F471646

General Info

Members Datasets Scaffolds Average Seq Length
639 280 1278 171

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_866322_c1|nmdc:mga09592_866322_c1_122_724
Length 200
Sequence LLNSECCIGGAADQSAFSNQHSEISASNMDVLAFYAFAGIAVIASLLVIGQGNPMHSVMLLIVSFGALAGLYVVLDAPFTAVTQIIVYAGAIMVLFLFVVMLLNVPREEPAPGGAATLLGSTGMRIGAVLSLLLAGELLWALLRIGFGWASRAETAASVSSVALIGSGIFTRHAFAFEATSVLILVAMIGAVVLARREHS

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
165 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
170 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
212 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
213 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
240 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
241 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
242 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
243 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
244 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
245 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
251 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
252 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0
Rhizoplane 3.44
Rhizosphere 90.61
Stem 0
Stem Tuber 0
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_866322_c1 3300050508 Bacteria 761
2 JGI24745J21846_1016045 3300002073 Bacteria 868
3 JGI24035J26624_1009355 3300002126 Bacteria 965
4 JGI25406J46586_10000551 3300003203 Bacteria 17619
5 JGI25406J46586_10001262 3300003203 Bacteria 11872
6 JGI25406J46586_10120242 3300003203 Bacteria 773
7 Ga0065714_10072204 3300005288 Bacteria 3412
8 Ga0065704_10005852 3300005289 Bacteria 3146
9 Ga0065712_10009881 3300005290 Bacteria 2256
10 Ga0065712_10018740 3300005290 Bacteria 2386
11 Ga0065712_10084760 3300005290 Bacteria 2743
12 Ga0065712_10087888 3300005290 Bacteria 2549
13 Ga0065712_10310482 3300005290 Bacteria 840
14 Ga0065712_10406397 3300005290 Bacteria 726
15 Ga0065715_10009247 3300005293 Bacteria 4293
16 Ga0065715_10009346 3300005293 Bacteria 2344
17 Ga0065715_10105744 3300005293 Bacteria 2874
18 Ga0065715_10462750 3300005293 Bacteria 814
19 Ga0065707_10103611 3300005295 Bacteria 2739
20 Ga0065707_10167221 3300005295 Bacteria 1513
21 Ga0065707_10318638 3300005295 Bacteria 970
22 Ga0070683_100000094 3300005329 Bacteria 58242
23 Ga0070683_100103115 3300005329 Bacteria 2688
24 Ga0070670_100029410 3300005331 Bacteria 4730
25 Ga0070670_100047811 3300005331 Bacteria 3682
26 Ga0070670_100186698 3300005331 Bacteria 1800
27 Ga0070670_100674048 3300005331 Bacteria 929
28 Ga0070677_10128962 3300005333 Bacteria 1152
29 Ga0070677_10320386 3300005333 Bacteria 794
30 Ga0068869_100239485 3300005334 Bacteria 1445
31 Ga0070666_10528333 3300005335 Bacteria 857
32 Ga0070680_100259809 3300005336 Bacteria 1469
33 Ga0070680_100336784 3300005336 Bacteria 1282
34 Ga0070682_100213800 3300005337 Bacteria 1368
35 Ga0068868_100049345 3300005338 Bacteria 3303
36 Ga0070660_100265946 3300005339 Bacteria 1401
37 Ga0070687_100060313 3300005343 Bacteria 2001
38 Ga0070661_100016313 3300005344 Bacteria 5251
39 Ga0070661_100169844 3300005344 Bacteria 1656
40 Ga0070661_100697914 3300005344 Bacteria 827
41 Ga0070661_100934584 3300005344 Bacteria 717
42 Ga0070668_100367769 3300005347 Bacteria 1221
43 Ga0070668_101386338 3300005347 Bacteria 641
44 Ga0070669_100005170 3300005353 Bacteria 9439
45 Ga0070669_100040998 3300005353 Bacteria 3366
46 Ga0070669_100351989 3300005353 Bacteria 1196
47 Ga0070669_101048725 3300005353 Bacteria 701
48 Ga0070675_100041683 3300005354 Bacteria 3750
49 Ga0070675_100235798 3300005354 Bacteria 1597
50 Ga0070675_100386547 3300005354 Bacteria 1246
51 Ga0070675_100397586 3300005354 Bacteria 1229
52 Ga0070675_100398057 3300005354 Bacteria 1228
53 Ga0070671_100050359 3300005355 Bacteria 3464
54 Ga0070671_100437696 3300005355 Bacteria 1121
55 Ga0070674_100356010 3300005356 Bacteria 1184
56 Ga0070673_100581237 3300005364 Bacteria 1020
57 Ga0070688_100050003 3300005365 Bacteria 2603
58 Ga0070688_100868461 3300005365 Bacteria 710
59 Ga0070688_101017771 3300005365 Bacteria 659
60 Ga0070659_100639026 3300005366 Bacteria 917
61 Ga0070667_100939165 3300005367 Bacteria 806
62 Ga0070667_100943757 3300005367 Bacteria 804
63 Ga0070713_100018924 3300005436 Bacteria 5244
64 Ga0070700_100020842 3300005441 Bacteria 3804
65 Ga0070700_100038200 3300005441 Bacteria 2925
66 Ga0070694_100608024 3300005444 Bacteria 881
67 Ga0070694_100738971 3300005444 Bacteria 803
68 Ga0070663_100098572 3300005455 Bacteria 2178
69 Ga0070663_100590807 3300005455 Bacteria 933
70 Ga0070678_100132984 3300005456 Bacteria 1979
71 Ga0070678_100363343 3300005456 Bacteria 1248
72 Ga0070678_100685909 3300005456 Bacteria 922
73 Ga0070681_10259734 3300005458 Bacteria 1649
74 Ga0070698_100034849 3300005471 Bacteria 5207
75 Ga0070699_100001266 3300005518 Bacteria 23295
76 Ga0070699_100972890 3300005518 Bacteria 778
77 Ga0070684_100000166 3300005535 Bacteria 45212
78 Ga0070684_100506079 3300005535 Bacteria 1119
79 Ga0070672_100197870 3300005543 Bacteria 1680
80 Ga0070672_100304866 3300005543 Bacteria 1351
81 Ga0070672_100382132 3300005543 Bacteria 1205
82 Ga0070672_100557131 3300005543 Bacteria 996
83 Ga0070672_100693113 3300005543 Bacteria 892
84 Ga0070686_100386376 3300005544 Bacteria 1061
85 Ga0070695_100072900 3300005545 Bacteria 2252
86 Ga0070695_100828934 3300005545 Bacteria 743
87 Ga0070696_100215415 3300005546 Bacteria 1439
88 Ga0070696_100540765 3300005546 Bacteria 932
89 Ga0070693_100026270 3300005547 Bacteria 3142
90 Ga0070665_101281379 3300005548 Bacteria 743
91 Ga0070704_100030216 3300005549 Bacteria 3628
92 Ga0070664_100009365 3300005564 Bacteria 7941
93 Ga0070664_100128339 3300005564 Bacteria 2226
94 Ga0070664_100415934 3300005564 Bacteria 1231
95 Ga0070664_100716256 3300005564 Bacteria 933
96 Ga0068856_100265569 3300005614 Bacteria 1732
97 Ga0070702_100005168 3300005615 Bacteria 6043
98 Ga0068859_100784460 3300005617 Bacteria 1041
99 Ga0068864_101170761 3300005618 Bacteria 767
100 Ga0068861_100019101 3300005719 Bacteria 4894
101 Ga0068861_100170030 3300005719 Bacteria 1806
102 Ga0068861_100599356 3300005719 Bacteria 1011
103 Ga0068861_101830081 3300005719 Bacteria 603
104 Ga0068851_10270367 3300005834 Bacteria 969
105 Ga0068863_100865763 3300005841 Bacteria 903
106 Ga0068863_101485358 3300005841 Bacteria 686
107 Ga0068862_100035412 3300005844 Bacteria 4228
108 Ga0068862_100200782 3300005844 Bacteria 1798
109 Ga0068862_100331869 3300005844 Bacteria 1406
110 Ga0068862_100557333 3300005844 Bacteria 1095
111 Ga0081539_10000074 3300005985 Bacteria 231435
112 Ga0081539_10001558 3300005985 Bacteria 38098
113 Ga0081539_10001853 3300005985 Bacteria 33320
114 Ga0081539_10040561 3300005985 Bacteria 2731
115 Ga0081539_10179139 3300005985 Bacteria 996
116 Ga0070717_10415409 3300006028 Bacteria 1210
117 Ga0075368_10052983 3300006042 Bacteria 1614
118 Ga0075363_100323192 3300006048 Bacteria 898
119 Ga0075364_10001357 3300006051 Bacteria 13208
120 Ga0075364_10180189 3300006051 Bacteria 1429
121 Ga0075364_10272761 3300006051 Bacteria 1151
122 Ga0075362_10000746 3300006177 Bacteria 9684
123 Ga0075362_10130114 3300006177 Bacteria 1196
124 Ga0075367_10030679 3300006178 Bacteria 3084
125 Ga0075367_10076777 3300006178 Bacteria 2016
126 Ga0075367_10100255 3300006178 Bacteria 1769
127 Ga0075367_10173273 3300006178 Bacteria 1344
128 Ga0075366_10122669 3300006195 Bacteria 1566
129 Ga0075366_10159559 3300006195 Bacteria 1366
130 Ga0097621_100146702 3300006237 Bacteria 2021
131 Ga0097621_100435440 3300006237 Bacteria 1179
132 Ga0097621_100894088 3300006237 Bacteria 827
133 Ga0075370_10100482 3300006353 Bacteria 1674
134 Ga0075370_10215271 3300006353 Bacteria 1135
135 Ga0075428_100000017 3300006844 Bacteria 147833
136 Ga0075428_100000295 3300006844 Bacteria 48665
137 Ga0075428_100069014 3300006844 Bacteria 3867
138 Ga0075428_100073237 3300006844 Bacteria 3741
139 Ga0075430_100003248 3300006846 Bacteria 13620
140 Ga0075430_100017811 3300006846 Bacteria 6047
141 Ga0075430_100020871 3300006846 Bacteria 5569
142 Ga0075430_100033466 3300006846 Bacteria 4362
143 Ga0075430_100315830 3300006846 Bacteria 1292
144 Ga0075430_100822014 3300006846 Bacteria 766
145 Ga0075430_101013247 3300006846 Bacteria 684
146 Ga0075431_100004098 3300006847 Bacteria 14230
147 Ga0075431_100047382 3300006847 Bacteria 4431
148 Ga0075431_100120157 3300006847 Bacteria 2711
149 Ga0075431_100139379 3300006847 Bacteria 2500
150 Ga0075431_100238020 3300006847 Bacteria 1853
151 Ga0075431_100781717 3300006847 Bacteria 929
152 Ga0075433_10090367 3300006852 Bacteria 2707
153 Ga0075433_10125663 3300006852 Bacteria 2278
154 Ga0075433_10149209 3300006852 Bacteria 2079
155 Ga0075433_10260473 3300006852 Bacteria 1537
156 Ga0075433_10553867 3300006852 Bacteria 1011
157 Ga0075434_100504270 3300006871 Bacteria 1231
158 Ga0075434_101262632 3300006871 Bacteria 750
159 Ga0075434_101469276 3300006871 Bacteria 691
160 Ga0075429_100043580 3300006880 Bacteria 3905
161 Ga0075429_100399298 3300006880 Bacteria 1204
162 Ga0075429_100517201 3300006880 Bacteria 1046
163 Ga0075429_100810836 3300006880 Bacteria 820
164 Ga0068865_100695936 3300006881 Bacteria 868
165 Ga0097620_100784377 3300006931 Bacteria 1041
166 Ga0075435_100902238 3300007076 Bacteria 771
167 Ga0105240_10103506 3300009093 Bacteria 3459
168 Ga0105240_10151938 3300009093 Bacteria 2757
169 Ga0111539_10000002 3300009094 Bacteria 983359
170 Ga0111539_10000037 3300009094 Bacteria 143023
171 Ga0111539_10008348 3300009094 Bacteria 13180
172 Ga0111539_10024995 3300009094 Bacteria 7320
173 Ga0111539_10132671 3300009094 Bacteria 2917
174 Ga0111539_10366981 3300009094 Bacteria 1676
175 Ga0111539_10568136 3300009094 Bacteria 1321
176 Ga0111539_10724381 3300009094 Bacteria 1158
177 Ga0111539_11339402 3300009094 Bacteria 831
178 Ga0111539_11574096 3300009094 Bacteria 762
179 Ga0105247_11185299 3300009101 Bacteria 607
180 Ga0114129_10004316 3300009147 Bacteria 20102
181 Ga0114129_10008636 3300009147 Bacteria 14525
182 Ga0114129_10009195 3300009147 Bacteria 14088
183 Ga0114129_10015583 3300009147 Bacteria 10808
184 Ga0114129_10055131 3300009147 Bacteria 5572
185 Ga0114129_11368661 3300009147 Bacteria 874
186 Ga0105243_11554325 3300009148 Bacteria 687
187 Ga0105241_10036009 3300009174 Bacteria 3724
188 Ga0105242_10862317 3300009176 Bacteria 902
189 Ga0105242_12162645 3300009176 Bacteria 601
190 Ga0105248_10221608 3300009177 Bacteria 2129
191 Ga0105248_10222454 3300009177 Bacteria 2125
192 Ga0105248_10777388 3300009177 Bacteria 1081
193 Ga0105248_13044020 3300009177 Bacteria 534
194 Ga0105237_10148692 3300009545 Bacteria 2338
195 Ga0105238_10298326 3300009551 Bacteria 1595
196 Ga0105249_10116358 3300009553 Bacteria 2534
197 Ga0105249_10339804 3300009553 Bacteria 1518
198 Ga0105249_10656757 3300009553 Bacteria 1106
199 Ga0105239_10340380 3300010375 Bacteria 1693
200 Ga0105246_10531502 3300011119 Bacteria 1004
201 Ga0157378_10479074 3300013297 Bacteria 1240
202 Ga0163162_10008950 3300013306 Bacteria 9733
203 Ga0163162_10256904 3300013306 Bacteria 1879
204 Ga0163162_10841242 3300013306 Bacteria 1033
205 Ga0157375_10439164 3300013308 Bacteria 1471
206 Ga0157375_10780624 3300013308 Bacteria 1105
207 Ga0157375_12076562 3300013308 Bacteria 676
208 Ga0163163_10003825 3300014325 Bacteria 12818
209 Ga0163163_10030417 3300014325 Bacteria 5204
210 Ga0163163_10304756 3300014325 Bacteria 1645
211 Ga0157380_10108216 3300014326 Bacteria 2330
212 Ga0157380_10396133 3300014326 Bacteria 1308
213 Ga0157380_10545858 3300014326 Bacteria 1136
214 Ga0157380_10984312 3300014326 Bacteria 876
215 Ga0157380_11152707 3300014326 Bacteria 817
216 Ga0157380_11297186 3300014326 Unclassified 775
217 Ga0157380_11587689 3300014326 Bacteria 709
218 Ga0157377_10041220 3300014745 Bacteria 2561
219 Ga0157379_11452105 3300014968 Bacteria 666
220 Ga0157376_10357727 3300014969 Bacteria 1399
221 Ga0157376_10382089 3300014969 Bacteria 1357
222 Ga0157376_10904952 3300014969 Bacteria 901
223 Ga0207666_1040252 3300025271 Bacteria 730
224 Ga0207697_10000717 3300025315 Bacteria 18881
225 Ga0207682_10082501 3300025893 Bacteria 1380
226 Ga0207688_10001322 3300025901 Bacteria 12879
227 Ga0207680_10093459 3300025903 Bacteria 1918
228 Ga0207680_10192550 3300025903 Bacteria 1385
229 Ga0207680_10330409 3300025903 Bacteria 1068
230 Ga0207643_10106690 3300025908 Bacteria 1646
231 Ga0207643_10664206 3300025908 Bacteria 673
232 Ga0207705_10779332 3300025909 Bacteria 742
233 Ga0207707_10125793 3300025912 Bacteria 2242
234 Ga0207671_10082575 3300025914 Bacteria 2411
235 Ga0207657_10649472 3300025919 Bacteria 821
236 Ga0207649_10021247 3300025920 Bacteria 3733
237 Ga0207649_10862147 3300025920 Bacteria 709
238 Ga0207681_10003863 3300025923 Bacteria 9307
239 Ga0207681_11352844 3300025923 Bacteria 598
240 Ga0207650_10016257 3300025925 Bacteria 5198
241 Ga0207650_10077153 3300025925 Bacteria 2518
242 Ga0207650_10260187 3300025925 Bacteria 1407
243 Ga0207659_10028324 3300025926 Bacteria 3806
244 Ga0207659_10055057 3300025926 Bacteria 2843
245 Ga0207659_10095935 3300025926 Bacteria 2225
246 Ga0207659_10200018 3300025926 Bacteria 1595
247 Ga0207659_10261151 3300025926 Bacteria 1409
248 Ga0207659_10622685 3300025926 Bacteria 921
249 Ga0207644_10052792 3300025931 Bacteria 2923
250 Ga0207644_10455445 3300025931 Bacteria 1051
251 Ga0207690_10077857 3300025932 Bacteria 2306
252 Ga0207706_10345068 3300025933 Bacteria 1295
253 Ga0207709_11071088 3300025935 Bacteria 661
254 Ga0207669_10041536 3300025937 Bacteria 2678
255 Ga0207669_10076108 3300025937 Bacteria 2129
256 Ga0207669_10079190 3300025937 Bacteria 2097
257 Ga0207669_10112204 3300025937 Bacteria 1830
258 Ga0207669_10121789 3300025937 Bacteria 1773
259 Ga0207669_10763035 3300025937 Bacteria 800
260 Ga0207691_10149718 3300025940 Bacteria 2052
261 Ga0207691_10211982 3300025940 Bacteria 1682
262 Ga0207691_10523878 3300025940 Bacteria 1006
263 Ga0207691_10547518 3300025940 Bacteria 981
264 Ga0207711_10120457 3300025941 Bacteria 2342
265 Ga0207711_10907801 3300025941 Bacteria 819
266 Ga0207661_10020111 3300025944 Bacteria 4985
267 Ga0207661_10108572 3300025944 Bacteria 2343
268 Ga0207679_10005801 3300025945 Bacteria 7751
269 Ga0207679_10641560 3300025945 Bacteria 960
270 Ga0207651_10187694 3300025960 Bacteria 1646
271 Ga0207651_11392180 3300025960 Bacteria 631
272 Ga0207712_10004344 3300025961 Bacteria 8955
273 Ga0207712_10372625 3300025961 Bacteria 1193
274 Ga0207712_10669844 3300025961 Bacteria 903
275 Ga0207668_10270489 3300025972 Bacteria 1389
276 Ga0207668_11098358 3300025972 Bacteria 713
277 Ga0207640_10267345 3300025981 Bacteria 1336
278 Ga0207640_10837246 3300025981 Bacteria 799
279 Ga0207640_11707054 3300025981 Bacteria 568
280 Ga0207658_10857419 3300025986 Bacteria 826
281 Ga0207658_10978303 3300025986 Bacteria 772
282 Ga0207678_10132479 3300026067 Bacteria 2127
283 Ga0207708_10067174 3300026075 Bacteria 2742
284 Ga0207708_10070516 3300026075 Bacteria 2676
285 Ga0207708_10744203 3300026075 Bacteria 841
286 Ga0207702_10135324 3300026078 Bacteria 2223
287 Ga0207641_10291226 3300026088 Bacteria 1539
288 Ga0207641_10812847 3300026088 Bacteria 925
289 Ga0207641_11385543 3300026088 Bacteria 704
290 Ga0207676_10140197 3300026095 Bacteria 2069
291 Ga0207676_10159926 3300026095 Bacteria 1950
292 Ga0207674_10603316 3300026116 Bacteria 1060
293 Ga0207674_10975228 3300026116 Bacteria 816
294 Ga0207675_100011213 3300026118 Bacteria 8393
295 Ga0207675_100339487 3300026118 Bacteria 1470
296 Ga0207675_101233964 3300026118 Bacteria 768
297 Ga0207683_10055481 3300026121 Bacteria 3474
298 Ga0207683_10118218 3300026121 Bacteria 2378
299 Ga0207683_10413841 3300026121 Bacteria 1241
300 Ga0207683_10731172 3300026121 Bacteria 918
301 Ga0209968_1018725 3300027526 Bacteria 1111
302 Ga0209998_10046096 3300027717 Bacteria 1000
303 Ga0209813_10107085 3300027866 Bacteria 958
304 Ga0209974_10176669 3300027876 Bacteria 780
305 Ga0207428_10000004 3300027907 Bacteria 727800
306 Ga0207428_10001068 3300027907 Bacteria 30064
307 Ga0207428_10012687 3300027907 Bacteria 7389
308 Ga0207428_10243210 3300027907 Bacteria 1344
309 Ga0207428_10535986 3300027907 Bacteria 848
310 Ga0268265_10018118 3300028380 Bacteria 4875
311 Ga0268265_10159237 3300028380 Bacteria 1915
312 Ga0268265_10355028 3300028380 Bacteria 1340
313 Ga0268265_10378813 3300028380 Bacteria 1301
314 Ga0268265_10545157 3300028380 Bacteria 1100
315 Ga0268265_11780363 3300028380 Bacteria 622
316 Ga0268264_10129238 3300028381 Bacteria 2237
317 Ga0268264_11064473 3300028381 Bacteria 817
318 Ga0307408_100030568 3300031548 Bacteria 3741
319 Ga0307408_100201185 3300031548 Bacteria 1612
320 Ga0307408_100396225 3300031548 Bacteria 1184
321 Ga0307408_101103814 3300031548 Bacteria 736
322 Ga0307408_101617492 3300031548 Bacteria 615
323 Ga0307405_10030293 3300031731 Bacteria 3172
324 Ga0307405_10973968 3300031731 Bacteria 722
325 Ga0307413_10081301 3300031824 Bacteria 2077
326 Ga0307413_10690389 3300031824 Bacteria 847
327 Ga0307413_10794136 3300031824 Bacteria 795
328 Ga0307410_10031322 3300031852 Bacteria 3412
329 Ga0307410_10187188 3300031852 Bacteria 1572
330 Ga0307410_10357881 3300031852 Bacteria 1168
331 Ga0307406_10078753 3300031901 Bacteria 2184
332 Ga0307406_10534429 3300031901 Bacteria 956
333 Ga0307407_10013207 3300031903 Bacteria 3999
334 Ga0307407_10473829 3300031903 Bacteria 913
335 Ga0307407_10488159 3300031903 Bacteria 901
336 Ga0307407_10559304 3300031903 Bacteria 847
337 Ga0307412_10004341 3300031911 Bacteria 7907
338 Ga0307412_10057260 3300031911 Bacteria 2601
339 Ga0307409_100016611 3300031995 Bacteria 4876
340 Ga0307409_100198041 3300031995 Bacteria 1794
341 Ga0307409_100440710 3300031995 Bacteria 1255
342 Ga0307416_100019683 3300032002 Bacteria 4793
343 Ga0307416_100032671 3300032002 Bacteria 3936
344 Ga0307416_100077431 3300032002 Bacteria 2793
345 Ga0307416_100107948 3300032002 Bacteria 2444
346 Ga0307416_100108892 3300032002 Bacteria 2435
347 Ga0307416_100111565 3300032002 Bacteria 2411
348 Ga0307416_100131191 3300032002 Bacteria 2256
349 Ga0307416_100294305 3300032002 Bacteria 1609
350 Ga0307416_100939416 3300032002 Bacteria 966
351 Ga0307416_101195397 3300032002 Bacteria 866
352 Ga0307414_10065988 3300032004 Bacteria 2585
353 Ga0307414_10499577 3300032004 Bacteria 1076
354 Ga0307411_10022399 3300032005 Bacteria 3719
355 Ga0307411_10074438 3300032005 Bacteria 2314
356 Ga0307411_10249991 3300032005 Bacteria 1393
357 Ga0307411_10336041 3300032005 Bacteria 1226
358 Ga0307411_10573462 3300032005 Bacteria 966
359 Ga0307411_10584277 3300032005 Bacteria 958
360 Ga0307411_10670192 3300032005 Bacteria 900
361 Ga0307415_100067318 3300032126 Bacteria 2502
362 Ga0307415_100233055 3300032126 Bacteria 1484
363 Ga0307415_100416548 3300032126 Bacteria 1151
364 Ga0307415_100679630 3300032126 Bacteria 926
365 Ga0373929_0082191 3300035085 Bacteria 787
366 Ga0373945_0079918 3300035116 Bacteria 1251
367 Ga0373946_0159597 3300035171 Bacteria 1058
368 Ga0373931_0909359 3300035691 Bacteria 592
369 Ga0373935_0188915 3300035692 Bacteria 1418
370 Ga0373935_0251565 3300035692 Bacteria 1237
371 Ga0373933_0172169 3300035724 Bacteria 1378
372 Ga0373933_0517343 3300035724 Bacteria 782
373 Ga0373937_0025518 3300036401 Bacteria 5335
374 Ga0373925_1050376 3300037068 Bacteria 670
375 Ga0451800_1266025 3300041459 Bacteria 908
376 Ga0451807_1318327 3300041486 Bacteria 769
377 Ga0451841_0375391 3300041498 Bacteria 691
378 Ga0451843_0700692 3300041509 Bacteria 694
379 Ga0451853_1554116 3300041512 Bacteria 1049
380 Ga0439431_0045483 3300041997 Bacteria 1127
381 Ga0439433_0040321 3300041999 Bacteria 1086
382 Ga0439433_0114530 3300041999 Bacteria 676
383 Ga0439437_017052 3300042000 Bacteria 861
384 Ga0439445_0022985 3300042004 Bacteria 1576
385 Ga0439450_010750 3300042008 Bacteria 1773
386 Ga0439462_0058283 3300042015 Bacteria 1044
387 Ga0450920_039900 3300042122 Bacteria 935
388 Ga0450896_026488 3300042133 Bacteria 865
389 Ga0439446_0017402 3300042156 Bacteria 2009
390 Ga0439446_0018579 3300042156 Bacteria 1949
391 Ga0439446_0072768 3300042156 Bacteria 1054
392 Ga0439435_0012867 3300042436 Bacteria 2037
393 Ga0439435_0044165 3300042436 Bacteria 1256
394 Ga0439435_0138662 3300042436 Bacteria 773
395 Ga0439444_0067247 3300042437 Bacteria 760
396 Ga0439444_0074934 3300042437 Bacteria 731
397 Ga0439464_0039402 3300042439 Bacteria 1343
398 Ga0439464_0090786 3300042439 Bacteria 921
399 Ga0439460_0026127 3300042461 Bacteria 1631
400 Ga0439460_0033799 3300042461 Bacteria 1471
401 Ga0439460_0080817 3300042461 Bacteria 1020
402 Ga0451577_0125270 3300042876 Bacteria 2302
403 Ga0439440_0046765 3300042993 Bacteria 1070
404 Ga0453684_0335310 3300044712 Bacteria 1709
405 Ga0451576_0043533 3300045051 Bacteria 4736
406 Ga0451576_0094215 3300045051 Bacteria 3114
407 Ga0495592_0135150 3300046454 Bacteria 1721
408 Ga0495638_0008491 3300046460 Bacteria 7279
409 Ga0495582_0281907 3300046473 Bacteria 954
410 Ga0495639_0574761 3300046475 Bacteria 578
411 Ga0495608_0197436 3300046511 Bacteria 1269
412 Ga0495587_0475331 3300046536 Bacteria 692
413 Ga0495598_0040628 3300046537 Bacteria 1357
414 Ga0495656_0039211 3300046615 Bacteria 1967
415 Ga0495635_0049123 3300046663 Bacteria 2908
416 Ga0495659_0021490 3300046664 Bacteria 2175
417 Ga0495659_0307617 3300046664 Bacteria 671
418 Ga0495647_0152101 3300046681 Bacteria 993
419 Ga0495658_0061320 3300046683 Bacteria 2159
420 Ga0495600_0117828 3300046809 Bacteria 1728
421 Ga0495636_0120564 3300047318 Bacteria 1160
422 Ga0495674_0107881 3300047319 Bacteria 2363
423 Ga0495674_0249426 3300047319 Bacteria 1461
424 Ga0495674_1065018 3300047319 Bacteria 617
425 Ga0495672_0120022 3300047320 Bacteria 1399
426 Ga0495684_0261197 3300047471 Bacteria 1256
427 Ga0495684_0273969 3300047471 Bacteria 1220
428 Ga0496101_0601485 3300048904 Bacteria 869
429 Ga0496102_0028152 3300048905 Bacteria 5020
430 Ga0496102_0339962 3300048905 Bacteria 1414
431 Ga0496103_0529891 3300048906 Bacteria 753
432 Ga0496104_0265287 3300048907 Bacteria 1630
433 Ga0496104_0282814 3300048907 Bacteria 1572
434 Ga0496105_0339869 3300048908 Bacteria 1201
435 Ga0496106_0631757 3300048909 Bacteria 856
436 Ga0496108_0050479 3300048911 Bacteria 3482
437 Ga0496109_0018373 3300048912 Bacteria 6143
438 Ga0496109_1558771 3300048912 Bacteria 595
439 Ga0496110_0011815 3300048913 Bacteria 7168
440 Ga0496111_0012097 3300048914 Bacteria 5836
441 Ga0496111_0088437 3300048914 Bacteria 2269
442 Ga0496112_0003634 3300048915 Bacteria 12846
443 Ga0496113_0212734 3300048916 Bacteria 1539
444 Ga0496114_0100789 3300048917 Bacteria 2465
445 Ga0496114_0438191 3300048917 Bacteria 1157
446 Ga0496114_0710662 3300048917 Bacteria 881
447 Ga0496115_0520649 3300048918 Bacteria 954
448 Ga0501292_001564 3300049515 Bacteria 2833
449 Ga0501299_022960 3300049522 Bacteria 1154
450 Ga0501299_097809 3300049522 Bacteria 677
451 Ga0501300_032088 3300049523 Bacteria 777
452 Ga0501031_0028667 3300049568 Bacteria 3630
453 Ga0501031_0077005 3300049568 Bacteria 2172
454 Ga0501031_0100742 3300049568 Bacteria 1885
455 Ga0501031_0202990 3300049568 Bacteria 1293
456 Ga0501032_0316046 3300049569 Bacteria 1008
457 Ga0501033_0137386 3300049570 Bacteria 1768
458 Ga0501033_0532023 3300049570 Bacteria 811
459 Ga0501034_0020238 3300049571 Bacteria 6795
460 Ga0501034_0106719 3300049571 Bacteria 2793
461 Ga0501034_0115821 3300049571 Bacteria 2668
462 Ga0501034_0861575 3300049571 Bacteria 795
463 Ga0501036_0018205 3300049572 Bacteria 5882
464 Ga0501036_0323016 3300049572 Bacteria 1289
465 Ga0501036_1097418 3300049572 Bacteria 650
466 Ga0501036_1696559 3300049572 Bacteria 509
467 Ga0501037_0104826 3300049573 Bacteria 2038
468 Ga0501037_0291201 3300049573 Bacteria 1136
469 Ga0501038_0173861 3300049574 Bacteria 1741
470 Ga0501038_0361112 3300049574 Bacteria 1129
471 Ga0501038_0433622 3300049574 Bacteria 1012
472 Ga0501039_0006784 3300049575 Bacteria 8707
473 Ga0501039_0146214 3300049575 Bacteria 1857
474 Ga0501039_0293359 3300049575 Bacteria 1278
475 Ga0501040_0067255 3300049576 Bacteria 2469
476 Ga0501040_0238818 3300049576 Bacteria 1295
477 Ga0501040_0568752 3300049576 Bacteria 818
478 Ga0501040_0698474 3300049576 Bacteria 734
479 Ga0501040_0960159 3300049576 Bacteria 619
480 Ga0501041_0012600 3300049577 Bacteria 5009
481 Ga0501041_0449975 3300049577 Bacteria 818
482 Ga0501042_0175687 3300049578 Bacteria 1545
483 Ga0501042_0198924 3300049578 Bacteria 1445
484 Ga0501043_0001515 3300049579 Bacteria 20276
485 Ga0501046_0056943 3300049580 Bacteria 3067
486 Ga0501047_0000655 3300049581 Bacteria 36211
487 Ga0501047_0020226 3300049581 Bacteria 6392
488 Ga0501047_0997622 3300049581 Bacteria 650
489 Ga0501048_0322227 3300049582 Bacteria 1101
490 Ga0501048_0395491 3300049582 Bacteria 987
491 Ga0501067_0086419 3300049583 Bacteria 1740
492 Ga0501067_0102782 3300049583 Bacteria 1588
493 Ga0501067_0104188 3300049583 Bacteria 1576
494 Ga0501068_0023032 3300049584 Bacteria 3649
495 Ga0501068_0144844 3300049584 Bacteria 1491
496 Ga0501068_0374429 3300049584 Bacteria 916
497 Ga0501068_0582052 3300049584 Bacteria 729
498 Ga0501070_0289836 3300049586 Bacteria 1334
499 Ga0501071_0040967 3300049587 Bacteria 3316
500 Ga0501071_0198355 3300049587 Bacteria 1507
501 Ga0501071_0386114 3300049587 Bacteria 1068
502 Ga0501072_0096244 3300049588 Bacteria 2353
503 Ga0501072_0121998 3300049588 Bacteria 2076
504 Ga0501072_0188081 3300049588 Bacteria 1647
505 Ga0501072_0205294 3300049588 Bacteria 1571
506 Ga0501072_0235429 3300049588 Bacteria 1458
507 Ga0501072_0620448 3300049588 Bacteria 852
508 Ga0501073_0069110 3300049589 Bacteria 2461
509 Ga0501073_0179319 3300049589 Bacteria 1466
510 Ga0501073_0745195 3300049589 Bacteria 675
511 Ga0501073_0909887 3300049589 Bacteria 606
512 Ga0501074_0057226 3300049590 Bacteria 2809
513 Ga0501074_0226228 3300049590 Bacteria 1332
514 Ga0501074_0836872 3300049590 Bacteria 648
515 Ga0501075_0016140 3300049591 Bacteria 5375
516 Ga0501075_0025261 3300049591 Bacteria 4365
517 Ga0501075_0137163 3300049591 Bacteria 1864
518 Ga0501075_0304239 3300049591 Bacteria 1215
519 Ga0501075_0655270 3300049591 Bacteria 800
520 Ga0501075_1304262 3300049591 Bacteria 550
521 Ga0501076_0002349 3300049592 Bacteria 12942
522 Ga0501076_0017306 3300049592 Bacteria 5476
523 Ga0501076_0052814 3300049592 Bacteria 3220
524 Ga0501076_0325057 3300049592 Bacteria 1262
525 Ga0501076_0718808 3300049592 Bacteria 824
526 Ga0501076_1054189 3300049592 Bacteria 670
527 Ga0501077_0033000 3300049593 Bacteria 3296
528 Ga0501077_0163910 3300049593 Bacteria 1412
529 Ga0501077_0241339 3300049593 Bacteria 1149
530 Ga0501077_0657962 3300049593 Bacteria 673
531 Ga0501208_130984 3300049655 Bacteria 560
532 Ga0501211_004634 3300049658 Bacteria 1394
533 Ga0501217_080814 3300049661 Bacteria 899
534 Ga0501233_080764 3300049668 Bacteria 837
535 Ga0501246_006699 3300049676 Bacteria 992
536 Ga0501261_008614 3300049690 Bacteria 1320
537 Ga0501225_0205906 3300049705 Bacteria 627
538 Ga0501079_0121992 3300049741 Bacteria 2027
539 Ga0501079_0862700 3300049741 Bacteria 713
540 Ga0501080_0004681 3300049742 Bacteria 12201
541 Ga0501080_0046088 3300049742 Bacteria 4061
542 Ga0501080_0059920 3300049742 Bacteria 3542
543 Ga0501080_0711364 3300049742 Bacteria 885
544 Ga0501081_0047734 3300049743 Bacteria 2946
545 Ga0501081_0160062 3300049743 Bacteria 1622
546 Ga0501083_0011535 3300049744 Bacteria 6198
547 Ga0501083_0035680 3300049744 Bacteria 3396
548 Ga0501083_0044372 3300049744 Bacteria 3009
549 Ga0501083_0621858 3300049744 Bacteria 702
550 Ga0501266_053971 3300049763 Bacteria 627
551 Ga0501270_017764 3300049767 Bacteria 1045
552 Ga0501283_037067 3300049779 Bacteria 834
553 Ga0501035_0087739 3300049822 Bacteria 2741
554 Ga0501035_0621703 3300049822 Bacteria 878
555 Ga0501035_0799212 3300049822 Bacteria 754
556 Ga0501044_0399364 3300049823 Bacteria 1287
557 Ga0501044_0790490 3300049823 Bacteria 829
558 Ga0501045_0003977 3300049824 Bacteria 10174
559 Ga0501045_0203817 3300049824 Bacteria 1474
560 Ga0501045_0252051 3300049824 Bacteria 1314
561 nmdc:mga03683_130170_c1 3300050489 Bacteria 1125
562 nmdc:mga03683_18662_c1 3300050489 Bacteria 2639
563 nmdc:mga00v17_209911_c1 3300050491 Bacteria 1260
564 nmdc:mga00v17_258565_c1 3300050491 Bacteria 1129
565 nmdc:mga00v17_3790_c1 3300050491 Bacteria 5428
566 nmdc:mga0yw44_314216_c1 3300050492 Bacteria 1051
567 nmdc:mga0k408_369372_c1 3300050493 Bacteria 855
568 nmdc:mga0k408_8033_c1 3300050493 Bacteria 5656
569 nmdc:mga0k408_8489_c1 3300050493 Bacteria 5517
570 nmdc:mga06z11_167416_c1 3300050494 Bacteria 1260
571 nmdc:mga06z11_50336_c1 3300050494 Bacteria 2129
572 nmdc:mga06z11_60949_c1 3300050494 Bacteria 1966
573 nmdc:mga04h51_15505_c1 3300050495 Bacteria 2196
574 nmdc:mga04h51_18673_c1 3300050495 Bacteria 1702
575 nmdc:mga05p37_1981_c1 3300050507 Bacteria 23880
576 nmdc:mga05p37_2447_c1 3300050507 Bacteria 21583
577 nmdc:mga05p37_36837_c2 3300050507 Bacteria 5679
578 nmdc:mga05p37_59395_c1 3300050507 Bacteria 4709
579 nmdc:mga05p37_8178_c1 3300050507 Bacteria 12363
580 nmdc:mga09592_316841_c1 3300050508 Bacteria 1351
581 nmdc:mga09592_472546_c1 3300050508 Bacteria 1081
582 nmdc:mga09592_55588_c1 3300050508 Bacteria 3345
583 nmdc:mga0qj67_19983_c1 3300050509 Bacteria 5126
584 nmdc:mga0qj67_24872_c1 3300050509 Bacteria 4621
585 nmdc:mga0qj67_5153_c1 3300050509 Bacteria 9527
586 nmdc:mga0qj67_726744_c1 3300050509 Bacteria 789
587 nmdc:mga0qj67_76380_c1 3300050509 Bacteria 2679
588 nmdc:mga06r32_1282030_c1 3300050510 Bacteria 677
589 nmdc:mga06r32_13185_c1 3300050510 Bacteria 7488
590 nmdc:mga06r32_156746_c1 3300050510 Bacteria 2258
591 nmdc:mga06r32_1592340_c1 3300050510 Bacteria 592
592 nmdc:mga06r32_324008_c1 3300050510 Bacteria 1526
593 nmdc:mga06r32_38067_c1 3300050510 Bacteria 4554
594 nmdc:mga06r32_9552_c1 3300050510 Bacteria 8758
595 nmdc:mga08y16_109057_c1 3300050511 Bacteria 2882
596 nmdc:mga08y16_1150799_c1 3300050511 Bacteria 749
597 nmdc:mga08y16_17529_c1 3300050511 Bacteria 7542
598 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
599 nmdc:mga08y16_3529_c1 3300050511 Bacteria 16237
600 nmdc:mga08y16_408326_c1 3300050511 Bacteria 1389
601 nmdc:mga08y16_52143_c1 3300050511 Bacteria 4280
602 nmdc:mga08y16_666541_c1 3300050511 Bacteria 1043
603 nmdc:mga0n895_195581_c2 3300050512 Bacteria 1040
604 nmdc:mga0n895_376660_c1 3300050512 Bacteria 1436
605 nmdc:mga0n895_5943_c1 3300050512 Bacteria 10266
606 nmdc:mga0a205_18430_c1 3300050515 Bacteria 6563
607 nmdc:mga0a205_18629_c1 3300050515 Bacteria 6531
608 nmdc:mga0a205_389558_c1 3300050515 Bacteria 1258
609 nmdc:mga0a205_42207_c1 3300050515 Bacteria 4394
610 nmdc:mga0a205_48168_c1 3300050515 Bacteria 4113
611 nmdc:mga0a205_74704_c1 3300050515 Bacteria 3275
612 nmdc:mga0a205_82233_c1 3300050515 Bacteria 3110
613 Ga0495601_0312208 3300053077 Bacteria 1024
614 Ga0495601_0469590 3300053077 Bacteria 813
615 Ga0495612_0342904 3300053078 Bacteria 674
616 Ga0500641_0006072 3300053096 Bacteria 4280
617 Ga0500556_0007078 3300053104 Bacteria 3203
618 Ga0500568_0013092 3300053139 Bacteria 3793
619 Ga0500616_0003513 3300053153 Bacteria 11902
620 Ga0500611_043423 3300053727 Bacteria 998
621 Ga0501084_0006193 3300054114 Bacteria 9838
622 Ga0501084_0012966 3300054114 Bacteria 6902
623 Ga0501084_0228904 3300054114 Bacteria 1569
624 Ga0501084_0710714 3300054114 Bacteria 847
625 Ga0501084_0895238 3300054114 Bacteria 746
626 Ga0590071_040230 3300059421 Bacteria 1124
627 Ga0590071_052993 3300059421 Bacteria 985
628 Ga0590071_057838 3300059421 Bacteria 945
629 Ga0590075_050668 3300059424 Bacteria 1065
630 Ga0590075_066463 3300059424 Bacteria 930
631 Ga0590077_000256 3300059426 Bacteria 15185
632 Ga0501082_0074604 3300060353 Bacteria 2922
633 Ga0501082_0084295 3300060353 Bacteria 2741
634 Ga0501082_0269235 3300060353 Bacteria 1482
635 Ga0501082_0763864 3300060353 Bacteria 846
636 Ga0501082_0884055 3300060353 Bacteria 782
637 Ga0501082_1077570 3300060353 Bacteria 702
638 Ga0530510_0004651 3300061734 Bacteria 9494
639 Ga0530510_0487647 3300061734 Bacteria 934
640 nmdc:mga09592_866322_c1
641 JGI24745J21846_1016045
642 JGI24035J26624_1009355
643 JGI25406J46586_10000551
644 JGI25406J46586_10001262
645 JGI25406J46586_10120242
646 Ga0065714_10072204
647 Ga0065704_10005852
648 Ga0065712_10009881
649 Ga0065712_10018740
650 Ga0065712_10084760
651 Ga0065712_10087888
652 Ga0065712_10310482
653 Ga0065712_10406397
654 Ga0065715_10009247
655 Ga0065715_10009346
656 Ga0065715_10105744
657 Ga0065715_10462750
658 Ga0065707_10103611
659 Ga0065707_10167221
660 Ga0065707_10318638
661 Ga0070683_100000094
662 Ga0070683_100103115
663 Ga0070670_100029410
664 Ga0070670_100047811
665 Ga0070670_100186698
666 Ga0070670_100674048
667 Ga0070677_10128962
668 Ga0070677_10320386
669 Ga0068869_100239485
670 Ga0070666_10528333
671 Ga0070680_100259809
672 Ga0070680_100336784
673 Ga0070682_100213800
674 Ga0068868_100049345
675 Ga0070660_100265946
676 Ga0070687_100060313
677 Ga0070661_100016313
678 Ga0070661_100169844
679 Ga0070661_100697914
680 Ga0070661_100934584
681 Ga0070668_100367769
682 Ga0070668_101386338
683 Ga0070669_100005170
684 Ga0070669_100040998
685 Ga0070669_100351989
686 Ga0070669_101048725
687 Ga0070675_100041683
688 Ga0070675_100235798
689 Ga0070675_100386547
690 Ga0070675_100397586
691 Ga0070675_100398057
692 Ga0070671_100050359
693 Ga0070671_100437696
694 Ga0070674_100356010
695 Ga0070673_100581237
696 Ga0070688_100050003
697 Ga0070688_100868461
698 Ga0070688_101017771
699 Ga0070659_100639026
700 Ga0070667_100939165
701 Ga0070667_100943757
702 Ga0070713_100018924
703 Ga0070700_100020842
704 Ga0070700_100038200
705 Ga0070694_100608024
706 Ga0070694_100738971
707 Ga0070663_100098572
708 Ga0070663_100590807
709 Ga0070678_100132984
710 Ga0070678_100363343
711 Ga0070678_100685909
712 Ga0070681_10259734
713 Ga0070698_100034849
714 Ga0070699_100001266
715 Ga0070699_100972890
716 Ga0070684_100000166
717 Ga0070684_100506079
718 Ga0070672_100197870
719 Ga0070672_100304866
720 Ga0070672_100382132
721 Ga0070672_100557131
722 Ga0070672_100693113
723 Ga0070686_100386376
724 Ga0070695_100072900
725 Ga0070695_100828934
726 Ga0070696_100215415
727 Ga0070696_100540765
728 Ga0070693_100026270
729 Ga0070665_101281379
730 Ga0070704_100030216
731 Ga0070664_100009365
732 Ga0070664_100128339
733 Ga0070664_100415934
734 Ga0070664_100716256
735 Ga0068856_100265569
736 Ga0070702_100005168
737 Ga0068859_100784460
738 Ga0068864_101170761
739 Ga0068861_100019101
740 Ga0068861_100170030
741 Ga0068861_100599356
742 Ga0068861_101830081
743 Ga0068851_10270367
744 Ga0068863_100865763
745 Ga0068863_101485358
746 Ga0068862_100035412
747 Ga0068862_100200782
748 Ga0068862_100331869
749 Ga0068862_100557333
750 Ga0081539_10000074
751 Ga0081539_10001558
752 Ga0081539_10001853
753 Ga0081539_10040561
754 Ga0081539_10179139
755 Ga0070717_10415409
756 Ga0075368_10052983
757 Ga0075363_100323192
758 Ga0075364_10001357
759 Ga0075364_10180189
760 Ga0075364_10272761
761 Ga0075362_10000746
762 Ga0075362_10130114
763 Ga0075367_10030679
764 Ga0075367_10076777
765 Ga0075367_10100255
766 Ga0075367_10173273
767 Ga0075366_10122669
768 Ga0075366_10159559
769 Ga0097621_100146702
770 Ga0097621_100435440
771 Ga0097621_100894088
772 Ga0075370_10100482
773 Ga0075370_10215271
774 Ga0075428_100000017
775 Ga0075428_100000295
776 Ga0075428_100069014
777 Ga0075428_100073237
778 Ga0075430_100003248
779 Ga0075430_100017811
780 Ga0075430_100020871
781 Ga0075430_100033466
782 Ga0075430_100315830
783 Ga0075430_100822014
784 Ga0075430_101013247
785 Ga0075431_100004098
786 Ga0075431_100047382
787 Ga0075431_100120157
788 Ga0075431_100139379
789 Ga0075431_100238020
790 Ga0075431_100781717
791 Ga0075433_10090367
792 Ga0075433_10125663
793 Ga0075433_10149209
794 Ga0075433_10260473
795 Ga0075433_10553867
796 Ga0075434_100504270
797 Ga0075434_101262632
798 Ga0075434_101469276
799 Ga0075429_100043580
800 Ga0075429_100399298
801 Ga0075429_100517201
802 Ga0075429_100810836
803 Ga0068865_100695936
804 Ga0097620_100784377
805 Ga0075435_100902238
806 Ga0105240_10103506
807 Ga0105240_10151938
808 Ga0111539_10000002
809 Ga0111539_10000037
810 Ga0111539_10008348
811 Ga0111539_10024995
812 Ga0111539_10132671
813 Ga0111539_10366981
814 Ga0111539_10568136
815 Ga0111539_10724381
816 Ga0111539_11339402
817 Ga0111539_11574096
818 Ga0105247_11185299
819 Ga0114129_10004316
820 Ga0114129_10008636
821 Ga0114129_10009195
822 Ga0114129_10015583
823 Ga0114129_10055131
824 Ga0114129_11368661
825 Ga0105243_11554325
826 Ga0105241_10036009
827 Ga0105242_10862317
828 Ga0105242_12162645
829 Ga0105248_10221608
830 Ga0105248_10222454
831 Ga0105248_10777388
832 Ga0105248_13044020
833 Ga0105237_10148692
834 Ga0105238_10298326
835 Ga0105249_10116358
836 Ga0105249_10339804
837 Ga0105249_10656757
838 Ga0105239_10340380
839 Ga0105246_10531502
840 Ga0157378_10479074
841 Ga0163162_10008950
842 Ga0163162_10256904
843 Ga0163162_10841242
844 Ga0157375_10439164
845 Ga0157375_10780624
846 Ga0157375_12076562
847 Ga0163163_10003825
848 Ga0163163_10030417
849 Ga0163163_10304756
850 Ga0157380_10108216
851 Ga0157380_10396133
852 Ga0157380_10545858
853 Ga0157380_10984312
854 Ga0157380_11152707
855 Ga0157380_11297186
856 Ga0157380_11587689
857 Ga0157377_10041220
858 Ga0157379_11452105
859 Ga0157376_10357727
860 Ga0157376_10382089
861 Ga0157376_10904952
862 Ga0207666_1040252
863 Ga0207697_10000717
864 Ga0207682_10082501
865 Ga0207688_10001322
866 Ga0207680_10093459
867 Ga0207680_10192550
868 Ga0207680_10330409
869 Ga0207643_10106690
870 Ga0207643_10664206
871 Ga0207705_10779332
872 Ga0207707_10125793
873 Ga0207671_10082575
874 Ga0207657_10649472
875 Ga0207649_10021247
876 Ga0207649_10862147
877 Ga0207681_10003863
878 Ga0207681_11352844
879 Ga0207650_10016257
880 Ga0207650_10077153
881 Ga0207650_10260187
882 Ga0207659_10028324
883 Ga0207659_10055057
884 Ga0207659_10095935
885 Ga0207659_10200018
886 Ga0207659_10261151
887 Ga0207659_10622685
888 Ga0207644_10052792
889 Ga0207644_10455445
890 Ga0207690_10077857
891 Ga0207706_10345068
892 Ga0207709_11071088
893 Ga0207669_10041536
894 Ga0207669_10076108
895 Ga0207669_10079190
896 Ga0207669_10112204
897 Ga0207669_10121789
898 Ga0207669_10763035
899 Ga0207691_10149718
900 Ga0207691_10211982
901 Ga0207691_10523878
902 Ga0207691_10547518
903 Ga0207711_10120457
904 Ga0207711_10907801
905 Ga0207661_10020111
906 Ga0207661_10108572
907 Ga0207679_10005801
908 Ga0207679_10641560
909 Ga0207651_10187694
910 Ga0207651_11392180
911 Ga0207712_10004344
912 Ga0207712_10372625
913 Ga0207712_10669844
914 Ga0207668_10270489
915 Ga0207668_11098358
916 Ga0207640_10267345
917 Ga0207640_10837246
918 Ga0207640_11707054
919 Ga0207658_10857419
920 Ga0207658_10978303
921 Ga0207678_10132479
922 Ga0207708_10067174
923 Ga0207708_10070516
924 Ga0207708_10744203
925 Ga0207702_10135324
926 Ga0207641_10291226
927 Ga0207641_10812847
928 Ga0207641_11385543
929 Ga0207676_10140197
930 Ga0207676_10159926
931 Ga0207674_10603316
932 Ga0207674_10975228
933 Ga0207675_100011213
934 Ga0207675_100339487
935 Ga0207675_101233964
936 Ga0207683_10055481
937 Ga0207683_10118218
938 Ga0207683_10413841
939 Ga0207683_10731172
940 Ga0209968_1018725
941 Ga0209998_10046096
942 Ga0209813_10107085
943 Ga0209974_10176669
944 Ga0207428_10000004
945 Ga0207428_10001068
946 Ga0207428_10012687
947 Ga0207428_10243210
948 Ga0207428_10535986
949 Ga0268265_10018118
950 Ga0268265_10159237
951 Ga0268265_10355028
952 Ga0268265_10378813
953 Ga0268265_10545157
954 Ga0268265_11780363
955 Ga0268264_10129238
956 Ga0268264_11064473
957 Ga0307408_100030568
958 Ga0307408_100201185
959 Ga0307408_100396225
960 Ga0307408_101103814
961 Ga0307408_101617492
962 Ga0307405_10030293
963 Ga0307405_10973968
964 Ga0307413_10081301
965 Ga0307413_10690389
966 Ga0307413_10794136
967 Ga0307410_10031322
968 Ga0307410_10187188
969 Ga0307410_10357881
970 Ga0307406_10078753
971 Ga0307406_10534429
972 Ga0307407_10013207
973 Ga0307407_10473829
974 Ga0307407_10488159
975 Ga0307407_10559304
976 Ga0307412_10004341
977 Ga0307412_10057260
978 Ga0307409_100016611
979 Ga0307409_100198041
980 Ga0307409_100440710
981 Ga0307416_100019683
982 Ga0307416_100032671
983 Ga0307416_100077431
984 Ga0307416_100107948
985 Ga0307416_100108892
986 Ga0307416_100111565
987 Ga0307416_100131191
988 Ga0307416_100294305
989 Ga0307416_100939416
990 Ga0307416_101195397
991 Ga0307414_10065988
992 Ga0307414_10499577
993 Ga0307411_10022399
994 Ga0307411_10074438
995 Ga0307411_10249991
996 Ga0307411_10336041
997 Ga0307411_10573462
998 Ga0307411_10584277
999 Ga0307411_10670192
1000 Ga0307415_100067318
1001 Ga0307415_100233055
1002 Ga0307415_100416548
1003 Ga0307415_100679630
1004 Ga0373929_0082191
1005 Ga0373945_0079918
1006 Ga0373946_0159597
1007 Ga0373931_0909359
1008 Ga0373935_0188915
1009 Ga0373935_0251565
1010 Ga0373933_0172169
1011 Ga0373933_0517343
1012 Ga0373937_0025518
1013 Ga0373925_1050376
1014 Ga0451800_1266025
1015 Ga0451807_1318327
1016 Ga0451841_0375391
1017 Ga0451843_0700692
1018 Ga0451853_1554116
1019 Ga0439431_0045483
1020 Ga0439433_0040321
1021 Ga0439433_0114530
1022 Ga0439437_017052
1023 Ga0439445_0022985
1024 Ga0439450_010750
1025 Ga0439462_0058283
1026 Ga0450920_039900
1027 Ga0450896_026488
1028 Ga0439446_0017402
1029 Ga0439446_0018579
1030 Ga0439446_0072768
1031 Ga0439435_0012867
1032 Ga0439435_0044165
1033 Ga0439435_0138662
1034 Ga0439444_0067247
1035 Ga0439444_0074934
1036 Ga0439464_0039402
1037 Ga0439464_0090786
1038 Ga0439460_0026127
1039 Ga0439460_0033799
1040 Ga0439460_0080817
1041 Ga0451577_0125270
1042 Ga0439440_0046765
1043 Ga0453684_0335310
1044 Ga0451576_0043533
1045 Ga0451576_0094215
1046 Ga0495592_0135150
1047 Ga0495638_0008491
1048 Ga0495582_0281907
1049 Ga0495639_0574761
1050 Ga0495608_0197436
1051 Ga0495587_0475331
1052 Ga0495598_0040628
1053 Ga0495656_0039211
1054 Ga0495635_0049123
1055 Ga0495659_0021490
1056 Ga0495659_0307617
1057 Ga0495647_0152101
1058 Ga0495658_0061320
1059 Ga0495600_0117828
1060 Ga0495636_0120564
1061 Ga0495674_0107881
1062 Ga0495674_0249426
1063 Ga0495674_1065018
1064 Ga0495672_0120022
1065 Ga0495684_0261197
1066 Ga0495684_0273969
1067 Ga0496101_0601485
1068 Ga0496102_0028152
1069 Ga0496102_0339962
1070 Ga0496103_0529891
1071 Ga0496104_0265287
1072 Ga0496104_0282814
1073 Ga0496105_0339869
1074 Ga0496106_0631757
1075 Ga0496108_0050479
1076 Ga0496109_0018373
1077 Ga0496109_1558771
1078 Ga0496110_0011815
1079 Ga0496111_0012097
1080 Ga0496111_0088437
1081 Ga0496112_0003634
1082 Ga0496113_0212734
1083 Ga0496114_0100789
1084 Ga0496114_0438191
1085 Ga0496114_0710662
1086 Ga0496115_0520649
1087 Ga0501292_001564
1088 Ga0501299_022960
1089 Ga0501299_097809
1090 Ga0501300_032088
1091 Ga0501031_0028667
1092 Ga0501031_0077005
1093 Ga0501031_0100742
1094 Ga0501031_0202990
1095 Ga0501032_0316046
1096 Ga0501033_0137386
1097 Ga0501033_0532023
1098 Ga0501034_0020238
1099 Ga0501034_0106719
1100 Ga0501034_0115821
1101 Ga0501034_0861575
1102 Ga0501036_0018205
1103 Ga0501036_0323016
1104 Ga0501036_1097418
1105 Ga0501036_1696559
1106 Ga0501037_0104826
1107 Ga0501037_0291201
1108 Ga0501038_0173861
1109 Ga0501038_0361112
1110 Ga0501038_0433622
1111 Ga0501039_0006784
1112 Ga0501039_0146214
1113 Ga0501039_0293359
1114 Ga0501040_0067255
1115 Ga0501040_0238818
1116 Ga0501040_0568752
1117 Ga0501040_0698474
1118 Ga0501040_0960159
1119 Ga0501041_0012600
1120 Ga0501041_0449975
1121 Ga0501042_0175687
1122 Ga0501042_0198924
1123 Ga0501043_0001515
1124 Ga0501046_0056943
1125 Ga0501047_0000655
1126 Ga0501047_0020226
1127 Ga0501047_0997622
1128 Ga0501048_0322227
1129 Ga0501048_0395491
1130 Ga0501067_0086419
1131 Ga0501067_0102782
1132 Ga0501067_0104188
1133 Ga0501068_0023032
1134 Ga0501068_0144844
1135 Ga0501068_0374429
1136 Ga0501068_0582052
1137 Ga0501070_0289836
1138 Ga0501071_0040967
1139 Ga0501071_0198355
1140 Ga0501071_0386114
1141 Ga0501072_0096244
1142 Ga0501072_0121998
1143 Ga0501072_0188081
1144 Ga0501072_0205294
1145 Ga0501072_0235429
1146 Ga0501072_0620448
1147 Ga0501073_0069110
1148 Ga0501073_0179319
1149 Ga0501073_0745195
1150 Ga0501073_0909887
1151 Ga0501074_0057226
1152 Ga0501074_0226228
1153 Ga0501074_0836872
1154 Ga0501075_0016140
1155 Ga0501075_0025261
1156 Ga0501075_0137163
1157 Ga0501075_0304239
1158 Ga0501075_0655270
1159 Ga0501075_1304262
1160 Ga0501076_0002349
1161 Ga0501076_0017306
1162 Ga0501076_0052814
1163 Ga0501076_0325057
1164 Ga0501076_0718808
1165 Ga0501076_1054189
1166 Ga0501077_0033000
1167 Ga0501077_0163910
1168 Ga0501077_0241339
1169 Ga0501077_0657962
1170 Ga0501208_130984
1171 Ga0501211_004634
1172 Ga0501217_080814
1173 Ga0501233_080764
1174 Ga0501246_006699
1175 Ga0501261_008614
1176 Ga0501225_0205906
1177 Ga0501079_0121992
1178 Ga0501079_0862700
1179 Ga0501080_0004681
1180 Ga0501080_0046088
1181 Ga0501080_0059920
1182 Ga0501080_0711364
1183 Ga0501081_0047734
1184 Ga0501081_0160062
1185 Ga0501083_0011535
1186 Ga0501083_0035680
1187 Ga0501083_0044372
1188 Ga0501083_0621858
1189 Ga0501266_053971
1190 Ga0501270_017764
1191 Ga0501283_037067
1192 Ga0501035_0087739
1193 Ga0501035_0621703
1194 Ga0501035_0799212
1195 Ga0501044_0399364
1196 Ga0501044_0790490
1197 Ga0501045_0003977
1198 Ga0501045_0203817
1199 Ga0501045_0252051
1200 nmdc:mga03683_130170_c1
1201 nmdc:mga03683_18662_c1
1202 nmdc:mga00v17_209911_c1
1203 nmdc:mga00v17_258565_c1
1204 nmdc:mga00v17_3790_c1
1205 nmdc:mga0yw44_314216_c1
1206 nmdc:mga0k408_369372_c1
1207 nmdc:mga0k408_8033_c1
1208 nmdc:mga0k408_8489_c1
1209 nmdc:mga06z11_167416_c1
1210 nmdc:mga06z11_50336_c1
1211 nmdc:mga06z11_60949_c1
1212 nmdc:mga04h51_15505_c1
1213 nmdc:mga04h51_18673_c1
1214 nmdc:mga05p37_1981_c1
1215 nmdc:mga05p37_2447_c1
1216 nmdc:mga05p37_36837_c2
1217 nmdc:mga05p37_59395_c1
1218 nmdc:mga05p37_8178_c1
1219 nmdc:mga09592_316841_c1
1220 nmdc:mga09592_472546_c1
1221 nmdc:mga09592_55588_c1
1222 nmdc:mga0qj67_19983_c1
1223 nmdc:mga0qj67_24872_c1
1224 nmdc:mga0qj67_5153_c1
1225 nmdc:mga0qj67_726744_c1
1226 nmdc:mga0qj67_76380_c1
1227 nmdc:mga06r32_1282030_c1
1228 nmdc:mga06r32_13185_c1
1229 nmdc:mga06r32_156746_c1
1230 nmdc:mga06r32_1592340_c1
1231 nmdc:mga06r32_324008_c1
1232 nmdc:mga06r32_38067_c1
1233 nmdc:mga06r32_9552_c1
1234 nmdc:mga08y16_109057_c1
1235 nmdc:mga08y16_1150799_c1
1236 nmdc:mga08y16_17529_c1
1237 nmdc:mga08y16_2_c1
1238 nmdc:mga08y16_3529_c1
1239 nmdc:mga08y16_408326_c1
1240 nmdc:mga08y16_52143_c1
1241 nmdc:mga08y16_666541_c1
1242 nmdc:mga0n895_195581_c2
1243 nmdc:mga0n895_376660_c1
1244 nmdc:mga0n895_5943_c1
1245 nmdc:mga0a205_18430_c1
1246 nmdc:mga0a205_18629_c1
1247 nmdc:mga0a205_389558_c1
1248 nmdc:mga0a205_42207_c1
1249 nmdc:mga0a205_48168_c1
1250 nmdc:mga0a205_74704_c1
1251 nmdc:mga0a205_82233_c1
1252 Ga0495601_0312208
1253 Ga0495601_0469590
1254 Ga0495612_0342904
1255 Ga0500641_0006072
1256 Ga0500556_0007078
1257 Ga0500568_0013092
1258 Ga0500616_0003513
1259 Ga0500611_043423
1260 Ga0501084_0006193
1261 Ga0501084_0012966
1262 Ga0501084_0228904
1263 Ga0501084_0710714
1264 Ga0501084_0895238
1265 Ga0590071_040230
1266 Ga0590071_052993
1267 Ga0590071_057838
1268 Ga0590075_050668
1269 Ga0590075_066463
1270 Ga0590077_000256
1271 Ga0501082_0074604
1272 Ga0501082_0084295
1273 Ga0501082_0269235
1274 Ga0501082_0763864
1275 Ga0501082_0884055
1276 Ga0501082_1077570
1277 Ga0530510_0004651
1278 Ga0530510_0487647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

44

194

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l8f-assembly1.cif.gz_C crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a, e62a, h65a. 0.9893 2 48
5l8b-assembly2.cif.gz_Q crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a 0.9892 2 48
5l8b-assembly1.cif.gz_E crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a 0.988 2 48
5l8b-assembly4.cif.gz_a crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a 0.9868 2 48
5l8b-assembly1.cif.gz_J crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a 0.9863 2 48
ID Description Score Start End Superfamily
5l8bX00 Special;Helix non-globular;Helix Hairpins; 0.9877 2 48 6.10.140.1960
5l8bP00 Special;Helix non-globular;Helix Hairpins; 0.9872 2 48 6.10.140.1960
5l8fA00 Special;Helix non-globular;Helix Hairpins; 0.9869 2 48 6.10.140.1960
5l8ba00 Special;Helix non-globular;Helix Hairpins; 0.9868 2 48 6.10.140.1960
5l8gQ00 Special;Helix non-globular;Helix Hairpins; 0.9848 2 48 6.10.140.1960
ID Description Score Start End GO Terms
AF-A0A2G2JYV0-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9753 1 60 GO:0005886
GO:0008137
GO:0048038
AF-A0A526ZEA5-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9629 2 60 GO:0005886
GO:0008137
GO:0048038
AF-A0A2G2JYV0-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9598 1 60 GO:0005886
GO:0008137
GO:0048038
AF-A0A355SYS2-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9585 2 60 GO:0005886
GO:0008137
GO:0048038
AF-A0A257VTF4-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9165 1 70 GO:0005886
GO:0008137
GO:0048038

Map