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

157

363

0.91

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

44

146

0.88

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

156

342

0.87

PF02655

ATP-grasp_3

ATP-grasp domain

178

337

0.81

PF02222

ATP-grasp

ATP-grasp domain

166

335

0.78

PF13535

ATP-grasp_4

ATP-grasp domain

192

340

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d8d-assembly3.cif.gz_F crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii 0.9012 11 328
4fu0-assembly1.cif.gz_B crystal structure of vang d-ala:d-ser ligase from enterococcus faecalis 0.9006 9 328
3r5x-assembly2.cif.gz_C crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp 0.8976 10 328
5d8d-assembly3.cif.gz_D crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii 0.8968 7 328
5dmx-assembly1.cif.gz_A crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii, space group p212121 0.8949 7 330
ID Description Score Start End Superfamily
af_P9WP31_140_368_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.908 115 328 3.40.50.20
1ehiB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8856 203 329 3.30.470.20
1ehiA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8847 205 329 3.30.470.20
5dmxB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8835 115 314 3.30.470.20
3se7B03 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.882 138 199 3.30.1490.20
ID Description Score Start End GO Terms
AF-A0A1T5NEK1-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.9674 8 330 GO:0005524
GO:0005737
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A7V5BFI6-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.9664 9 330 GO:0005524
GO:0005737
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A2D5JKA9-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.9614 8 329 GO:0005524
GO:0005737
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A7Y8NUZ3-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.9609 8 329 GO:0005524
GO:0005737
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A2D8JML4-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.9607 10 325 GO:0005524
GO:0005737
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555

Map