F471778

General Info

Members Datasets Scaffolds Average Seq Length
641 291 1282 370

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10299991|Ga0111539_102999911
Length 420
Sequence VLSNLKKEAAMMRNRFHFISLAVVLLFGLETVAAADTFRIRLTGARCADDPACHNRFHPAIKPVITVKPGDTVIMETRDAFDGQITPSSTAADVIPTFLGGPLNLNLVHPLTGPVAIQGAEPGDLLVVHIVDIIQADFAYTINVPGFGFLRSEVPGPAILHWDIKGDVATSRDLPGVRIHAEPSMGTTGIALSVAKTEEVFQREHELAGRGGFVLEPNPDDAVPASLCGHGGTVASRCLRTIPTRENAGNIDVKQLTKGGRLLIPVFVPGALFSAGDAHFAQGDGEIAGTTMEMNVTLVVKFTLRKGEANRLGITTFQFERDNFFAPPERAVPKRFFATTGISVDRVTGKNESEDLTLSARNAALNMIDHLVRVRGLTRQQAYMLSSTAVDLHINQLVDVPNFLVSAFLHLDVFRDEHGK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
154 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
183 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
184 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
185 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
186 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
187 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
188 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
189 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
190 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
291 2895427314 Nonomuraea sp. PA05 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.31
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 2.96
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 3.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10299991 3300009094 Bacteria 1870
2 JGI25407J50210_10001823 3300003373 Bacteria 4921
3 JGI25407J50210_10018575 3300003373 Bacteria 1807
4 JGI25407J50210_10027487 3300003373 Bacteria 1475
5 JGI25407J50210_10038778 3300003373 Bacteria 1223
6 Ga0070676_10039542 3300005328 Bacteria 2728
7 Ga0070683_100002954 3300005329 Bacteria 13633
8 Ga0070683_100324285 3300005329 Bacteria 1466
9 Ga0070670_100039279 3300005331 Bacteria 4070
10 Ga0070670_100087292 3300005331 Bacteria 2681
11 Ga0068869_100002664 3300005334 Bacteria 10792
12 Ga0068869_100070680 3300005334 Bacteria 2583
13 Ga0070682_100018260 3300005337 Bacteria 4097
14 Ga0070682_100069653 3300005337 Bacteria 2247
15 Ga0068868_100007164 3300005338 Bacteria 7926
16 Ga0070660_100173784 3300005339 Bacteria 1741
17 Ga0070691_10001538 3300005341 Bacteria 9931
18 Ga0070687_100162306 3300005343 Bacteria 1322
19 Ga0070661_100044405 3300005344 Bacteria 3247
20 Ga0070669_100113215 3300005353 Bacteria 2061
21 Ga0070675_100009104 3300005354 Bacteria 7711
22 Ga0070675_100010062 3300005354 Bacteria 7375
23 Ga0070671_100032104 3300005355 Bacteria 4342
24 Ga0070671_100111262 3300005355 Bacteria 2301
25 Ga0070673_100004502 3300005364 Bacteria 8819
26 Ga0070659_100027063 3300005366 Bacteria 4415
27 Ga0070709_10009881 3300005434 Bacteria 5272
28 Ga0070709_10030851 3300005434 Bacteria 3220
29 Ga0070709_10057101 3300005434 Bacteria 2471
30 Ga0070714_100000449 3300005435 Bacteria 29907
31 Ga0070714_100022034 3300005435 Bacteria 5220
32 Ga0070714_100025919 3300005435 Bacteria 4842
33 Ga0070714_100028341 3300005435 Bacteria 4645
34 Ga0070713_100053850 3300005436 Bacteria 3335
35 Ga0070713_100225510 3300005436 Bacteria 1701
36 Ga0070710_10003211 3300005437 Bacteria 7746
37 Ga0070710_10009107 3300005437 Bacteria 4855
38 Ga0070701_10062898 3300005438 Bacteria 1962
39 Ga0070711_100084684 3300005439 Bacteria 2268
40 Ga0070700_100090841 3300005441 Bacteria 1992
41 Ga0070708_100200281 3300005445 Bacteria 1869
42 Ga0070663_100069283 3300005455 Bacteria 2562
43 Ga0070678_100026365 3300005456 Bacteria 3928
44 Ga0070662_100058573 3300005457 Bacteria 2804
45 Ga0070706_100002259 3300005467 Bacteria 19516
46 Ga0070706_100020543 3300005467 Bacteria 6086
47 Ga0070706_100133390 3300005467 Bacteria 2318
48 Ga0070706_100241501 3300005467 Unclassified 1687
49 Ga0070707_100010690 3300005468 Bacteria 8549
50 Ga0070707_100018397 3300005468 Bacteria 6573
51 Ga0070707_100022461 3300005468 Bacteria 5965
52 Ga0070707_100065077 3300005468 Bacteria 3501
53 Ga0070698_100001269 3300005471 Bacteria 28186
54 Ga0070698_100009431 3300005471 Bacteria 10456
55 Ga0070698_100019092 3300005471 Bacteria 7206
56 Ga0070698_100042584 3300005471 Bacteria 4657
57 Ga0070699_100002426 3300005518 Bacteria 16718
58 Ga0070679_100011760 3300005530 Bacteria 8343
59 Ga0070684_100090818 3300005535 Bacteria 2716
60 Ga0070697_100117278 3300005536 Bacteria 2224
61 Ga0068853_100082698 3300005539 Bacteria 2812
62 Ga0070672_100071010 3300005543 Bacteria 2768
63 Ga0070672_100083546 3300005543 Bacteria 2563
64 Ga0070696_100018903 3300005546 Bacteria 4665
65 Ga0070693_100003760 3300005547 Bacteria 7105
66 Ga0070665_100052846 3300005548 Bacteria 4075
67 Ga0068855_100089064 3300005563 Bacteria 3564
68 Ga0070664_100007440 3300005564 Bacteria 8840
69 Ga0068857_100043152 3300005577 Bacteria 4000
70 Ga0068856_100078857 3300005614 Bacteria 3265
71 Ga0070702_100003431 3300005615 Bacteria 7089
72 Ga0068852_100025604 3300005616 Bacteria 4783
73 Ga0068859_100048864 3300005617 Bacteria 4249
74 Ga0068859_100167626 3300005617 Bacteria 2276
75 Ga0068864_100009334 3300005618 Bacteria 8091
76 Ga0068861_100180588 3300005719 Bacteria 1756
77 Ga0068870_10007789 3300005840 Bacteria 4790
78 Ga0068870_10144270 3300005840 Bacteria 1396
79 Ga0068863_100018636 3300005841 Bacteria 6641
80 Ga0068860_100026646 3300005843 Bacteria 5573
81 Ga0068860_100303263 3300005843 Bacteria 1565
82 Ga0068862_100006890 3300005844 Bacteria 9424
83 Ga0081455_10000613 3300005937 Bacteria 46197
84 Ga0081455_10000984 3300005937 Bacteria 36271
85 Ga0081455_10002019 3300005937 Bacteria 24270
86 Ga0081455_10006961 3300005937 Bacteria 12020
87 Ga0081455_10009471 3300005937 Bacteria 10016
88 Ga0081455_10022928 3300005937 Bacteria 5821
89 Ga0081455_10043802 3300005937 Bacteria 3911
90 Ga0081455_10046198 3300005937 Bacteria 3781
91 Ga0081538_10000139 3300005981 Bacteria 75075
92 Ga0081538_10000704 3300005981 Bacteria 36646
93 Ga0081538_10005296 3300005981 Bacteria 11639
94 Ga0081538_10011358 3300005981 Bacteria 7221
95 Ga0081538_10020497 3300005981 Unclassified 4861
96 Ga0081538_10028285 3300005981 Bacteria 3860
97 Ga0081538_10032059 3300005981 Bacteria 3531
98 Ga0081538_10035816 3300005981 Bacteria 3253
99 Ga0081538_10044240 3300005981 Unclassified 2781
100 Ga0081540_1000334 3300005983 Bacteria 48288
101 Ga0081540_1001224 3300005983 Bacteria 22409
102 Ga0081540_1013051 3300005983 Bacteria 5424
103 Ga0081540_1021132 3300005983 Bacteria 3888
104 Ga0081540_1025723 3300005983 Unclassified 3379
105 Ga0081540_1039986 3300005983 Bacteria 2450
106 Ga0081539_10007226 3300005985 Bacteria 10206
107 Ga0081539_10020205 3300005985 Bacteria 4516
108 Ga0081539_10041769 3300005985 Bacteria 2677
109 Ga0070717_10010914 3300006028 Bacteria 6878
110 Ga0075432_10036071 3300006058 Bacteria 1719
111 Ga0070716_100032543 3300006173 Bacteria 2845
112 Ga0070712_100005943 3300006175 Bacteria 7544
113 Ga0070712_100091085 3300006175 Bacteria 2233
114 Ga0075367_10030744 3300006178 Bacteria 3081
115 Ga0075367_10151560 3300006178 Bacteria 1439
116 Ga0075427_10002202 3300006194 Bacteria 2596
117 Ga0068871_100036296 3300006358 Bacteria 3924
118 Ga0075428_100004948 3300006844 Bacteria 14795
119 Ga0075428_100020793 3300006844 Bacteria 7266
120 Ga0075428_100029751 3300006844 Bacteria 6042
121 Ga0075428_100048567 3300006844 Bacteria 4657
122 Ga0075428_100080554 3300006844 Bacteria 3553
123 Ga0075430_100003287 3300006846 Bacteria 13549
124 Ga0075431_100000036 3300006847 Bacteria 68411
125 Ga0075431_100002693 3300006847 Bacteria 17220
126 Ga0075431_100005619 3300006847 Bacteria 12386
127 Ga0075431_100007275 3300006847 Bacteria 11021
128 Ga0075431_100055618 3300006847 Bacteria 4082
129 Ga0075431_100356292 3300006847 Bacteria 1470
130 Ga0075433_10020330 3300006852 Bacteria 5548
131 Ga0075433_10039037 3300006852 Bacteria 4103
132 Ga0075433_10050754 3300006852 Bacteria 3611
133 Ga0075433_10074633 3300006852 Bacteria 2984
134 Ga0075434_100001921 3300006871 Bacteria 18017
135 Ga0075434_100021643 3300006871 Bacteria 6253
136 Ga0075434_100035275 3300006871 Bacteria 4944
137 Ga0075434_100037760 3300006871 Bacteria 4781
138 Ga0075434_100203655 3300006871 Bacteria 1999
139 Ga0075434_100309971 3300006871 Unclassified 1599
140 Ga0075429_100004893 3300006880 Bacteria 11542
141 Ga0075429_100082381 3300006880 Bacteria 2804
142 Ga0075436_100000663 3300006914 Bacteria 22664
143 Ga0075436_100035768 3300006914 Bacteria 3425
144 Ga0075436_100056374 3300006914 Bacteria 2714
145 Ga0075436_100141889 3300006914 Bacteria 1688
146 Ga0097620_100048865 3300006931 Bacteria 4249
147 Ga0097620_100167632 3300006931 Bacteria 2276
148 Ga0075435_100002027 3300007076 Bacteria 13255
149 Ga0075435_100033315 3300007076 Bacteria 4072
150 Ga0075435_100038599 3300007076 Bacteria 3807
151 Ga0075435_100173587 3300007076 Bacteria 1819
152 Ga0105240_10158732 3300009093 Bacteria 2688
153 Ga0111539_10006855 3300009094 Bacteria 14635
154 Ga0111539_10010301 3300009094 Bacteria 11768
155 Ga0111539_10016749 3300009094 Bacteria 9083
156 Ga0111539_10048828 3300009094 Bacteria 5050
157 Ga0111539_10139584 3300009094 Unclassified 2838
158 Ga0105245_10017505 3300009098 Bacteria 6253
159 Ga0105247_10038774 3300009101 Bacteria 2910
160 Ga0114129_10010643 3300009147 Bacteria 13119
161 Ga0114129_10034385 3300009147 Bacteria 7158
162 Ga0114129_10078920 3300009147 Bacteria 4578
163 Ga0114129_10125485 3300009147 Bacteria 3530
164 Ga0114129_10577404 3300009147 Bacteria 1459
165 Ga0105243_10186298 3300009148 Bacteria 1809
166 Ga0105242_10309483 3300009176 Bacteria 1445
167 Ga0105248_10025546 3300009177 Bacteria 6567
168 Ga0105238_10009059 3300009551 Bacteria 9958
169 Ga0105249_10020328 3300009553 Bacteria 5936
170 Ga0105249_10193084 3300009553 Bacteria 1988
171 Ga0105239_10091920 3300010375 Bacteria 3349
172 Ga0105246_10008187 3300011119 Bacteria 6419
173 Ga0157371_10043418 3300013102 Bacteria 3203
174 Ga0157370_10031765 3300013104 Bacteria 5162
175 Ga0157369_10022496 3300013105 Bacteria 7032
176 Ga0157374_10100708 3300013296 Bacteria 2770
177 Ga0163162_10077270 3300013306 Bacteria 3392
178 Ga0163162_10201199 3300013306 Bacteria 2121
179 Ga0157372_10019272 3300013307 Bacteria 7346
180 Ga0157372_10099865 3300013307 Bacteria 3311
181 Ga0157375_10191062 3300013308 Bacteria 2202
182 Ga0157380_10094443 3300014326 Bacteria 2475
183 Ga0157377_10001025 3300014745 Bacteria 11804
184 Ga0157377_10006210 3300014745 Bacteria 5683
185 Ga0157377_10221793 3300014745 Bacteria 1211
186 Ga0157379_10017406 3300014968 Bacteria 6330
187 Ga0157376_10209038 3300014969 Bacteria 1801
188 Ga0206354_10405797 3300020081 Bacteria 2482
189 Ga0206353_10013686 3300020082 Bacteria 2335
190 Ga0213876_10001465 3300021384 Bacteria 14693
191 Ga0213876_10024863 3300021384 Bacteria 3163
192 Ga0207692_10001785 3300025898 Bacteria 8161
193 Ga0207692_10013464 3300025898 Bacteria 3549
194 Ga0207692_10037613 3300025898 Bacteria 2368
195 Ga0207710_10018803 3300025900 Bacteria 2941
196 Ga0207685_10006385 3300025905 Bacteria 3207
197 Ga0207699_10000498 3300025906 Bacteria 19673
198 Ga0207699_10052100 3300025906 Bacteria 2421
199 Ga0207643_10000624 3300025908 Bacteria 22324
200 Ga0207684_10002518 3300025910 Bacteria 18425
201 Ga0207684_10029983 3300025910 Bacteria 4631
202 Ga0207684_10092220 3300025910 Bacteria 2582
203 Ga0207684_10130624 3300025910 Bacteria 2156
204 Ga0207684_10273750 3300025910 Bacteria 1457
205 Ga0207695_10179319 3300025913 Bacteria 2040
206 Ga0207693_10001608 3300025915 Bacteria 19968
207 Ga0207693_10101629 3300025915 Bacteria 2255
208 Ga0207693_10116207 3300025915 Bacteria 2101
209 Ga0207663_10011289 3300025916 Bacteria 4793
210 Ga0207663_10023205 3300025916 Bacteria 3556
211 Ga0207660_10026680 3300025917 Bacteria 3935
212 Ga0207657_10010650 3300025919 Bacteria 9160
213 Ga0207652_10063156 3300025921 Bacteria 3202
214 Ga0207646_10002660 3300025922 Bacteria 20960
215 Ga0207646_10048485 3300025922 Bacteria 3807
216 Ga0207646_10148964 3300025922 Bacteria 2110
217 Ga0207646_10295552 3300025922 Bacteria 1463
218 Ga0207650_10057470 3300025925 Bacteria 2893
219 Ga0207659_10026939 3300025926 Bacteria 3885
220 Ga0207687_10056017 3300025927 Bacteria 2764
221 Ga0207700_10003031 3300025928 Bacteria 9690
222 Ga0207700_10053846 3300025928 Bacteria 3017
223 Ga0207664_10004729 3300025929 Bacteria 9242
224 Ga0207664_10044462 3300025929 Bacteria 3478
225 Ga0207664_10175347 3300025929 Bacteria 1837
226 Ga0207644_10067243 3300025931 Bacteria 2611
227 Ga0207690_10043251 3300025932 Bacteria 2963
228 Ga0207690_10129606 3300025932 Bacteria 1844
229 Ga0207706_10010078 3300025933 Bacteria 8655
230 Ga0207709_10097519 3300025935 Bacteria 1936
231 Ga0207665_10010984 3300025939 Bacteria 5943
232 Ga0207665_10016903 3300025939 Bacteria 4790
233 Ga0207665_10044122 3300025939 Bacteria 2983
234 Ga0207665_10061866 3300025939 Unclassified 2539
235 Ga0207691_10032484 3300025940 Bacteria 4865
236 Ga0207691_10090850 3300025940 Bacteria 2736
237 Ga0207711_10334234 3300025941 Bacteria 1401
238 Ga0207689_10009422 3300025942 Bacteria 8432
239 Ga0207661_10003455 3300025944 Bacteria 10967
240 Ga0207661_10023130 3300025944 Bacteria 4692
241 Ga0207661_10023337 3300025944 Bacteria 4673
242 Ga0207679_10043360 3300025945 Bacteria 3239
243 Ga0207679_10054147 3300025945 Bacteria 2952
244 Ga0207667_10438431 3300025949 Bacteria 1328
245 Ga0207651_10330799 3300025960 Bacteria 1277
246 Ga0207712_10290878 3300025961 Unclassified 1337
247 Ga0207640_10068829 3300025981 Bacteria 2374
248 Ga0207677_10032056 3300026023 Bacteria 3374
249 Ga0207677_10112457 3300026023 Bacteria 2030
250 Ga0207678_10023860 3300026067 Bacteria 5349
251 Ga0207708_10029279 3300026075 Bacteria 4173
252 Ga0207702_10002078 3300026078 Bacteria 19339
253 Ga0207702_10049002 3300026078 Bacteria 3563
254 Ga0207674_10035618 3300026116 Bacteria 5195
255 Ga0207674_10195953 3300026116 Bacteria 1970
256 Ga0207675_100071370 3300026118 Bacteria 3247
257 Ga0207683_10045207 3300026121 Bacteria 3850
258 Ga0207698_10080863 3300026142 Bacteria 2620
259 Ga0207428_10002280 3300027907 Bacteria 19250
260 Ga0207428_10033870 3300027907 Bacteria 4190
261 Ga0207428_10141030 3300027907 Bacteria 1839
262 Ga0207428_10178338 3300027907 Bacteria 1606
263 Ga0268265_10195685 3300028380 Bacteria 1749
264 Ga0268265_10302115 3300028380 Bacteria 1442
265 Ga0307408_100019443 3300031548 Bacteria 4574
266 Ga0307405_10001982 3300031731 Bacteria 8851
267 Ga0307405_10010081 3300031731 Bacteria 4875
268 Ga0307405_10021467 3300031731 Bacteria 3630
269 Ga0307405_10081697 3300031731 Bacteria 2113
270 Ga0307413_10004338 3300031824 Bacteria 6155
271 Ga0307413_10019113 3300031824 Bacteria 3611
272 Ga0307410_10016525 3300031852 Bacteria 4404
273 Ga0326468_10001239 3300031889 Bacteria 2302
274 Ga0307406_10002307 3300031901 Bacteria 10356
275 Ga0307406_10013881 3300031901 Bacteria 4624
276 Ga0307406_10066848 3300031901 Bacteria 2341
277 Ga0307406_10073955 3300031901 Unclassified 2242
278 Ga0307407_10005559 3300031903 Bacteria 5486
279 Ga0307409_100010837 3300031995 Bacteria 5702
280 Ga0307409_100011232 3300031995 Bacteria 5631
281 Ga0307409_100046795 3300031995 Bacteria 3277
282 Ga0307409_100066896 3300031995 Bacteria 2835
283 Ga0307409_100077147 3300031995 Bacteria 2675
284 Ga0307416_100001515 3300032002 Bacteria 12670
285 Ga0307416_100002365 3300032002 Bacteria 10794
286 Ga0307416_100076459 3300032002 Unclassified 2806
287 Ga0307416_100184910 3300032002 Bacteria 1957
288 Ga0307414_10043883 3300032004 Bacteria 3049
289 Ga0307414_10082970 3300032004 Bacteria 2352
290 Ga0307411_10161326 3300032005 Unclassified 1680
291 Ga0307415_100000842 3300032126 Bacteria 14028
292 Ga0307415_100002589 3300032126 Bacteria 9036
293 Ga0307415_100010916 3300032126 Bacteria 5168
294 Ga0307415_100019486 3300032126 Bacteria 4120
295 Ga0307415_100058206 3300032126 Bacteria 2660
296 Ga0307415_100071613 3300032126 Bacteria 2438
297 Ga0307415_100190851 3300032126 Bacteria 1617
298 Ga0307415_100223907 3300032126 Bacteria 1510
299 Ga0373948_0003667 3300034817 Bacteria 2380
300 Ga0373928_0011524 3300035084 Bacteria 1751
301 Ga0373934_0000031 3300035086 Bacteria 45039
302 Ga0373934_0000760 3300035086 Bacteria 11561
303 Ga0373934_0010410 3300035086 Bacteria 3491
304 Ga0373934_0017719 3300035086 Bacteria 2721
305 Ga0373934_0029306 3300035086 Unclassified 2148
306 Ga0373952_0003251 3300035092 Bacteria 2925
307 Ga0373923_0003098 3300035111 Bacteria 5271
308 Ga0373923_0057065 3300035111 Bacteria 1650
309 Ga0373936_0004873 3300035113 Bacteria 5058
310 Ga0373945_0044616 3300035116 Bacteria 1613
311 Ga0373953_0000151 3300035117 Bacteria 17853
312 Ga0373953_0007802 3300035117 Bacteria 3606
313 Ga0373953_0019910 3300035117 Bacteria 2502
314 Ga0373954_0007890 3300035118 Bacteria 4663
315 Ga0373954_0019306 3300035118 Bacteria 3073
316 Ga0373954_0027656 3300035118 Bacteria 2605
317 Ga0373956_0000231 3300035119 Bacteria 22066
318 Ga0373956_0018708 3300035119 Bacteria 2935
319 Ga0373957_0000081 3300035120 Bacteria 22990
320 Ga0373957_0002353 3300035120 Bacteria 5375
321 Ga0373957_0027529 3300035120 Unclassified 2065
322 Ga0373960_0004683 3300035121 Bacteria 3145
323 Ga0373946_0045939 3300035171 Bacteria 1808
324 Ga0373955_0000208 3300035172 Bacteria 24470
325 Ga0373955_0049466 3300035172 Bacteria 2282
326 Ga0373955_0087098 3300035172 Unclassified 1774
327 Ga0373955_0128589 3300035172 Bacteria 1477
328 Ga0373924_0001353 3300035410 Bacteria 7903
329 Ga0373924_0001926 3300035410 Bacteria 6905
330 Ga0373924_0045279 3300035410 Bacteria 1810
331 Ga0373935_0004987 3300035692 Bacteria 7812
332 Ga0373935_0151448 3300035692 Bacteria 1574
333 Ga0373927_0120462 3300035695 Bacteria 1712
334 Ga0373933_0000015 3300035724 Bacteria 103111
335 Ga0373933_0000790 3300035724 Bacteria 19347
336 Ga0373933_0012517 3300035724 Bacteria 4687
337 Ga0373933_0017480 3300035724 Unclassified 4023
338 Ga0373933_0037659 3300035724 Bacteria 2838
339 Ga0373937_0000053 3300036401 Bacteria 103072
340 Ga0373937_0040224 3300036401 Bacteria 4261
341 Ga0373937_0071261 3300036401 Bacteria 3205
342 Ga0373937_0127534 3300036401 Bacteria 2374
343 Ga0373937_0227610 3300036401 Unclassified 1755
344 Ga0373925_0169984 3300037068 Bacteria 1721
345 Ga0373925_0182571 3300037068 Bacteria 1661
346 Ga0395899_0064640 3300037312 Bacteria 2690
347 Ga0395899_0090318 3300037312 Bacteria 2221
348 Ga0395899_0187213 3300037312 Bacteria 1450
349 Ga0395900_0102609 3300037418 Bacteria 2938
350 Ga0395900_0173779 3300037418 Bacteria 2192
351 Ga0395900_0188101 3300037418 Bacteria 2095
352 Ga0395898_0021352 3300037466 Bacteria 6566
353 Ga0395898_0032826 3300037466 Bacteria 5183
354 Ga0395898_0460153 3300037466 Bacteria 1211
355 Ga0395905_0013831 3300037471 Bacteria 7720
356 Ga0395905_0126094 3300037471 Bacteria 2407
357 Ga0395905_0376588 3300037471 Bacteria 1313
358 Ga0436364_0797116 3300037853 Bacteria 7644
359 Ga0395901_0005759 3300038443 Bacteria 12554
360 Ga0395901_0028904 3300038443 Bacteria 5703
361 Ga0395901_0050220 3300038443 Bacteria 4334
362 Ga0395901_0081903 3300038443 Bacteria 3371
363 Ga0395901_0095711 3300038443 Bacteria 3111
364 Ga0395901_0234963 3300038443 Bacteria 1913
365 Ga0436365_0043975 3300039437 Bacteria 6582
366 Ga0436365_0578598 3300039437 Bacteria 60563
367 Ga0436363_1173535 3300039450 Bacteria 1883
368 Ga0439448_0032918 3300042005 Bacteria 1651
369 Ga0439448_0038727 3300042005 Bacteria 1535
370 Ga0439450_000265 3300042008 Bacteria 6365
371 Ga0439450_012253 3300042008 Bacteria 1698
372 Ga0439454_006492 3300042011 Bacteria 1440
373 Ga0439456_004949 3300042013 Bacteria 2703
374 Ga0439463_004947 3300042016 Bacteria 3323
375 Ga0439463_015236 3300042016 Bacteria 1901
376 Ga0439463_018506 3300042016 Bacteria 1734
377 Ga0439463_026974 3300042016 Bacteria 1444
378 Ga0450888_002827 3300042126 Bacteria 1732
379 Ga0450900_004203 3300042136 Bacteria 1645
380 Ga0450905_003182 3300042142 Bacteria 2152
381 Ga0450910_008490 3300042147 Bacteria 1446
382 Ga0439444_0001480 3300042437 Bacteria 3065
383 Ga0439464_0001983 3300042439 Bacteria 4956
384 Ga0439460_0000589 3300042461 Bacteria 7987
385 Ga0439460_0024581 3300042461 Bacteria 1670
386 Ga0466963_0027912 3300044694 Bacteria 3619
387 Ga0466963_0196855 3300044694 Bacteria 1409
388 Ga0466957_0025217 3300044842 Bacteria 3523
389 Ga0466967_0139731 3300045976 Bacteria 2255
390 Ga0466967_0264537 3300045976 Bacteria 1646
391 Ga0495592_0000057 3300046454 Bacteria 103108
392 Ga0495592_0023560 3300046454 Bacteria 4683
393 Ga0495592_0042394 3300046454 Bacteria 3408
394 Ga0495592_0098746 3300046454 Bacteria 2083
395 Ga0495603_0034959 3300046455 Bacteria 3020
396 Ga0495629_0002284 3300046459 Bacteria 14770
397 Ga0495629_0023894 3300046459 Bacteria 4353
398 Ga0495641_0013830 3300046461 Bacteria 4402
399 Ga0495641_0021266 3300046461 Bacteria 3266
400 Ga0495651_0000032 3300046462 Bacteria 103111
401 Ga0495651_0031798 3300046462 Bacteria 4114
402 Ga0495651_0038062 3300046462 Bacteria 3746
403 Ga0495651_0060399 3300046462 Unclassified 2903
404 Ga0495651_0077985 3300046462 Bacteria 2506
405 Ga0495653_0003850 3300046463 Bacteria 12134
406 Ga0495653_0031686 3300046463 Bacteria 4201
407 Ga0495653_0046616 3300046463 Bacteria 3355
408 Ga0495653_0132891 3300046463 Unclassified 1759
409 Ga0495664_0007283 3300046477 Bacteria 6138
410 Ga0495664_0011629 3300046477 Bacteria 4966
411 Ga0495664_0024383 3300046477 Bacteria 3515
412 Ga0495608_0000045 3300046511 Bacteria 100413
413 Ga0495608_0002509 3300046511 Bacteria 13167
414 Ga0495608_0058293 3300046511 Unclassified 2546
415 Ga0495618_0020342 3300046514 Bacteria 4084
416 Ga0495628_0000063 3300046516 Bacteria 86231
417 Ga0495628_0037776 3300046516 Bacteria 3870
418 Ga0495628_0061281 3300046516 Bacteria 2950
419 Ga0495630_0044932 3300046517 Bacteria 3300
420 Ga0495630_0176351 3300046517 Bacteria 1629
421 Ga0495652_0000078 3300046529 Bacteria 103039
422 Ga0495652_0008603 3300046529 Bacteria 9305
423 Ga0495652_0048570 3300046529 Bacteria 3635
424 Ga0495665_0001346 3300046531 Bacteria 13134
425 Ga0495665_0009906 3300046531 Bacteria 5160
426 Ga0495640_0034638 3300046533 Bacteria 3577
427 Ga0495640_0100596 3300046533 Bacteria 1898
428 Ga0495587_0000050 3300046536 Bacteria 103111
429 Ga0495587_0005595 3300046536 Bacteria 8198
430 Ga0495587_0070004 3300046536 Bacteria 2042
431 Ga0495587_0193742 3300046536 Unclassified 1150
432 Ga0495609_0045698 3300046538 Bacteria 1962
433 Ga0495645_0009049 3300046543 Bacteria 6955
434 Ga0495645_0013640 3300046543 Bacteria 5756
435 Ga0495645_0019152 3300046543 Bacteria 4927
436 Ga0495645_0153197 3300046543 Bacteria 1599
437 Ga0495667_0000055 3300046559 Bacteria 103111
438 Ga0495667_0003259 3300046559 Bacteria 10878
439 Ga0495667_0033981 3300046559 Bacteria 3410
440 Ga0495667_0048491 3300046559 Bacteria 2804
441 Ga0495667_0050561 3300046559 Unclassified 2743
442 Ga0495667_0094172 3300046559 Bacteria 1939
443 Ga0495634_0006054 3300046642 Bacteria 9226
444 Ga0495634_0023755 3300046642 Bacteria 4307
445 Ga0495634_0025049 3300046642 Bacteria 4181
446 Ga0495635_0041393 3300046663 Bacteria 3182
447 Ga0495635_0055169 3300046663 Bacteria 2737
448 Ga0495661_0156236 3300046665 Bacteria 1228
449 Ga0495657_0000009 3300046675 Bacteria 217555
450 Ga0495657_0007024 3300046675 Bacteria 8735
451 Ga0495657_0012832 3300046675 Bacteria 6209
452 Ga0495657_0036295 3300046675 Bacteria 3407
453 Ga0495657_0055824 3300046675 Bacteria 2634
454 Ga0495599_0000033 3300046678 Bacteria 106425
455 Ga0495599_0014104 3300046678 Bacteria 4947
456 Ga0495599_0018677 3300046678 Bacteria 4319
457 Ga0495599_0137288 3300046678 Unclassified 1517
458 Ga0495623_0011619 3300046679 Bacteria 5703
459 Ga0495646_0005623 3300046680 Bacteria 7933
460 Ga0495647_0037308 3300046681 Bacteria 1833
461 Ga0495613_0017438 3300046689 Bacteria 5347
462 Ga0495624_0037475 3300046690 Bacteria 3118
463 Ga0495600_0010180 3300046809 Bacteria 5827
464 Ga0495600_0036155 3300046809 Bacteria 3209
465 Ga0495600_0067826 3300046809 Bacteria 2331
466 Ga0495581_0002573 3300047315 Bacteria 10305
467 Ga0495581_0005622 3300047315 Bacteria 7265
468 Ga0495604_0000052 3300047317 Bacteria 103088
469 Ga0495604_0037350 3300047317 Bacteria 3825
470 Ga0495604_0056232 3300047317 Bacteria 3030
471 Ga0495604_0060777 3300047317 Bacteria 2892
472 Ga0495674_0031298 3300047319 Bacteria 4834
473 Ga0495674_0042374 3300047319 Bacteria 4060
474 Ga0495680_0000027 3300047322 Bacteria 113036
475 Ga0495680_0003729 3300047322 Bacteria 14842
476 Ga0495680_0005074 3300047322 Bacteria 12428
477 Ga0495680_0038510 3300047322 Bacteria 3820
478 Ga0495675_0000191 3300047444 Bacteria 44921
479 Ga0495675_0041471 3300047444 Unclassified 2934
480 Ga0495675_0154039 3300047444 Bacteria 1418
481 Ga0495684_0023938 3300047471 Bacteria 4696
482 Ga0495684_0066693 3300047471 Bacteria 2736
483 Ga0495684_0076543 3300047471 Bacteria 2541
484 Ga0495684_0078676 3300047471 Bacteria 2502
485 Ga0495684_0115431 3300047471 Bacteria 2024
486 Ga0495593_0004475 3300047673 Bacteria 8306
487 Ga0495602_0000756 3300048088 Bacteria 30716
488 Ga0495602_0015346 3300048088 Bacteria 7738
489 Ga0495602_0027530 3300048088 Bacteria 5461
490 Ga0495602_0071881 3300048088 Bacteria 2952
491 Ga0495602_0082423 3300048088 Bacteria 2699
492 Ga0495602_0091198 3300048088 Bacteria 2528
493 Ga0495614_0026701 3300048089 Bacteria 2489
494 Ga0496100_0048419 3300048903 Bacteria 2743
495 Ga0496102_0097390 3300048905 Bacteria 2728
496 Ga0496104_0059291 3300048907 Bacteria 3623
497 Ga0496104_0250049 3300048907 Bacteria 1685
498 Ga0496105_0005714 3300048908 Bacteria 9468
499 Ga0496105_0050346 3300048908 Bacteria 3440
500 Ga0496106_0011607 3300048909 Bacteria 6510
501 Ga0496106_0030408 3300048909 Bacteria 4028
502 Ga0496108_0001459 3300048911 Bacteria 18696
503 Ga0496108_0108327 3300048911 Bacteria 2373
504 Ga0496108_0141076 3300048911 Bacteria 2076
505 Ga0496109_0073281 3300048912 Bacteria 3146
506 Ga0496109_0414427 3300048912 Bacteria 1273
507 Ga0496110_0064494 3300048913 Bacteria 3237
508 Ga0496111_0001909 3300048914 Bacteria 12336
509 Ga0496112_0076142 3300048915 Bacteria 3318
510 Ga0496112_0097963 3300048915 Bacteria 2902
511 Ga0496113_0027530 3300048916 Bacteria 4076
512 Ga0496115_0039654 3300048918 Bacteria 3741
513 Ga0501031_0000708 3300049568 Bacteria 19922
514 Ga0501031_0017830 3300049568 Bacteria 4617
515 Ga0501031_0106172 3300049568 Bacteria 1833
516 Ga0501033_0019426 3300049570 Bacteria 5139
517 Ga0501033_0116722 3300049570 Bacteria 1939
518 Ga0501036_0000868 3300049572 Bacteria 22508
519 Ga0501036_0006516 3300049572 Bacteria 9484
520 Ga0501036_0011767 3300049572 Bacteria 7250
521 Ga0501036_0016270 3300049572 Bacteria 6213
522 Ga0501037_0109348 3300049573 Bacteria 1992
523 Ga0501038_0001594 3300049574 Bacteria 21053
524 Ga0501038_0155057 3300049574 Bacteria 1865
525 Ga0501039_0000454 3300049575 Bacteria 29734
526 Ga0501039_0002694 3300049575 Bacteria 13258
527 Ga0501039_0014888 3300049575 Bacteria 5948
528 Ga0501040_0000619 3300049576 Bacteria 21740
529 Ga0501040_0003753 3300049576 Bacteria 9848
530 Ga0501040_0007466 3300049576 Bacteria 7082
531 Ga0501040_0026147 3300049576 Bacteria 3925
532 Ga0501041_0007603 3300049577 Bacteria 6363
533 Ga0501041_0022364 3300049577 Bacteria 3785
534 Ga0501041_0205195 3300049577 Bacteria 1236
535 Ga0501042_0001651 3300049578 Bacteria 13293
536 Ga0501042_0002546 3300049578 Bacteria 11213
537 Ga0501042_0100977 3300049578 Bacteria 2074
538 Ga0501042_0148687 3300049578 Bacteria 1689
539 Ga0501043_0022145 3300049579 Bacteria 4986
540 Ga0501046_0001348 3300049580 Bacteria 23779
541 Ga0501046_0006644 3300049580 Bacteria 10219
542 Ga0501046_0159664 3300049580 Bacteria 1696
543 Ga0501048_0001279 3300049582 Bacteria 19076
544 Ga0501048_0001325 3300049582 Bacteria 18758
545 Ga0501068_0069300 3300049584 Bacteria 2150
546 Ga0501069_0018762 3300049585 Bacteria 3736
547 Ga0501069_0031576 3300049585 Bacteria 2914
548 Ga0501070_0026984 3300049586 Bacteria 4817
549 Ga0501071_0000687 3300049587 Bacteria 17680
550 Ga0501071_0041470 3300049587 Bacteria 3297
551 Ga0501072_0003321 3300049588 Bacteria 12105
552 Ga0501072_0020440 3300049588 Bacteria 5130
553 Ga0501072_0034049 3300049588 Bacteria 3991
554 Ga0501074_0015751 3300049590 Bacteria 5496
555 Ga0501074_0031437 3300049590 Bacteria 3845
556 Ga0501074_0218787 3300049590 Bacteria 1356
557 Ga0501075_0000224 3300049591 Bacteria 30212
558 Ga0501075_0000539 3300049591 Bacteria 22950
559 Ga0501075_0002800 3300049591 Bacteria 11685
560 Ga0501075_0030638 3300049591 Bacteria 3985
561 Ga0501075_0135716 3300049591 Bacteria 1875
562 Ga0501076_0000544 3300049592 Bacteria 24072
563 Ga0501076_0001510 3300049592 Bacteria 15591
564 Ga0501077_0000842 3300049593 Bacteria 18581
565 Ga0501077_0009683 3300049593 Bacteria 5989
566 Ga0501079_0000580 3300049741 Bacteria 24226
567 Ga0501079_0011051 3300049741 Bacteria 6884
568 Ga0501079_0038591 3300049741 Bacteria 3683
569 Ga0501080_0008226 3300049742 Bacteria 9445
570 Ga0501080_0418026 3300049742 Bacteria 1205
571 Ga0501081_0004091 3300049743 Bacteria 9344
572 Ga0501081_0004270 3300049743 Bacteria 9161
573 Ga0501081_0007577 3300049743 Bacteria 7036
574 Ga0501081_0021488 3300049743 Bacteria 4308
575 Ga0501081_0163710 3300049743 Bacteria 1604
576 Ga0501083_0158952 3300049744 Bacteria 1479
577 Ga0501035_0004285 3300049822 Bacteria 13543
578 Ga0501045_0000261 3300049824 Bacteria 30562
579 Ga0501045_0001915 3300049824 Bacteria 14074
580 Ga0501045_0006315 3300049824 Bacteria 8196
581 Ga0501045_0036185 3300049824 Bacteria 3584
582 Ga0501045_0294485 3300049824 Bacteria 1208
583 nmdc:mga05p37_16641_c1 3300050507 Bacteria 8858
584 nmdc:mga05p37_21100_c1 3300050507 Bacteria 7885
585 nmdc:mga05p37_44136_c1 3300050507 Bacteria 5485
586 nmdc:mga05p37_6076_c1 3300050507 Bacteria 14219
587 nmdc:mga05p37_7014_c1 3300050507 Bacteria 13281
588 nmdc:mga05p37_99490_c1 3300050507 Bacteria 3582
589 nmdc:mga09592_14307_c1 3300050508 Bacteria 4758
590 nmdc:mga09592_19885_c1 3300050508 Bacteria 5516
591 nmdc:mga09592_7469_c1 3300050508 Bacteria 8885
592 nmdc:mga0qj67_10436_c1 3300050509 Bacteria 6940
593 nmdc:mga0qj67_22_c3 3300050509 Bacteria 58549
594 nmdc:mga0qj67_285336_c1 3300050509 Bacteria 1338
595 nmdc:mga0qj67_3633_c1 3300050509 Bacteria 11129
596 nmdc:mga06r32_19205_c1 3300050510 Bacteria 6273
597 nmdc:mga06r32_243591_c1 3300050510 Bacteria 1785
598 nmdc:mga06r32_318360_c1 3300050510 Bacteria 1541
599 nmdc:mga06r32_5261_c1 3300050510 Bacteria 11641
600 nmdc:mga06r32_8071_c1 3300050510 Bacteria 9472
601 nmdc:mga06r32_851_c3 3300050510 Bacteria 22324
602 nmdc:mga08y16_205630_c1 3300050511 Bacteria 2040
603 nmdc:mga08y16_24689_c1 3300050511 Bacteria 6343
604 nmdc:mga08y16_26416_c1 3300050511 Bacteria 6123
605 nmdc:mga08y16_3603_c1 3300050511 Bacteria 16079
606 nmdc:mga08y16_8672_c1 3300050511 Bacteria 10662
607 nmdc:mga0n895_208945_c1 3300050512 Bacteria 1982
608 nmdc:mga0n895_247470_c1 3300050512 Unclassified 1809
609 nmdc:mga0n895_48390_c1 3300050512 Bacteria 4162
610 nmdc:mga0n895_7146_c1 3300050512 Bacteria 9550
611 nmdc:mga0n895_8215_c1 3300050512 Bacteria 9024
612 nmdc:mga0n895_9633_c1 3300050512 Bacteria 8465
613 nmdc:mga0rr50_136877_c1 3300050513 Bacteria 1967
614 nmdc:mga0rr50_63274_c1 3300050513 Bacteria 2794
615 nmdc:mga08x19_15565_c1 3300050514 Bacteria 4629
616 nmdc:mga0a205_20169_c1 3300050515 Bacteria 6288
617 nmdc:mga0a205_344041_c1 3300050515 Bacteria 1359
618 nmdc:mga0a205_3455_c1 3300050515 Bacteria 14107
619 nmdc:mga0a205_35297_c1 3300050515 Bacteria 4801
620 nmdc:mga0a205_44839_c2 3300050515 Bacteria 3654
621 Ga0495595_0000710 3300053084 Bacteria 12697
622 Ga0495595_0003702 3300053084 Bacteria 6076
623 Ga0495619_0008609 3300053085 Bacteria 6454
624 Ga0495619_0013235 3300053085 Bacteria 5199
625 Ga0500616_0016573 3300053153 Bacteria 4192
626 Ga0501084_0000264 3300054114 Bacteria 39550
627 Ga0501084_0005132 3300054114 Bacteria 10721
628 Ga0501084_0006958 3300054114 Bacteria 9316
629 Ga0501084_0328476 3300054114 Bacteria 1292
630 Ga0590071_017698 3300059421 Bacteria 1674
631 Ga0590075_001084 3300059424 Bacteria 7015
632 Ga0590075_011694 3300059424 Bacteria 2125
633 Ga0590077_001619 3300059426 Bacteria 5162
634 Ga0501082_0001425 3300060353 Bacteria 21015
635 Ga0501082_0041953 3300060353 Bacteria 3945
636 Ga0501082_0143218 3300060353 Bacteria 2074
637 Ga0501082_0235611 3300060353 Bacteria 1593
638 Ga0530510_0000269 3300061734 Bacteria 32734
639 Ga0530510_0001940 3300061734 Bacteria 14156
640 Ga0530510_0009692 3300061734 Bacteria 6758
641 2895431572 2895427314 Bacteria 13147766
642 Ga0111539_10299991
643 JGI25407J50210_10001823
644 JGI25407J50210_10018575
645 JGI25407J50210_10027487
646 JGI25407J50210_10038778
647 Ga0070676_10039542
648 Ga0070683_100002954
649 Ga0070683_100324285
650 Ga0070670_100039279
651 Ga0070670_100087292
652 Ga0068869_100002664
653 Ga0068869_100070680
654 Ga0070682_100018260
655 Ga0070682_100069653
656 Ga0068868_100007164
657 Ga0070660_100173784
658 Ga0070691_10001538
659 Ga0070687_100162306
660 Ga0070661_100044405
661 Ga0070669_100113215
662 Ga0070675_100009104
663 Ga0070675_100010062
664 Ga0070671_100032104
665 Ga0070671_100111262
666 Ga0070673_100004502
667 Ga0070659_100027063
668 Ga0070709_10009881
669 Ga0070709_10030851
670 Ga0070709_10057101
671 Ga0070714_100000449
672 Ga0070714_100022034
673 Ga0070714_100025919
674 Ga0070714_100028341
675 Ga0070713_100053850
676 Ga0070713_100225510
677 Ga0070710_10003211
678 Ga0070710_10009107
679 Ga0070701_10062898
680 Ga0070711_100084684
681 Ga0070700_100090841
682 Ga0070708_100200281
683 Ga0070663_100069283
684 Ga0070678_100026365
685 Ga0070662_100058573
686 Ga0070706_100002259
687 Ga0070706_100020543
688 Ga0070706_100133390
689 Ga0070706_100241501
690 Ga0070707_100010690
691 Ga0070707_100018397
692 Ga0070707_100022461
693 Ga0070707_100065077
694 Ga0070698_100001269
695 Ga0070698_100009431
696 Ga0070698_100019092
697 Ga0070698_100042584
698 Ga0070699_100002426
699 Ga0070679_100011760
700 Ga0070684_100090818
701 Ga0070697_100117278
702 Ga0068853_100082698
703 Ga0070672_100071010
704 Ga0070672_100083546
705 Ga0070696_100018903
706 Ga0070693_100003760
707 Ga0070665_100052846
708 Ga0068855_100089064
709 Ga0070664_100007440
710 Ga0068857_100043152
711 Ga0068856_100078857
712 Ga0070702_100003431
713 Ga0068852_100025604
714 Ga0068859_100048864
715 Ga0068859_100167626
716 Ga0068864_100009334
717 Ga0068861_100180588
718 Ga0068870_10007789
719 Ga0068870_10144270
720 Ga0068863_100018636
721 Ga0068860_100026646
722 Ga0068860_100303263
723 Ga0068862_100006890
724 Ga0081455_10000613
725 Ga0081455_10000984
726 Ga0081455_10002019
727 Ga0081455_10006961
728 Ga0081455_10009471
729 Ga0081455_10022928
730 Ga0081455_10043802
731 Ga0081455_10046198
732 Ga0081538_10000139
733 Ga0081538_10000704
734 Ga0081538_10005296
735 Ga0081538_10011358
736 Ga0081538_10020497
737 Ga0081538_10028285
738 Ga0081538_10032059
739 Ga0081538_10035816
740 Ga0081538_10044240
741 Ga0081540_1000334
742 Ga0081540_1001224
743 Ga0081540_1013051
744 Ga0081540_1021132
745 Ga0081540_1025723
746 Ga0081540_1039986
747 Ga0081539_10007226
748 Ga0081539_10020205
749 Ga0081539_10041769
750 Ga0070717_10010914
751 Ga0075432_10036071
752 Ga0070716_100032543
753 Ga0070712_100005943
754 Ga0070712_100091085
755 Ga0075367_10030744
756 Ga0075367_10151560
757 Ga0075427_10002202
758 Ga0068871_100036296
759 Ga0075428_100004948
760 Ga0075428_100020793
761 Ga0075428_100029751
762 Ga0075428_100048567
763 Ga0075428_100080554
764 Ga0075430_100003287
765 Ga0075431_100000036
766 Ga0075431_100002693
767 Ga0075431_100005619
768 Ga0075431_100007275
769 Ga0075431_100055618
770 Ga0075431_100356292
771 Ga0075433_10020330
772 Ga0075433_10039037
773 Ga0075433_10050754
774 Ga0075433_10074633
775 Ga0075434_100001921
776 Ga0075434_100021643
777 Ga0075434_100035275
778 Ga0075434_100037760
779 Ga0075434_100203655
780 Ga0075434_100309971
781 Ga0075429_100004893
782 Ga0075429_100082381
783 Ga0075436_100000663
784 Ga0075436_100035768
785 Ga0075436_100056374
786 Ga0075436_100141889
787 Ga0097620_100048865
788 Ga0097620_100167632
789 Ga0075435_100002027
790 Ga0075435_100033315
791 Ga0075435_100038599
792 Ga0075435_100173587
793 Ga0105240_10158732
794 Ga0111539_10006855
795 Ga0111539_10010301
796 Ga0111539_10016749
797 Ga0111539_10048828
798 Ga0111539_10139584
799 Ga0105245_10017505
800 Ga0105247_10038774
801 Ga0114129_10010643
802 Ga0114129_10034385
803 Ga0114129_10078920
804 Ga0114129_10125485
805 Ga0114129_10577404
806 Ga0105243_10186298
807 Ga0105242_10309483
808 Ga0105248_10025546
809 Ga0105238_10009059
810 Ga0105249_10020328
811 Ga0105249_10193084
812 Ga0105239_10091920
813 Ga0105246_10008187
814 Ga0157371_10043418
815 Ga0157370_10031765
816 Ga0157369_10022496
817 Ga0157374_10100708
818 Ga0163162_10077270
819 Ga0163162_10201199
820 Ga0157372_10019272
821 Ga0157372_10099865
822 Ga0157375_10191062
823 Ga0157380_10094443
824 Ga0157377_10001025
825 Ga0157377_10006210
826 Ga0157377_10221793
827 Ga0157379_10017406
828 Ga0157376_10209038
829 Ga0206354_10405797
830 Ga0206353_10013686
831 Ga0213876_10001465
832 Ga0213876_10024863
833 Ga0207692_10001785
834 Ga0207692_10013464
835 Ga0207692_10037613
836 Ga0207710_10018803
837 Ga0207685_10006385
838 Ga0207699_10000498
839 Ga0207699_10052100
840 Ga0207643_10000624
841 Ga0207684_10002518
842 Ga0207684_10029983
843 Ga0207684_10092220
844 Ga0207684_10130624
845 Ga0207684_10273750
846 Ga0207695_10179319
847 Ga0207693_10001608
848 Ga0207693_10101629
849 Ga0207693_10116207
850 Ga0207663_10011289
851 Ga0207663_10023205
852 Ga0207660_10026680
853 Ga0207657_10010650
854 Ga0207652_10063156
855 Ga0207646_10002660
856 Ga0207646_10048485
857 Ga0207646_10148964
858 Ga0207646_10295552
859 Ga0207650_10057470
860 Ga0207659_10026939
861 Ga0207687_10056017
862 Ga0207700_10003031
863 Ga0207700_10053846
864 Ga0207664_10004729
865 Ga0207664_10044462
866 Ga0207664_10175347
867 Ga0207644_10067243
868 Ga0207690_10043251
869 Ga0207690_10129606
870 Ga0207706_10010078
871 Ga0207709_10097519
872 Ga0207665_10010984
873 Ga0207665_10016903
874 Ga0207665_10044122
875 Ga0207665_10061866
876 Ga0207691_10032484
877 Ga0207691_10090850
878 Ga0207711_10334234
879 Ga0207689_10009422
880 Ga0207661_10003455
881 Ga0207661_10023130
882 Ga0207661_10023337
883 Ga0207679_10043360
884 Ga0207679_10054147
885 Ga0207667_10438431
886 Ga0207651_10330799
887 Ga0207712_10290878
888 Ga0207640_10068829
889 Ga0207677_10032056
890 Ga0207677_10112457
891 Ga0207678_10023860
892 Ga0207708_10029279
893 Ga0207702_10002078
894 Ga0207702_10049002
895 Ga0207674_10035618
896 Ga0207674_10195953
897 Ga0207675_100071370
898 Ga0207683_10045207
899 Ga0207698_10080863
900 Ga0207428_10002280
901 Ga0207428_10033870
902 Ga0207428_10141030
903 Ga0207428_10178338
904 Ga0268265_10195685
905 Ga0268265_10302115
906 Ga0307408_100019443
907 Ga0307405_10001982
908 Ga0307405_10010081
909 Ga0307405_10021467
910 Ga0307405_10081697
911 Ga0307413_10004338
912 Ga0307413_10019113
913 Ga0307410_10016525
914 Ga0326468_10001239
915 Ga0307406_10002307
916 Ga0307406_10013881
917 Ga0307406_10066848
918 Ga0307406_10073955
919 Ga0307407_10005559
920 Ga0307409_100010837
921 Ga0307409_100011232
922 Ga0307409_100046795
923 Ga0307409_100066896
924 Ga0307409_100077147
925 Ga0307416_100001515
926 Ga0307416_100002365
927 Ga0307416_100076459
928 Ga0307416_100184910
929 Ga0307414_10043883
930 Ga0307414_10082970
931 Ga0307411_10161326
932 Ga0307415_100000842
933 Ga0307415_100002589
934 Ga0307415_100010916
935 Ga0307415_100019486
936 Ga0307415_100058206
937 Ga0307415_100071613
938 Ga0307415_100190851
939 Ga0307415_100223907
940 Ga0373948_0003667
941 Ga0373928_0011524
942 Ga0373934_0000031
943 Ga0373934_0000760
944 Ga0373934_0010410
945 Ga0373934_0017719
946 Ga0373934_0029306
947 Ga0373952_0003251
948 Ga0373923_0003098
949 Ga0373923_0057065
950 Ga0373936_0004873
951 Ga0373945_0044616
952 Ga0373953_0000151
953 Ga0373953_0007802
954 Ga0373953_0019910
955 Ga0373954_0007890
956 Ga0373954_0019306
957 Ga0373954_0027656
958 Ga0373956_0000231
959 Ga0373956_0018708
960 Ga0373957_0000081
961 Ga0373957_0002353
962 Ga0373957_0027529
963 Ga0373960_0004683
964 Ga0373946_0045939
965 Ga0373955_0000208
966 Ga0373955_0049466
967 Ga0373955_0087098
968 Ga0373955_0128589
969 Ga0373924_0001353
970 Ga0373924_0001926
971 Ga0373924_0045279
972 Ga0373935_0004987
973 Ga0373935_0151448
974 Ga0373927_0120462
975 Ga0373933_0000015
976 Ga0373933_0000790
977 Ga0373933_0012517
978 Ga0373933_0017480
979 Ga0373933_0037659
980 Ga0373937_0000053
981 Ga0373937_0040224
982 Ga0373937_0071261
983 Ga0373937_0127534
984 Ga0373937_0227610
985 Ga0373925_0169984
986 Ga0373925_0182571
987 Ga0395899_0064640
988 Ga0395899_0090318
989 Ga0395899_0187213
990 Ga0395900_0102609
991 Ga0395900_0173779
992 Ga0395900_0188101
993 Ga0395898_0021352
994 Ga0395898_0032826
995 Ga0395898_0460153
996 Ga0395905_0013831
997 Ga0395905_0126094
998 Ga0395905_0376588
999 Ga0436364_0797116
1000 Ga0395901_0005759
1001 Ga0395901_0028904
1002 Ga0395901_0050220
1003 Ga0395901_0081903
1004 Ga0395901_0095711
1005 Ga0395901_0234963
1006 Ga0436365_0043975
1007 Ga0436365_0578598
1008 Ga0436363_1173535
1009 Ga0439448_0032918
1010 Ga0439448_0038727
1011 Ga0439450_000265
1012 Ga0439450_012253
1013 Ga0439454_006492
1014 Ga0439456_004949
1015 Ga0439463_004947
1016 Ga0439463_015236
1017 Ga0439463_018506
1018 Ga0439463_026974
1019 Ga0450888_002827
1020 Ga0450900_004203
1021 Ga0450905_003182
1022 Ga0450910_008490
1023 Ga0439444_0001480
1024 Ga0439464_0001983
1025 Ga0439460_0000589
1026 Ga0439460_0024581
1027 Ga0466963_0027912
1028 Ga0466963_0196855
1029 Ga0466957_0025217
1030 Ga0466967_0139731
1031 Ga0466967_0264537
1032 Ga0495592_0000057
1033 Ga0495592_0023560
1034 Ga0495592_0042394
1035 Ga0495592_0098746
1036 Ga0495603_0034959
1037 Ga0495629_0002284
1038 Ga0495629_0023894
1039 Ga0495641_0013830
1040 Ga0495641_0021266
1041 Ga0495651_0000032
1042 Ga0495651_0031798
1043 Ga0495651_0038062
1044 Ga0495651_0060399
1045 Ga0495651_0077985
1046 Ga0495653_0003850
1047 Ga0495653_0031686
1048 Ga0495653_0046616
1049 Ga0495653_0132891
1050 Ga0495664_0007283
1051 Ga0495664_0011629
1052 Ga0495664_0024383
1053 Ga0495608_0000045
1054 Ga0495608_0002509
1055 Ga0495608_0058293
1056 Ga0495618_0020342
1057 Ga0495628_0000063
1058 Ga0495628_0037776
1059 Ga0495628_0061281
1060 Ga0495630_0044932
1061 Ga0495630_0176351
1062 Ga0495652_0000078
1063 Ga0495652_0008603
1064 Ga0495652_0048570
1065 Ga0495665_0001346
1066 Ga0495665_0009906
1067 Ga0495640_0034638
1068 Ga0495640_0100596
1069 Ga0495587_0000050
1070 Ga0495587_0005595
1071 Ga0495587_0070004
1072 Ga0495587_0193742
1073 Ga0495609_0045698
1074 Ga0495645_0009049
1075 Ga0495645_0013640
1076 Ga0495645_0019152
1077 Ga0495645_0153197
1078 Ga0495667_0000055
1079 Ga0495667_0003259
1080 Ga0495667_0033981
1081 Ga0495667_0048491
1082 Ga0495667_0050561
1083 Ga0495667_0094172
1084 Ga0495634_0006054
1085 Ga0495634_0023755
1086 Ga0495634_0025049
1087 Ga0495635_0041393
1088 Ga0495635_0055169
1089 Ga0495661_0156236
1090 Ga0495657_0000009
1091 Ga0495657_0007024
1092 Ga0495657_0012832
1093 Ga0495657_0036295
1094 Ga0495657_0055824
1095 Ga0495599_0000033
1096 Ga0495599_0014104
1097 Ga0495599_0018677
1098 Ga0495599_0137288
1099 Ga0495623_0011619
1100 Ga0495646_0005623
1101 Ga0495647_0037308
1102 Ga0495613_0017438
1103 Ga0495624_0037475
1104 Ga0495600_0010180
1105 Ga0495600_0036155
1106 Ga0495600_0067826
1107 Ga0495581_0002573
1108 Ga0495581_0005622
1109 Ga0495604_0000052
1110 Ga0495604_0037350
1111 Ga0495604_0056232
1112 Ga0495604_0060777
1113 Ga0495674_0031298
1114 Ga0495674_0042374
1115 Ga0495680_0000027
1116 Ga0495680_0003729
1117 Ga0495680_0005074
1118 Ga0495680_0038510
1119 Ga0495675_0000191
1120 Ga0495675_0041471
1121 Ga0495675_0154039
1122 Ga0495684_0023938
1123 Ga0495684_0066693
1124 Ga0495684_0076543
1125 Ga0495684_0078676
1126 Ga0495684_0115431
1127 Ga0495593_0004475
1128 Ga0495602_0000756
1129 Ga0495602_0015346
1130 Ga0495602_0027530
1131 Ga0495602_0071881
1132 Ga0495602_0082423
1133 Ga0495602_0091198
1134 Ga0495614_0026701
1135 Ga0496100_0048419
1136 Ga0496102_0097390
1137 Ga0496104_0059291
1138 Ga0496104_0250049
1139 Ga0496105_0005714
1140 Ga0496105_0050346
1141 Ga0496106_0011607
1142 Ga0496106_0030408
1143 Ga0496108_0001459
1144 Ga0496108_0108327
1145 Ga0496108_0141076
1146 Ga0496109_0073281
1147 Ga0496109_0414427
1148 Ga0496110_0064494
1149 Ga0496111_0001909
1150 Ga0496112_0076142
1151 Ga0496112_0097963
1152 Ga0496113_0027530
1153 Ga0496115_0039654
1154 Ga0501031_0000708
1155 Ga0501031_0017830
1156 Ga0501031_0106172
1157 Ga0501033_0019426
1158 Ga0501033_0116722
1159 Ga0501036_0000868
1160 Ga0501036_0006516
1161 Ga0501036_0011767
1162 Ga0501036_0016270
1163 Ga0501037_0109348
1164 Ga0501038_0001594
1165 Ga0501038_0155057
1166 Ga0501039_0000454
1167 Ga0501039_0002694
1168 Ga0501039_0014888
1169 Ga0501040_0000619
1170 Ga0501040_0003753
1171 Ga0501040_0007466
1172 Ga0501040_0026147
1173 Ga0501041_0007603
1174 Ga0501041_0022364
1175 Ga0501041_0205195
1176 Ga0501042_0001651
1177 Ga0501042_0002546
1178 Ga0501042_0100977
1179 Ga0501042_0148687
1180 Ga0501043_0022145
1181 Ga0501046_0001348
1182 Ga0501046_0006644
1183 Ga0501046_0159664
1184 Ga0501048_0001279
1185 Ga0501048_0001325
1186 Ga0501068_0069300
1187 Ga0501069_0018762
1188 Ga0501069_0031576
1189 Ga0501070_0026984
1190 Ga0501071_0000687
1191 Ga0501071_0041470
1192 Ga0501072_0003321
1193 Ga0501072_0020440
1194 Ga0501072_0034049
1195 Ga0501074_0015751
1196 Ga0501074_0031437
1197 Ga0501074_0218787
1198 Ga0501075_0000224
1199 Ga0501075_0000539
1200 Ga0501075_0002800
1201 Ga0501075_0030638
1202 Ga0501075_0135716
1203 Ga0501076_0000544
1204 Ga0501076_0001510
1205 Ga0501077_0000842
1206 Ga0501077_0009683
1207 Ga0501079_0000580
1208 Ga0501079_0011051
1209 Ga0501079_0038591
1210 Ga0501080_0008226
1211 Ga0501080_0418026
1212 Ga0501081_0004091
1213 Ga0501081_0004270
1214 Ga0501081_0007577
1215 Ga0501081_0021488
1216 Ga0501081_0163710
1217 Ga0501083_0158952
1218 Ga0501035_0004285
1219 Ga0501045_0000261
1220 Ga0501045_0001915
1221 Ga0501045_0006315
1222 Ga0501045_0036185
1223 Ga0501045_0294485
1224 nmdc:mga05p37_16641_c1
1225 nmdc:mga05p37_21100_c1
1226 nmdc:mga05p37_44136_c1
1227 nmdc:mga05p37_6076_c1
1228 nmdc:mga05p37_7014_c1
1229 nmdc:mga05p37_99490_c1
1230 nmdc:mga09592_14307_c1
1231 nmdc:mga09592_19885_c1
1232 nmdc:mga09592_7469_c1
1233 nmdc:mga0qj67_10436_c1
1234 nmdc:mga0qj67_22_c3
1235 nmdc:mga0qj67_285336_c1
1236 nmdc:mga0qj67_3633_c1
1237 nmdc:mga06r32_19205_c1
1238 nmdc:mga06r32_243591_c1
1239 nmdc:mga06r32_318360_c1
1240 nmdc:mga06r32_5261_c1
1241 nmdc:mga06r32_8071_c1
1242 nmdc:mga06r32_851_c3
1243 nmdc:mga08y16_205630_c1
1244 nmdc:mga08y16_24689_c1
1245 nmdc:mga08y16_26416_c1
1246 nmdc:mga08y16_3603_c1
1247 nmdc:mga08y16_8672_c1
1248 nmdc:mga0n895_208945_c1
1249 nmdc:mga0n895_247470_c1
1250 nmdc:mga0n895_48390_c1
1251 nmdc:mga0n895_7146_c1
1252 nmdc:mga0n895_8215_c1
1253 nmdc:mga0n895_9633_c1
1254 nmdc:mga0rr50_136877_c1
1255 nmdc:mga0rr50_63274_c1
1256 nmdc:mga08x19_15565_c1
1257 nmdc:mga0a205_20169_c1
1258 nmdc:mga0a205_344041_c1
1259 nmdc:mga0a205_3455_c1
1260 nmdc:mga0a205_35297_c1
1261 nmdc:mga0a205_44839_c2
1262 Ga0495595_0000710
1263 Ga0495595_0003702
1264 Ga0495619_0008609
1265 Ga0495619_0013235
1266 Ga0500616_0016573
1267 Ga0501084_0000264
1268 Ga0501084_0005132
1269 Ga0501084_0006958
1270 Ga0501084_0328476
1271 Ga0590071_017698
1272 Ga0590075_001084
1273 Ga0590075_011694
1274 Ga0590077_001619
1275 Ga0501082_0001425
1276 Ga0501082_0041953
1277 Ga0501082_0143218
1278 Ga0501082_0235611
1279 Ga0530510_0000269
1280 Ga0530510_0001940
1281 Ga0530510_0009692
1282 2895431572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

41

416

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wkn-assembly2.cif.gz_G gamma lactamase from delftia acidovorans 0.9415 2 372
2wkn-assembly2.cif.gz_G gamma lactamase from delftia acidovorans 0.9366 2 372
5xjv-assembly1.cif.gz_A two intermediate states of conformation switch in dual specificity phosphatase 13a 0.8756 314 340
2f4l-assembly2.cif.gz_D crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.7229 3 370
3tkk-assembly2.cif.gz_D crystal structure analysis of a recombinant predicted acetamidase/ formamidase from the thermophile thermoanaerobacter tengcongensis 0.7227 2 366
ID Description Score Start End Superfamily
af_Q5AJF2_20_284_2.60.120.580 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.9519 19 260 2.60.120.580
2f4lB01 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.9065 1 263 2.60.120.580
2f4lB01 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.8945 1 263 2.60.120.580
2f4lD03 Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains 0.8828 293 370 3.10.28.20
af_Q5AJF2_20_284_2.60.120.580 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.8678 19 260 2.60.120.580
ID Description Score Start End GO Terms
AF-A0A2N0MF88-F1-model_v4 Acetamidase 0.9937 4 372 GO:0016811
AF-A0A075HQA2-F1-model_v4 Formamidase (Formamide amidohydrolase) (EC 3.5.1.49) 0.993 78 372 GO:0004328
AF-A0A535WPW1-F1-model_v4 Acetamidase/formamidase family protein 0.9917 41 370 GO:0016811
AF-A0A5N9FRC3-F1-model_v4 Acetamidase/formamidase family protein 0.991 107 372 GO:0016811
AF-A0A5N9G9Z9-F1-model_v4 Acetamidase/formamidase family protein 0.9894 4 372 GO:0016811

Map