F471548

General Info

Members Datasets Scaffolds Average Seq Length
638 275 1276 277

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0273413|Ga0495628_0273413_132_938
Length 268
Sequence MDSPLVTPAWLSDALASSNPPLVIDVRPAEQFAAGHIPTAVHLDLWGVSLIDTSDAPLRAFMWMIGHLFSHRGVRPDQPVVVYESDSGMRAARAFWLLDVLGHPRPLLLDGGSTAWVADGLALTTEVHTPVPSTWHGAIEPDKLATWKQVADRLGQAGVAIVDTRSDEEFTGKVARAARSGAIPGAVHVEWTENLRDGKFKSPEELRAMYLGAGVRLPDEVLTYCQGGYRAAHAYIALRLAGYVNVRNYTGSWKEWGDRLDLPIDPRR

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 3.76
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 16.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0273413 3300046516 Bacteria 1256
2 Ga0065704_10189860 3300005289 Unclassified 1136
3 Ga0065712_10001092 3300005290 Bacteria 12074
4 Ga0065712_10007450 3300005290 Bacteria 4094
5 Ga0065712_10110232 3300005290 Unclassified 1834
6 Ga0065712_10133943 3300005290 Bacteria 1506
7 Ga0065715_10000243 3300005293 Bacteria 21447
8 Ga0065715_10009825 3300005293 Bacteria 2562
9 Ga0065715_10011620 3300005293 Unclassified 4569
10 Ga0065715_10091646 3300005293 Bacteria 5648
11 Ga0065715_10099119 3300005293 Bacteria 3456
12 Ga0065715_10108954 3300005293 Bacteria 2688
13 Ga0065707_10003696 3300005295 Bacteria 6593
14 Ga0070658_10079327 3300005327 Unclassified 2695
15 Ga0070676_10040109 3300005328 Unclassified 2710
16 Ga0070676_10049418 3300005328 Bacteria 2462
17 Ga0070683_100000702 3300005329 Bacteria 24327
18 Ga0070670_100004852 3300005331 Bacteria 11309
19 Ga0070670_100043972 3300005331 Bacteria 3840
20 Ga0070670_100148450 3300005331 Bacteria 2029
21 Ga0070677_10029409 3300005333 Unclassified 2083
22 Ga0068869_100098191 3300005334 Bacteria 2212
23 Ga0070666_10034847 3300005335 Bacteria 3336
24 Ga0070666_10059604 3300005335 Bacteria 2582
25 Ga0070666_10115315 3300005335 Bacteria 1860
26 Ga0070680_100120764 3300005336 Unclassified 2187
27 Ga0070682_100056876 3300005337 Bacteria 2462
28 Ga0070682_100220709 3300005337 Bacteria 1349
29 Ga0068868_100136537 3300005338 Unclassified 2011
30 Ga0070660_100047354 3300005339 Unclassified 3299
31 Ga0070687_100073178 3300005343 Bacteria 1846
32 Ga0070687_100122430 3300005343 Bacteria 1490
33 Ga0070661_100078044 3300005344 Unclassified 2442
34 Ga0070668_100063659 3300005347 Bacteria 2859
35 Ga0070668_100064576 3300005347 Bacteria 2838
36 Ga0070668_100069375 3300005347 Bacteria 2742
37 Ga0070668_100221661 3300005347 Bacteria 1560
38 Ga0070669_100141307 3300005353 Unclassified 1856
39 Ga0070669_100192705 3300005353 Bacteria 1600
40 Ga0070669_100358120 3300005353 Unclassified 1186
41 Ga0070675_100044603 3300005354 Bacteria 3626
42 Ga0070675_100079333 3300005354 Bacteria 2735
43 Ga0070675_100193280 3300005354 Bacteria 1764
44 Ga0070675_100421234 3300005354 Unclassified 1194
45 Ga0070671_100035887 3300005355 Bacteria 4109
46 Ga0070671_100038680 3300005355 Bacteria 3959
47 Ga0070671_100044186 3300005355 Bacteria 3702
48 Ga0070671_100060725 3300005355 Bacteria 3148
49 Ga0070674_100017414 3300005356 Bacteria 4521
50 Ga0070674_100105785 3300005356 Bacteria 2058
51 Ga0070674_100226578 3300005356 Bacteria 1457
52 Ga0070673_100002817 3300005364 Bacteria 10694
53 Ga0070673_100143069 3300005364 Bacteria 2019
54 Ga0070688_100035431 3300005365 Bacteria 3032
55 Ga0070688_100143658 3300005365 Bacteria 1624
56 Ga0070688_100157525 3300005365 Unclassified 1558
57 Ga0070659_100092042 3300005366 Unclassified 2431
58 Ga0070659_100245585 3300005366 Unclassified 1482
59 Ga0070667_100058116 3300005367 Unclassified 3269
60 Ga0070667_100081409 3300005367 Bacteria 2771
61 Ga0070667_100093549 3300005367 Bacteria 2589
62 Ga0070667_100700800 3300005367 Bacteria 937
63 Ga0070709_10243430 3300005434 Bacteria 1292
64 Ga0070701_10031600 3300005438 Bacteria 2628
65 Ga0070701_10159767 3300005438 Bacteria 1304
66 Ga0070705_100229952 3300005440 Unclassified 1289
67 Ga0070705_100344240 3300005440 Bacteria 1085
68 Ga0070700_100038341 3300005441 Bacteria 2920
69 Ga0070694_100028984 3300005444 Bacteria 3609
70 Ga0070694_100080381 3300005444 Bacteria 2265
71 Ga0070694_100352820 3300005444 Bacteria 1140
72 Ga0070663_100032064 3300005455 Bacteria 3618
73 Ga0070678_100180956 3300005456 Unclassified 1725
74 Ga0070678_100235874 3300005456 Bacteria 1527
75 Ga0070678_100401559 3300005456 Unclassified 1191
76 Ga0070678_100583150 3300005456 Unclassified 996
77 Ga0070662_100149445 3300005457 Bacteria 1817
78 Ga0070681_10081187 3300005458 Bacteria 3198
79 Ga0070681_10406667 3300005458 Unclassified 1273
80 Ga0068867_100080024 3300005459 Unclassified 2460
81 Ga0068867_100081710 3300005459 Bacteria 2436
82 Ga0070685_10014580 3300005466 Unclassified 4165
83 Ga0070706_100238829 3300005467 Bacteria 1697
84 Ga0070679_100108609 3300005530 Bacteria 2760
85 Ga0070684_100000068 3300005535 Bacteria 65538
86 Ga0070684_100020170 3300005535 Bacteria 5530
87 Ga0068853_100160473 3300005539 Unclassified 2029
88 Ga0070672_100019288 3300005543 Bacteria 4947
89 Ga0070686_100118848 3300005544 Bacteria 1812
90 Ga0070686_100149419 3300005544 Bacteria 1635
91 Ga0070695_100194281 3300005545 Unclassified 1446
92 Ga0070696_100022190 3300005546 Bacteria 4312
93 Ga0070696_100410626 3300005546 Bacteria 1061
94 Ga0070693_100035065 3300005547 Bacteria 2780
95 Ga0070665_100197036 3300005548 Bacteria 2015
96 Ga0070665_100212153 3300005548 Bacteria 1937
97 Ga0070704_100049883 3300005549 Bacteria 2939
98 Ga0070704_100071073 3300005549 Bacteria 2527
99 Ga0068855_100270507 3300005563 Unclassified 1889
100 Ga0070664_100000408 3300005564 Bacteria 32016
101 Ga0070664_100098617 3300005564 Unclassified 2538
102 Ga0070664_100105419 3300005564 Bacteria 2455
103 Ga0068857_100017341 3300005577 Bacteria 6309
104 Ga0068857_100343062 3300005577 Bacteria 1382
105 Ga0068856_100011122 3300005614 Bacteria 8736
106 Ga0068852_100127803 3300005616 Bacteria 2336
107 Ga0068859_100017581 3300005617 Bacteria 7189
108 Ga0068864_100129638 3300005618 Bacteria 2264
109 Ga0068861_100030653 3300005719 Bacteria 3943
110 Ga0068861_100124823 3300005719 Bacteria 2081
111 Ga0068861_100254637 3300005719 Bacteria 1500
112 Ga0068861_100272357 3300005719 Bacteria 1454
113 Ga0068861_100709761 3300005719 Bacteria 935
114 Ga0068870_10309386 3300005840 Bacteria 1000
115 Ga0068860_100113978 3300005843 Bacteria 2585
116 Ga0068862_100012472 3300005844 Bacteria 7034
117 Ga0081455_10062511 3300005937 Bacteria 3129
118 Ga0081455_10210783 3300005937 Bacteria 1448
119 Ga0070717_10317202 3300006028 Bacteria 1388
120 Ga0075365_10001207 3300006038 Bacteria 11410
121 Ga0075363_100046976 3300006048 Bacteria 2292
122 Ga0075364_10011061 3300006051 Bacteria 5476
123 Ga0075364_10043951 3300006051 Bacteria 2905
124 Ga0075364_10049492 3300006051 Bacteria 2741
125 Ga0075364_10114738 3300006051 Bacteria 1800
126 Ga0070716_100049593 3300006173 Unclassified 2379
127 Ga0075367_10014952 3300006178 Bacteria 4206
128 Ga0075367_10136293 3300006178 Bacteria 1519
129 Ga0075367_10224629 3300006178 Bacteria 1175
130 Ga0075366_10034638 3300006195 Bacteria 2974
131 Ga0075366_10039830 3300006195 Bacteria 2778
132 Ga0097621_100050813 3300006237 Bacteria 3372
133 Ga0097621_100160036 3300006237 Bacteria 1935
134 Ga0097621_100181576 3300006237 Unclassified 1818
135 Ga0075370_10036700 3300006353 Bacteria 2753
136 Ga0068871_100042411 3300006358 Bacteria 3652
137 Ga0068871_100161780 3300006358 Unclassified 1915
138 Ga0075428_100000007 3300006844 Bacteria 273226
139 Ga0075428_100000080 3300006844 Bacteria 80349
140 Ga0075428_100008548 3300006844 Bacteria 11358
141 Ga0075428_100765682 3300006844 Bacteria 1027
142 Ga0075430_100001296 3300006846 Bacteria 20155
143 Ga0075430_100008205 3300006846 Bacteria 8819
144 Ga0075430_100028567 3300006846 Bacteria 4737
145 Ga0075431_100002515 3300006847 Bacteria 17677
146 Ga0075431_100013703 3300006847 Bacteria 8193
147 Ga0075431_100022391 3300006847 Bacteria 6458
148 Ga0075431_100261494 3300006847 Bacteria 1756
149 Ga0075431_100444761 3300006847 Bacteria 1292
150 Ga0075431_100612342 3300006847 Bacteria 1072
151 Ga0075431_100893686 3300006847 Bacteria 858
152 Ga0075433_10012959 3300006852 Bacteria 6760
153 Ga0075433_10045659 3300006852 Bacteria 3809
154 Ga0075433_10273605 3300006852 Bacteria 1497
155 Ga0075434_100003574 3300006871 Bacteria 13890
156 Ga0075434_100003829 3300006871 Bacteria 13456
157 Ga0075434_100007745 3300006871 Bacteria 9945
158 Ga0075434_100009667 3300006871 Bacteria 9008
159 Ga0075434_100041345 3300006871 Bacteria 4568
160 Ga0075434_100515682 3300006871 Unclassified 1216
161 Ga0075429_100000156 3300006880 Bacteria 42804
162 Ga0075429_100001098 3300006880 Bacteria 21794
163 Ga0075429_100223549 3300006880 Unclassified 1649
164 Ga0068865_100036601 3300006881 Bacteria 3310
165 Ga0068865_100501801 3300006881 Unclassified 1012
166 Ga0075436_100179763 3300006914 Bacteria 1495
167 Ga0075436_100393737 3300006914 Bacteria 1003
168 Ga0097620_100017581 3300006931 Bacteria 7189
169 Ga0075435_100058310 3300007076 Bacteria 3126
170 Ga0075435_100085851 3300007076 Bacteria 2591
171 Ga0075435_100121368 3300007076 Unclassified 2181
172 Ga0075435_100142021 3300007076 Bacteria 2015
173 Ga0075435_100197806 3300007076 Bacteria 1703
174 Ga0111539_10000126 3300009094 Bacteria 86123
175 Ga0111539_10000181 3300009094 Bacteria 73457
176 Ga0111539_10000209 3300009094 Bacteria 69503
177 Ga0111539_10002571 3300009094 Bacteria 24028
178 Ga0111539_10003059 3300009094 Bacteria 22162
179 Ga0111539_10003739 3300009094 Bacteria 20026
180 Ga0111539_10007276 3300009094 Bacteria 14171
181 Ga0105245_10057076 3300009098 Bacteria 3511
182 Ga0114129_10000077 3300009147 Bacteria 90951
183 Ga0114129_10000113 3300009147 Bacteria 80752
184 Ga0114129_10002524 3300009147 Bacteria 25421
185 Ga0114129_10005533 3300009147 Bacteria 17870
186 Ga0114129_10019080 3300009147 Bacteria 9767
187 Ga0114129_10039874 3300009147 Bacteria 6625
188 Ga0114129_10043772 3300009147 Bacteria 6299
189 Ga0114129_10760291 3300009147 Bacteria 1240
190 Ga0114129_10784374 3300009147 Bacteria 1217
191 Ga0105243_10095585 3300009148 Bacteria 2456
192 Ga0105243_10096577 3300009148 Bacteria 2445
193 Ga0105241_10031061 3300009174 Bacteria 3996
194 Ga0105242_10059810 3300009176 Bacteria 3127
195 Ga0105242_10093851 3300009176 Bacteria 2530
196 Ga0105242_10553789 3300009176 Unclassified 1103
197 Ga0105248_10022766 3300009177 Bacteria 6953
198 Ga0105248_10046910 3300009177 Bacteria 4845
199 Ga0105248_10054018 3300009177 Bacteria 4506
200 Ga0105248_10072452 3300009177 Bacteria 3872
201 Ga0105248_10229941 3300009177 Bacteria 2087
202 Ga0105248_11046508 3300009177 Unclassified 922
203 Ga0105237_10103385 3300009545 Bacteria 2840
204 Ga0105238_10508973 3300009551 Bacteria 1206
205 Ga0105249_10001092 3300009553 Bacteria 24120
206 Ga0105249_10041046 3300009553 Bacteria 4205
207 Ga0105249_10162556 3300009553 Bacteria 2159
208 Ga0105249_10416074 3300009553 Bacteria 1377
209 Ga0105239_10338042 3300010375 Bacteria 1699
210 Ga0105239_10415450 3300010375 Unclassified 1523
211 Ga0105239_10454326 3300010375 Bacteria 1453
212 Ga0157370_10189133 3300013104 Bacteria 1911
213 Ga0157374_10130886 3300013296 Bacteria 2428
214 Ga0157378_10147044 3300013297 Bacteria 2193
215 Ga0163162_10040065 3300013306 Unclassified 4683
216 Ga0163162_10232794 3300013306 Bacteria 1973
217 Ga0157372_10184592 3300013307 Bacteria 2415
218 Ga0157372_10653834 3300013307 Bacteria 1224
219 Ga0157375_10335410 3300013308 Bacteria 1677
220 Ga0157375_10560977 3300013308 Unclassified 1303
221 Ga0163163_10000047 3300014325 Bacteria 131685
222 Ga0157380_10074748 3300014326 Bacteria 2752
223 Ga0157380_10608714 3300014326 Bacteria 1082
224 Ga0157377_10190131 3300014745 Unclassified 1297
225 Ga0157377_10244063 3300014745 Bacteria 1161
226 Ga0157379_10272523 3300014968 Bacteria 1539
227 Ga0157379_10491086 3300014968 Unclassified 1137
228 Ga0157376_10032880 3300014969 Unclassified 4169
229 Ga0157376_10075513 3300014969 Bacteria 2876
230 Ga0157376_10210373 3300014969 Bacteria 1795
231 Ga0163161_10040200 3300017792 Bacteria 3359
232 Ga0206356_11092933 3300020070 Bacteria 1394
233 Ga0207697_10006334 3300025315 Bacteria 5373
234 Ga0207697_10009342 3300025315 Unclassified 4243
235 Ga0207697_10043426 3300025315 Unclassified 1848
236 Ga0207656_10177172 3300025321 Bacteria 1022
237 Ga0207682_10029582 3300025893 Bacteria 2190
238 Ga0207682_10031951 3300025893 Bacteria 2115
239 Ga0207642_10038716 3300025899 Bacteria 2066
240 Ga0207642_10048161 3300025899 Bacteria 1909
241 Ga0207642_10097322 3300025899 Bacteria 1469
242 Ga0207710_10035482 3300025900 Unclassified 2194
243 Ga0207688_10005276 3300025901 Bacteria 7020
244 Ga0207688_10013281 3300025901 Bacteria 4475
245 Ga0207688_10014183 3300025901 Bacteria 4336
246 Ga0207688_10018526 3300025901 Unclassified 3788
247 Ga0207680_10052502 3300025903 Unclassified 2443
248 Ga0207680_10173000 3300025903 Bacteria 1456
249 Ga0207647_10215683 3300025904 Bacteria 1107
250 Ga0207699_10333419 3300025906 Bacteria 1067
251 Ga0207645_10000430 3300025907 Bacteria 34788
252 Ga0207645_10005036 3300025907 Bacteria 9679
253 Ga0207654_10076308 3300025911 Bacteria 2006
254 Ga0207707_10184631 3300025912 Unclassified 1820
255 Ga0207695_10029236 3300025913 Bacteria 6095
256 Ga0207662_10107160 3300025918 Unclassified 1739
257 Ga0207657_10022136 3300025919 Bacteria 5963
258 Ga0207652_10060565 3300025921 Bacteria 3266
259 Ga0207652_10320804 3300025921 Unclassified 1399
260 Ga0207681_10148524 3300025923 Bacteria 1754
261 Ga0207681_10156394 3300025923 Bacteria 1713
262 Ga0207681_10219050 3300025923 Unclassified 1471
263 Ga0207694_10525774 3300025924 Bacteria 992
264 Ga0207650_10005668 3300025925 Bacteria 8525
265 Ga0207650_10124631 3300025925 Bacteria 2010
266 Ga0207650_10369600 3300025925 Bacteria 1183
267 Ga0207659_10045883 3300025926 Unclassified 3083
268 Ga0207659_10061175 3300025926 Bacteria 2713
269 Ga0207659_10070578 3300025926 Bacteria 2548
270 Ga0207659_10114950 3300025926 Bacteria 2052
271 Ga0207700_10477585 3300025928 Bacteria 1101
272 Ga0207644_10024625 3300025931 Bacteria 4133
273 Ga0207644_10405802 3300025931 Bacteria 1114
274 Ga0207690_10127614 3300025932 Bacteria 1857
275 Ga0207706_10007625 3300025933 Bacteria 10005
276 Ga0207706_10022207 3300025933 Bacteria 5695
277 Ga0207706_10025028 3300025933 Bacteria 5351
278 Ga0207706_10416690 3300025933 Unclassified 1164
279 Ga0207686_10286718 3300025934 Unclassified 1218
280 Ga0207670_10063487 3300025936 Bacteria 2527
281 Ga0207670_10447239 3300025936 Bacteria 1041
282 Ga0207669_10078552 3300025937 Bacteria 2103
283 Ga0207669_10201737 3300025937 Unclassified 1444
284 Ga0207704_10131200 3300025938 Bacteria 1736
285 Ga0207704_10233913 3300025938 Bacteria 1368
286 Ga0207665_10238654 3300025939 Unclassified 1339
287 Ga0207691_10014291 3300025940 Bacteria 7572
288 Ga0207691_10015367 3300025940 Bacteria 7283
289 Ga0207691_10144380 3300025940 Bacteria 2096
290 Ga0207711_10109591 3300025941 Bacteria 2454
291 Ga0207711_10127220 3300025941 Bacteria 2281
292 Ga0207711_10132477 3300025941 Bacteria 2236
293 Ga0207711_10156261 3300025941 Bacteria 2061
294 Ga0207711_10169073 3300025941 Bacteria 1983
295 Ga0207689_10052121 3300025942 Bacteria 3372
296 Ga0207661_10010865 3300025944 Bacteria 6570
297 Ga0207661_10061872 3300025944 Bacteria 3026
298 Ga0207679_10008091 3300025945 Bacteria 6687
299 Ga0207679_10009222 3300025945 Bacteria 6308
300 Ga0207679_10048322 3300025945 Unclassified 3097
301 Ga0207679_10432325 3300025945 Bacteria 1164
302 Ga0207667_10170698 3300025949 Unclassified 2235
303 Ga0207651_10012146 3300025960 Bacteria 4858
304 Ga0207651_10188151 3300025960 Unclassified 1644
305 Ga0207712_10016762 3300025961 Bacteria 4750
306 Ga0207712_10031603 3300025961 Bacteria 3567
307 Ga0207712_10147506 3300025961 Bacteria 1813
308 Ga0207668_10065097 3300025972 Bacteria 2579
309 Ga0207658_10468802 3300025986 Bacteria 1117
310 Ga0207677_10078952 3300026023 Bacteria 2352
311 Ga0207677_10397748 3300026023 Bacteria 1168
312 Ga0207703_10133308 3300026035 Bacteria 2148
313 Ga0207703_10251730 3300026035 Bacteria 1592
314 Ga0207703_10726177 3300026035 Bacteria 945
315 Ga0207639_10029513 3300026041 Bacteria 4016
316 Ga0207639_10563915 3300026041 Bacteria 1047
317 Ga0207678_10049195 3300026067 Bacteria 3643
318 Ga0207678_10315828 3300026067 Unclassified 1344
319 Ga0207708_10012458 3300026075 Bacteria 6338
320 Ga0207708_10063453 3300026075 Bacteria 2822
321 Ga0207708_10130708 3300026075 Bacteria 1963
322 Ga0207648_10095236 3300026089 Bacteria 2604
323 Ga0207648_10120706 3300026089 Bacteria 2305
324 Ga0207648_10151636 3300026089 Bacteria 2045
325 Ga0207648_10544646 3300026089 Bacteria 1065
326 Ga0207676_10228456 3300026095 Unclassified 1662
327 Ga0207676_10240670 3300026095 Bacteria 1623
328 Ga0207674_10046430 3300026116 Bacteria 4459
329 Ga0207675_100069645 3300026118 Bacteria 3288
330 Ga0207675_100086424 3300026118 Unclassified 2945
331 Ga0207675_100124426 3300026118 Bacteria 2442
332 Ga0207675_100706249 3300026118 Bacteria 1017
333 Ga0207683_10002327 3300026121 Bacteria 16671
334 Ga0207698_10601478 3300026142 Bacteria 1084
335 Ga0207428_10000022 3300027907 Bacteria 273333
336 Ga0207428_10000558 3300027907 Bacteria 44040
337 Ga0207428_10003310 3300027907 Bacteria 15671
338 Ga0207428_10018122 3300027907 Bacteria 6024
339 Ga0207428_10038135 3300027907 Bacteria 3908
340 Ga0207428_10094848 3300027907 Bacteria 2312
341 Ga0207428_10159261 3300027907 Bacteria 1715
342 Ga0207428_10255692 3300027907 Bacteria 1305
343 Ga0268266_10029590 3300028379 Bacteria 4656
344 Ga0268265_10021994 3300028380 Bacteria 4476
345 Ga0268264_10038454 3300028381 Bacteria 3950
346 Ga0307408_100063264 3300031548 Unclassified 2706
347 Ga0307406_10120283 3300031901 Bacteria 1824
348 Ga0307406_10461594 3300031901 Unclassified 1021
349 Ga0307409_100201763 3300031995 Bacteria 1780
350 Ga0307416_100033897 3300032002 Unclassified 3878
351 Ga0307416_100066921 3300032002 Bacteria 2960
352 Ga0307416_100273209 3300032002 Bacteria 1661
353 Ga0307416_100516832 3300032002 Bacteria 1261
354 Ga0307411_10090961 3300032005 Unclassified 2130
355 Ga0307411_10138002 3300032005 Bacteria 1794
356 Ga0307411_10254881 3300032005 Bacteria 1382
357 Ga0307411_10374822 3300032005 Bacteria 1168
358 Ga0307415_100020687 3300032126 Bacteria 4024
359 Ga0373929_0041615 3300035085 Unclassified 1022
360 Ga0373934_0001306 3300035086 Bacteria 9080
361 Ga0373944_0088642 3300035089 Unclassified 1031
362 Ga0373936_0053294 3300035113 Bacteria 1640
363 Ga0373939_0044510 3300035114 Unclassified 1351
364 Ga0373945_0092412 3300035116 Unclassified 1173
365 Ga0373953_0126053 3300035117 Bacteria 1090
366 Ga0373956_0013319 3300035119 Bacteria 3420
367 Ga0373955_0002757 3300035172 Bacteria 7705
368 Ga0373955_0146397 3300035172 Bacteria 1388
369 Ga0373961_0082657 3300035241 Bacteria 1013
370 Ga0373962_0115585 3300035242 Bacteria 851
371 Ga0373931_0003753 3300035691 Bacteria 6868
372 Ga0373935_0066863 3300035692 Bacteria 2310
373 Ga0373933_0048738 3300035724 Bacteria 2523
374 Ga0373933_0106049 3300035724 Bacteria 1748
375 Ga0373947_0009443 3300035725 Bacteria 5601
376 Ga0373947_0446241 3300035725 Unclassified 876
377 Ga0373937_0000267 3300036401 Bacteria 50314
378 Ga0373937_0054358 3300036401 Bacteria 3674
379 Ga0395905_0441875 3300037471 Bacteria 1198
380 Ga0436365_1772359 3300039437 Bacteria 1431
381 Ga0439431_0008684 3300041997 Bacteria 2287
382 Ga0439449_0079024 3300042007 Bacteria 1213
383 Ga0450900_005746 3300042136 Bacteria 1477
384 Ga0439446_0008862 3300042156 Bacteria 2683
385 Ga0439435_0001853 3300042436 Bacteria 4040
386 Ga0439435_0002783 3300042436 Bacteria 3532
387 Ga0439464_0000294 3300042439 Bacteria 9448
388 Ga0439464_0014044 3300042439 Unclassified 2150
389 Ga0439460_0093517 3300042461 Unclassified 958
390 Ga0450916_017713 3300042530 Bacteria 954
391 Ga0453684_0481229 3300044712 Bacteria 1377
392 Ga0453684_0626216 3300044712 Bacteria 1176
393 Ga0451576_0128086 3300045051 Unclassified 2645
394 Ga0495592_0021770 3300046454 Bacteria 4878
395 Ga0495592_0327122 3300046454 Unclassified 989
396 Ga0495651_0014739 3300046462 Bacteria 6045
397 Ga0495653_0057448 3300046463 Bacteria 2961
398 Ga0495608_0210218 3300046511 Bacteria 1223
399 Ga0495635_0039743 3300046663 Bacteria 3253
400 Ga0495657_0167622 3300046675 Unclassified 1355
401 Ga0495599_0046670 3300046678 Bacteria 2716
402 Ga0495613_0199322 3300046689 Bacteria 1412
403 Ga0495674_0569650 3300047319 Unclassified 900
404 Ga0495684_0084401 3300047471 Bacteria 2409
405 Ga0495684_0272424 3300047471 Unclassified 1224
406 Ga0496101_0234536 3300048904 Bacteria 1427
407 Ga0496104_0028934 3300048907 Bacteria 5138
408 Ga0496104_0387489 3300048907 Bacteria 1310
409 Ga0496105_0010988 3300048908 Bacteria 7134
410 Ga0496105_0022601 3300048908 Bacteria 5094
411 Ga0496105_0170049 3300048908 Unclassified 1787
412 Ga0496106_0215083 3300048909 Bacteria 1532
413 Ga0496106_0424198 3300048909 Bacteria 1069
414 Ga0496107_0384868 3300048910 Bacteria 1043
415 Ga0496108_0004496 3300048911 Bacteria 11232
416 Ga0496109_0004709 3300048912 Bacteria 11388
417 Ga0496109_0267056 3300048912 Bacteria 1612
418 Ga0496109_0490339 3300048912 Bacteria 1160
419 Ga0496110_0000897 3300048913 Bacteria 20981
420 Ga0496110_0158571 3300048913 Bacteria 2051
421 Ga0496110_0235946 3300048913 Bacteria 1664
422 Ga0496111_0009214 3300048914 Bacteria 6576
423 Ga0496112_0001650 3300048915 Bacteria 17325
424 Ga0496112_0009921 3300048915 Bacteria 8613
425 Ga0496112_0163424 3300048915 Bacteria 2192
426 Ga0496113_0085449 3300048916 Bacteria 2424
427 Ga0496114_0001952 3300048917 Bacteria 15679
428 Ga0496114_0046787 3300048917 Bacteria 3595
429 Ga0496114_0083675 3300048917 Bacteria 2700
430 Ga0501032_0015405 3300049569 Bacteria 5396
431 Ga0501033_0002191 3300049570 Bacteria 16869
432 Ga0501033_0009097 3300049570 Bacteria 7662
433 Ga0501033_0016321 3300049570 Bacteria 5624
434 Ga0501034_0006185 3300049571 Bacteria 12896
435 Ga0501034_0045095 3300049571 Bacteria 4456
436 Ga0501036_0000736 3300049572 Bacteria 24203
437 Ga0501036_0024366 3300049572 Bacteria 5100
438 Ga0501036_0037509 3300049572 Bacteria 4100
439 Ga0501036_0040955 3300049572 Unclassified 3920
440 Ga0501036_0066729 3300049572 Bacteria 3044
441 Ga0501037_0001691 3300049573 Bacteria 16037
442 Ga0501037_0011556 3300049573 Bacteria 6498
443 Ga0501037_0074506 3300049573 Bacteria 2466
444 Ga0501037_0123804 3300049573 Bacteria 1857
445 Ga0501038_0008119 3300049574 Bacteria 9662
446 Ga0501038_0013040 3300049574 Bacteria 7580
447 Ga0501038_0079507 3300049574 Bacteria 2765
448 Ga0501038_0093989 3300049574 Bacteria 2507
449 Ga0501038_0178398 3300049574 Bacteria 1715
450 Ga0501039_0011592 3300049575 Bacteria 6712
451 Ga0501039_0050886 3300049575 Bacteria 3205
452 Ga0501039_0099195 3300049575 Bacteria 2273
453 Ga0501039_0143187 3300049575 Bacteria 1878
454 Ga0501039_0500252 3300049575 Bacteria 954
455 Ga0501040_0004631 3300049576 Bacteria 8923
456 Ga0501040_0050092 3300049576 Bacteria 2856
457 Ga0501040_0062551 3300049576 Bacteria 2561
458 Ga0501041_0003049 3300049577 Bacteria 9614
459 Ga0501041_0007112 3300049577 Bacteria 6565
460 Ga0501042_0020436 3300049578 Bacteria 4608
461 Ga0501042_0044228 3300049578 Bacteria 3172
462 Ga0501042_0070485 3300049578 Unclassified 2500
463 Ga0501042_0372009 3300049578 Unclassified 1034
464 Ga0501043_0001882 3300049579 Bacteria 17977
465 Ga0501043_0009877 3300049579 Bacteria 7482
466 Ga0501043_0083900 3300049579 Unclassified 2504
467 Ga0501043_0154152 3300049579 Bacteria 1797
468 Ga0501043_0217309 3300049579 Bacteria 1480
469 Ga0501043_0316426 3300049579 Bacteria 1190
470 Ga0501043_0401617 3300049579 Unclassified 1035
471 Ga0501043_0472735 3300049579 Bacteria 939
472 Ga0501046_0001568 3300049580 Bacteria 21836
473 Ga0501046_0005980 3300049580 Bacteria 10830
474 Ga0501046_0061370 3300049580 Bacteria 2939
475 Ga0501046_0128621 3300049580 Bacteria 1922
476 Ga0501046_0360373 3300049580 Unclassified 1054
477 Ga0501046_0394323 3300049580 Unclassified 1000
478 Ga0501047_0000683 3300049581 Bacteria 35386
479 Ga0501047_0005239 3300049581 Bacteria 12174
480 Ga0501047_0009202 3300049581 Bacteria 9326
481 Ga0501047_0075624 3300049581 Bacteria 3240
482 Ga0501047_0364467 3300049581 Unclassified 1280
483 Ga0501047_0400968 3300049581 Bacteria 1204
484 Ga0501048_0003910 3300049582 Bacteria 11316
485 Ga0501048_0008101 3300049582 Bacteria 7954
486 Ga0501048_0021795 3300049582 Bacteria 4689
487 Ga0501048_0037048 3300049582 Bacteria 3503
488 Ga0501048_0100614 3300049582 Bacteria 2039
489 Ga0501048_0158438 3300049582 Bacteria 1601
490 Ga0501067_0000667 3300049583 Bacteria 18455
491 Ga0501067_0009669 3300049583 Bacteria 5339
492 Ga0501067_0205300 3300049583 Bacteria 1097
493 Ga0501068_0003026 3300049584 Bacteria 8968
494 Ga0501068_0053918 3300049584 Bacteria 2435
495 Ga0501068_0089813 3300049584 Bacteria 1895
496 Ga0501068_0095915 3300049584 Bacteria 1834
497 Ga0501069_0000864 3300049585 Bacteria 14389
498 Ga0501069_0027420 3300049585 Bacteria 3121
499 Ga0501069_0192414 3300049585 Unclassified 1180
500 Ga0501070_0008973 3300049586 Bacteria 8457
501 Ga0501071_0005860 3300049587 Bacteria 7941
502 Ga0501071_0011875 3300049587 Bacteria 5882
503 Ga0501071_0066591 3300049587 Bacteria 2618
504 Ga0501071_0069872 3300049587 Bacteria 2558
505 Ga0501071_0091418 3300049587 Bacteria 2236
506 Ga0501071_0176035 3300049587 Bacteria 1602
507 Ga0501072_0012375 3300049588 Bacteria 6521
508 Ga0501072_0016556 3300049588 Bacteria 5664
509 Ga0501072_0231667 3300049588 Bacteria 1471
510 Ga0501072_0401912 3300049588 Unclassified 1086
511 Ga0501073_0003170 3300049589 Bacteria 12341
512 Ga0501073_0035585 3300049589 Bacteria 3538
513 Ga0501073_0057562 3300049589 Bacteria 2717
514 Ga0501073_0413027 3300049589 Bacteria 932
515 Ga0501074_0000197 3300049590 Bacteria 32785
516 Ga0501074_0009925 3300049590 Bacteria 6918
517 Ga0501074_0023665 3300049590 Unclassified 4464
518 Ga0501074_0184702 3300049590 Bacteria 1487
519 Ga0501075_0027354 3300049591 Bacteria 4203
520 Ga0501075_0036901 3300049591 Bacteria 3648
521 Ga0501075_0085337 3300049591 Bacteria 2392
522 Ga0501075_0186971 3300049591 Unclassified 1580
523 Ga0501075_0209684 3300049591 Bacteria 1486
524 Ga0501076_0005432 3300049592 Bacteria 9165
525 Ga0501076_0016095 3300049592 Bacteria 5662
526 Ga0501076_0023133 3300049592 Bacteria 4786
527 Ga0501076_0070014 3300049592 Bacteria 2804
528 Ga0501076_0250217 3300049592 Bacteria 1450
529 Ga0501077_0111430 3300049593 Bacteria 1734
530 Ga0501077_0223332 3300049593 Bacteria 1197
531 Ga0501079_0004503 3300049741 Bacteria 10336
532 Ga0501079_0009932 3300049741 Bacteria 7224
533 Ga0501079_0076858 3300049741 Bacteria 2582
534 Ga0501079_0214010 3300049741 Bacteria 1505
535 Ga0501080_0019686 3300049742 Bacteria 6250
536 Ga0501080_0058390 3300049742 Bacteria 3592
537 Ga0501080_0180386 3300049742 Bacteria 1943
538 Ga0501081_0002534 3300049743 Bacteria 11514
539 Ga0501081_0035860 3300049743 Bacteria 3378
540 Ga0501081_0093269 3300049743 Bacteria 2120
541 Ga0501081_0101974 3300049743 Unclassified 2029
542 Ga0501081_0188436 3300049743 Bacteria 1493
543 Ga0501083_0013465 3300049744 Bacteria 5716
544 Ga0501083_0037698 3300049744 Bacteria 3290
545 Ga0501083_0081811 3300049744 Bacteria 2140
546 Ga0501035_0001894 3300049822 Bacteria 21036
547 Ga0501035_0033177 3300049822 Bacteria 4695
548 Ga0501035_0036767 3300049822 Bacteria 4436
549 Ga0501035_0213458 3300049822 Bacteria 1650
550 Ga0501044_0000893 3300049823 Bacteria 36023
551 Ga0501044_0008686 3300049823 Bacteria 11119
552 Ga0501044_0105850 3300049823 Bacteria 2825
553 Ga0501044_0224700 3300049823 Bacteria 1827
554 Ga0501045_0012886 3300049824 Bacteria 5893
555 Ga0501045_0018832 3300049824 Bacteria 4914
556 Ga0501045_0045897 3300049824 Unclassified 3181
557 nmdc:mga03n38_164917_c1 3300050490 Bacteria 1124
558 nmdc:mga00v17_120788_c1 3300050491 Bacteria 1668
559 nmdc:mga00v17_68344_c1 3300050491 Bacteria 2196
560 nmdc:mga00v17_72632_c1 3300050491 Unclassified 2135
561 nmdc:mga0yw44_168000_c1 3300050492 Bacteria 1439
562 nmdc:mga0yw44_32281_c1 3300050492 Bacteria 3050
563 nmdc:mga0k408_14329_c1 3300050493 Bacteria 4365
564 nmdc:mga0k408_28460_c1 3300050493 Bacteria 3177
565 nmdc:mga0k408_93623_c1 3300050493 Bacteria 1767
566 nmdc:mga06z11_5856_c1 3300050494 Bacteria 4963
567 nmdc:mga04h51_83202_c1 3300050495 Unclassified 1140
568 nmdc:mga05p37_124923_c1 3300050507 Unclassified 3160
569 nmdc:mga05p37_12748_c1 3300050507 Bacteria 10051
570 nmdc:mga05p37_30361_c1 3300050507 Bacteria 6594
571 nmdc:mga05p37_37_c1 3300050507 Bacteria 110157
572 nmdc:mga05p37_487798_c1 3300050507 Bacteria 1417
573 nmdc:mga05p37_565_c1 3300050507 Bacteria 40748
574 nmdc:mga09592_282253_c1 3300050508 Bacteria 1440
575 nmdc:mga09592_32507_c1 3300050508 Bacteria 4350
576 nmdc:mga09592_370404_c1 3300050508 Bacteria 1239
577 nmdc:mga09592_399308_c1 3300050508 Bacteria 1188
578 nmdc:mga09592_53130_c1 3300050508 Bacteria 3420
579 nmdc:mga09592_5795_c1 3300050508 Bacteria 10075
580 nmdc:mga0qj67_18259_c1 3300050509 Bacteria 5344
581 nmdc:mga0qj67_19242_c1 3300050509 Bacteria 5215
582 nmdc:mga0qj67_24240_c1 3300050509 Bacteria 4676
583 nmdc:mga0qj67_63382_c1 3300050509 Bacteria 2939
584 nmdc:mga06r32_12799_c1 3300050510 Bacteria 7586
585 nmdc:mga06r32_146582_c1 3300050510 Bacteria 2338
586 nmdc:mga06r32_3414_c1 3300050510 Bacteria 14208
587 nmdc:mga06r32_64352_c1 3300050510 Unclassified 3536
588 nmdc:mga06r32_7395_c1 3300050510 Bacteria 9881
589 nmdc:mga08y16_1431_c1 3300050511 Bacteria 23934
590 nmdc:mga08y16_169206_c1 3300050511 Unclassified 2270
591 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
592 nmdc:mga08y16_306604_c1 3300050511 Bacteria 1636
593 nmdc:mga08y16_403_c1 3300050511 Bacteria 39740
594 nmdc:mga08y16_68581_c1 3300050511 Bacteria 3698
595 nmdc:mga08y16_90524_c1 3300050511 Bacteria 3189
596 nmdc:mga08y16_9345_c1 3300050511 Bacteria 10282
597 nmdc:mga0n895_108571_c1 3300050512 Bacteria 2789
598 nmdc:mga0n895_13549_c1 3300050512 Bacteria 7364
599 nmdc:mga0n895_14549_c1 3300050512 Bacteria 7151
600 nmdc:mga0n895_230530_c1 3300050512 Bacteria 1880
601 nmdc:mga0n895_267526_c1 3300050512 Bacteria 1734
602 nmdc:mga0rr50_13975_c1 3300050513 Bacteria 5247
603 nmdc:mga0rr50_161805_c1 3300050513 Unclassified 1817
604 nmdc:mga0rr50_212477_c1 3300050513 Bacteria 1594
605 nmdc:mga0rr50_64382_c1 3300050513 Bacteria 2773
606 nmdc:mga0rr50_80071_c1 3300050513 Bacteria 2518
607 nmdc:mga08x19_157928_c1 3300050514 Bacteria 1539
608 nmdc:mga08x19_467569_c1 3300050514 Bacteria 888
609 nmdc:mga0a205_143116_c1 3300050515 Bacteria 2291
610 nmdc:mga0a205_60121_c1 3300050515 Unclassified 3670
611 nmdc:mga0sz30_92294_c2 3300050516 Unclassified 956
612 Ga0495601_0020582 3300053077 Bacteria 4031
613 Ga0495595_0080757 3300053084 Unclassified 1549
614 Ga0495619_0067928 3300053085 Bacteria 2381
615 Ga0495619_0112646 3300053085 Bacteria 1860
616 Ga0500555_000105 3300053103 Bacteria 40073
617 Ga0500616_0000272 3300053153 Bacteria 77108
618 Ga0500645_000251 3300053730 Bacteria 39552
619 Ga0501084_0007171 3300054114 Bacteria 9181
620 Ga0501084_0008323 3300054114 Bacteria 8560
621 Ga0501084_0020752 3300054114 Bacteria 5480
622 Ga0501084_0139516 3300054114 Bacteria 2041
623 Ga0501084_0158989 3300054114 Bacteria 1906
624 Ga0501084_0387664 3300054114 Bacteria 1180
625 Ga0590074_000304 3300059423 Bacteria 6755
626 Ga0590075_000096 3300059424 Bacteria 22788
627 Ga0590077_000326 3300059426 Bacteria 13503
628 Ga0590077_007262 3300059426 Bacteria 2267
629 Ga0501082_0019093 3300060353 Bacteria 5906
630 Ga0501082_0040112 3300060353 Bacteria 4038
631 Ga0501082_0052224 3300060353 Bacteria 3523
632 Ga0501082_0073041 3300060353 Bacteria 2954
633 Ga0501082_0129871 3300060353 Bacteria 2186
634 Ga0501082_0259917 3300060353 Bacteria 1510
635 Ga0530510_0000198 3300061734 Bacteria 37256
636 Ga0530510_0012625 3300061734 Bacteria 5938
637 Ga0530510_0069602 3300061734 Bacteria 2553
638 Ga0530510_0338342 3300061734 Bacteria 1129
639 Ga0495628_0273413
640 Ga0065704_10189860
641 Ga0065712_10001092
642 Ga0065712_10007450
643 Ga0065712_10110232
644 Ga0065712_10133943
645 Ga0065715_10000243
646 Ga0065715_10009825
647 Ga0065715_10011620
648 Ga0065715_10091646
649 Ga0065715_10099119
650 Ga0065715_10108954
651 Ga0065707_10003696
652 Ga0070658_10079327
653 Ga0070676_10040109
654 Ga0070676_10049418
655 Ga0070683_100000702
656 Ga0070670_100004852
657 Ga0070670_100043972
658 Ga0070670_100148450
659 Ga0070677_10029409
660 Ga0068869_100098191
661 Ga0070666_10034847
662 Ga0070666_10059604
663 Ga0070666_10115315
664 Ga0070680_100120764
665 Ga0070682_100056876
666 Ga0070682_100220709
667 Ga0068868_100136537
668 Ga0070660_100047354
669 Ga0070687_100073178
670 Ga0070687_100122430
671 Ga0070661_100078044
672 Ga0070668_100063659
673 Ga0070668_100064576
674 Ga0070668_100069375
675 Ga0070668_100221661
676 Ga0070669_100141307
677 Ga0070669_100192705
678 Ga0070669_100358120
679 Ga0070675_100044603
680 Ga0070675_100079333
681 Ga0070675_100193280
682 Ga0070675_100421234
683 Ga0070671_100035887
684 Ga0070671_100038680
685 Ga0070671_100044186
686 Ga0070671_100060725
687 Ga0070674_100017414
688 Ga0070674_100105785
689 Ga0070674_100226578
690 Ga0070673_100002817
691 Ga0070673_100143069
692 Ga0070688_100035431
693 Ga0070688_100143658
694 Ga0070688_100157525
695 Ga0070659_100092042
696 Ga0070659_100245585
697 Ga0070667_100058116
698 Ga0070667_100081409
699 Ga0070667_100093549
700 Ga0070667_100700800
701 Ga0070709_10243430
702 Ga0070701_10031600
703 Ga0070701_10159767
704 Ga0070705_100229952
705 Ga0070705_100344240
706 Ga0070700_100038341
707 Ga0070694_100028984
708 Ga0070694_100080381
709 Ga0070694_100352820
710 Ga0070663_100032064
711 Ga0070678_100180956
712 Ga0070678_100235874
713 Ga0070678_100401559
714 Ga0070678_100583150
715 Ga0070662_100149445
716 Ga0070681_10081187
717 Ga0070681_10406667
718 Ga0068867_100080024
719 Ga0068867_100081710
720 Ga0070685_10014580
721 Ga0070706_100238829
722 Ga0070679_100108609
723 Ga0070684_100000068
724 Ga0070684_100020170
725 Ga0068853_100160473
726 Ga0070672_100019288
727 Ga0070686_100118848
728 Ga0070686_100149419
729 Ga0070695_100194281
730 Ga0070696_100022190
731 Ga0070696_100410626
732 Ga0070693_100035065
733 Ga0070665_100197036
734 Ga0070665_100212153
735 Ga0070704_100049883
736 Ga0070704_100071073
737 Ga0068855_100270507
738 Ga0070664_100000408
739 Ga0070664_100098617
740 Ga0070664_100105419
741 Ga0068857_100017341
742 Ga0068857_100343062
743 Ga0068856_100011122
744 Ga0068852_100127803
745 Ga0068859_100017581
746 Ga0068864_100129638
747 Ga0068861_100030653
748 Ga0068861_100124823
749 Ga0068861_100254637
750 Ga0068861_100272357
751 Ga0068861_100709761
752 Ga0068870_10309386
753 Ga0068860_100113978
754 Ga0068862_100012472
755 Ga0081455_10062511
756 Ga0081455_10210783
757 Ga0070717_10317202
758 Ga0075365_10001207
759 Ga0075363_100046976
760 Ga0075364_10011061
761 Ga0075364_10043951
762 Ga0075364_10049492
763 Ga0075364_10114738
764 Ga0070716_100049593
765 Ga0075367_10014952
766 Ga0075367_10136293
767 Ga0075367_10224629
768 Ga0075366_10034638
769 Ga0075366_10039830
770 Ga0097621_100050813
771 Ga0097621_100160036
772 Ga0097621_100181576
773 Ga0075370_10036700
774 Ga0068871_100042411
775 Ga0068871_100161780
776 Ga0075428_100000007
777 Ga0075428_100000080
778 Ga0075428_100008548
779 Ga0075428_100765682
780 Ga0075430_100001296
781 Ga0075430_100008205
782 Ga0075430_100028567
783 Ga0075431_100002515
784 Ga0075431_100013703
785 Ga0075431_100022391
786 Ga0075431_100261494
787 Ga0075431_100444761
788 Ga0075431_100612342
789 Ga0075431_100893686
790 Ga0075433_10012959
791 Ga0075433_10045659
792 Ga0075433_10273605
793 Ga0075434_100003574
794 Ga0075434_100003829
795 Ga0075434_100007745
796 Ga0075434_100009667
797 Ga0075434_100041345
798 Ga0075434_100515682
799 Ga0075429_100000156
800 Ga0075429_100001098
801 Ga0075429_100223549
802 Ga0068865_100036601
803 Ga0068865_100501801
804 Ga0075436_100179763
805 Ga0075436_100393737
806 Ga0097620_100017581
807 Ga0075435_100058310
808 Ga0075435_100085851
809 Ga0075435_100121368
810 Ga0075435_100142021
811 Ga0075435_100197806
812 Ga0111539_10000126
813 Ga0111539_10000181
814 Ga0111539_10000209
815 Ga0111539_10002571
816 Ga0111539_10003059
817 Ga0111539_10003739
818 Ga0111539_10007276
819 Ga0105245_10057076
820 Ga0114129_10000077
821 Ga0114129_10000113
822 Ga0114129_10002524
823 Ga0114129_10005533
824 Ga0114129_10019080
825 Ga0114129_10039874
826 Ga0114129_10043772
827 Ga0114129_10760291
828 Ga0114129_10784374
829 Ga0105243_10095585
830 Ga0105243_10096577
831 Ga0105241_10031061
832 Ga0105242_10059810
833 Ga0105242_10093851
834 Ga0105242_10553789
835 Ga0105248_10022766
836 Ga0105248_10046910
837 Ga0105248_10054018
838 Ga0105248_10072452
839 Ga0105248_10229941
840 Ga0105248_11046508
841 Ga0105237_10103385
842 Ga0105238_10508973
843 Ga0105249_10001092
844 Ga0105249_10041046
845 Ga0105249_10162556
846 Ga0105249_10416074
847 Ga0105239_10338042
848 Ga0105239_10415450
849 Ga0105239_10454326
850 Ga0157370_10189133
851 Ga0157374_10130886
852 Ga0157378_10147044
853 Ga0163162_10040065
854 Ga0163162_10232794
855 Ga0157372_10184592
856 Ga0157372_10653834
857 Ga0157375_10335410
858 Ga0157375_10560977
859 Ga0163163_10000047
860 Ga0157380_10074748
861 Ga0157380_10608714
862 Ga0157377_10190131
863 Ga0157377_10244063
864 Ga0157379_10272523
865 Ga0157379_10491086
866 Ga0157376_10032880
867 Ga0157376_10075513
868 Ga0157376_10210373
869 Ga0163161_10040200
870 Ga0206356_11092933
871 Ga0207697_10006334
872 Ga0207697_10009342
873 Ga0207697_10043426
874 Ga0207656_10177172
875 Ga0207682_10029582
876 Ga0207682_10031951
877 Ga0207642_10038716
878 Ga0207642_10048161
879 Ga0207642_10097322
880 Ga0207710_10035482
881 Ga0207688_10005276
882 Ga0207688_10013281
883 Ga0207688_10014183
884 Ga0207688_10018526
885 Ga0207680_10052502
886 Ga0207680_10173000
887 Ga0207647_10215683
888 Ga0207699_10333419
889 Ga0207645_10000430
890 Ga0207645_10005036
891 Ga0207654_10076308
892 Ga0207707_10184631
893 Ga0207695_10029236
894 Ga0207662_10107160
895 Ga0207657_10022136
896 Ga0207652_10060565
897 Ga0207652_10320804
898 Ga0207681_10148524
899 Ga0207681_10156394
900 Ga0207681_10219050
901 Ga0207694_10525774
902 Ga0207650_10005668
903 Ga0207650_10124631
904 Ga0207650_10369600
905 Ga0207659_10045883
906 Ga0207659_10061175
907 Ga0207659_10070578
908 Ga0207659_10114950
909 Ga0207700_10477585
910 Ga0207644_10024625
911 Ga0207644_10405802
912 Ga0207690_10127614
913 Ga0207706_10007625
914 Ga0207706_10022207
915 Ga0207706_10025028
916 Ga0207706_10416690
917 Ga0207686_10286718
918 Ga0207670_10063487
919 Ga0207670_10447239
920 Ga0207669_10078552
921 Ga0207669_10201737
922 Ga0207704_10131200
923 Ga0207704_10233913
924 Ga0207665_10238654
925 Ga0207691_10014291
926 Ga0207691_10015367
927 Ga0207691_10144380
928 Ga0207711_10109591
929 Ga0207711_10127220
930 Ga0207711_10132477
931 Ga0207711_10156261
932 Ga0207711_10169073
933 Ga0207689_10052121
934 Ga0207661_10010865
935 Ga0207661_10061872
936 Ga0207679_10008091
937 Ga0207679_10009222
938 Ga0207679_10048322
939 Ga0207679_10432325
940 Ga0207667_10170698
941 Ga0207651_10012146
942 Ga0207651_10188151
943 Ga0207712_10016762
944 Ga0207712_10031603
945 Ga0207712_10147506
946 Ga0207668_10065097
947 Ga0207658_10468802
948 Ga0207677_10078952
949 Ga0207677_10397748
950 Ga0207703_10133308
951 Ga0207703_10251730
952 Ga0207703_10726177
953 Ga0207639_10029513
954 Ga0207639_10563915
955 Ga0207678_10049195
956 Ga0207678_10315828
957 Ga0207708_10012458
958 Ga0207708_10063453
959 Ga0207708_10130708
960 Ga0207648_10095236
961 Ga0207648_10120706
962 Ga0207648_10151636
963 Ga0207648_10544646
964 Ga0207676_10228456
965 Ga0207676_10240670
966 Ga0207674_10046430
967 Ga0207675_100069645
968 Ga0207675_100086424
969 Ga0207675_100124426
970 Ga0207675_100706249
971 Ga0207683_10002327
972 Ga0207698_10601478
973 Ga0207428_10000022
974 Ga0207428_10000558
975 Ga0207428_10003310
976 Ga0207428_10018122
977 Ga0207428_10038135
978 Ga0207428_10094848
979 Ga0207428_10159261
980 Ga0207428_10255692
981 Ga0268266_10029590
982 Ga0268265_10021994
983 Ga0268264_10038454
984 Ga0307408_100063264
985 Ga0307406_10120283
986 Ga0307406_10461594
987 Ga0307409_100201763
988 Ga0307416_100033897
989 Ga0307416_100066921
990 Ga0307416_100273209
991 Ga0307416_100516832
992 Ga0307411_10090961
993 Ga0307411_10138002
994 Ga0307411_10254881
995 Ga0307411_10374822
996 Ga0307415_100020687
997 Ga0373929_0041615
998 Ga0373934_0001306
999 Ga0373944_0088642
1000 Ga0373936_0053294
1001 Ga0373939_0044510
1002 Ga0373945_0092412
1003 Ga0373953_0126053
1004 Ga0373956_0013319
1005 Ga0373955_0002757
1006 Ga0373955_0146397
1007 Ga0373961_0082657
1008 Ga0373962_0115585
1009 Ga0373931_0003753
1010 Ga0373935_0066863
1011 Ga0373933_0048738
1012 Ga0373933_0106049
1013 Ga0373947_0009443
1014 Ga0373947_0446241
1015 Ga0373937_0000267
1016 Ga0373937_0054358
1017 Ga0395905_0441875
1018 Ga0436365_1772359
1019 Ga0439431_0008684
1020 Ga0439449_0079024
1021 Ga0450900_005746
1022 Ga0439446_0008862
1023 Ga0439435_0001853
1024 Ga0439435_0002783
1025 Ga0439464_0000294
1026 Ga0439464_0014044
1027 Ga0439460_0093517
1028 Ga0450916_017713
1029 Ga0453684_0481229
1030 Ga0453684_0626216
1031 Ga0451576_0128086
1032 Ga0495592_0021770
1033 Ga0495592_0327122
1034 Ga0495651_0014739
1035 Ga0495653_0057448
1036 Ga0495608_0210218
1037 Ga0495635_0039743
1038 Ga0495657_0167622
1039 Ga0495599_0046670
1040 Ga0495613_0199322
1041 Ga0495674_0569650
1042 Ga0495684_0084401
1043 Ga0495684_0272424
1044 Ga0496101_0234536
1045 Ga0496104_0028934
1046 Ga0496104_0387489
1047 Ga0496105_0010988
1048 Ga0496105_0022601
1049 Ga0496105_0170049
1050 Ga0496106_0215083
1051 Ga0496106_0424198
1052 Ga0496107_0384868
1053 Ga0496108_0004496
1054 Ga0496109_0004709
1055 Ga0496109_0267056
1056 Ga0496109_0490339
1057 Ga0496110_0000897
1058 Ga0496110_0158571
1059 Ga0496110_0235946
1060 Ga0496111_0009214
1061 Ga0496112_0001650
1062 Ga0496112_0009921
1063 Ga0496112_0163424
1064 Ga0496113_0085449
1065 Ga0496114_0001952
1066 Ga0496114_0046787
1067 Ga0496114_0083675
1068 Ga0501032_0015405
1069 Ga0501033_0002191
1070 Ga0501033_0009097
1071 Ga0501033_0016321
1072 Ga0501034_0006185
1073 Ga0501034_0045095
1074 Ga0501036_0000736
1075 Ga0501036_0024366
1076 Ga0501036_0037509
1077 Ga0501036_0040955
1078 Ga0501036_0066729
1079 Ga0501037_0001691
1080 Ga0501037_0011556
1081 Ga0501037_0074506
1082 Ga0501037_0123804
1083 Ga0501038_0008119
1084 Ga0501038_0013040
1085 Ga0501038_0079507
1086 Ga0501038_0093989
1087 Ga0501038_0178398
1088 Ga0501039_0011592
1089 Ga0501039_0050886
1090 Ga0501039_0099195
1091 Ga0501039_0143187
1092 Ga0501039_0500252
1093 Ga0501040_0004631
1094 Ga0501040_0050092
1095 Ga0501040_0062551
1096 Ga0501041_0003049
1097 Ga0501041_0007112
1098 Ga0501042_0020436
1099 Ga0501042_0044228
1100 Ga0501042_0070485
1101 Ga0501042_0372009
1102 Ga0501043_0001882
1103 Ga0501043_0009877
1104 Ga0501043_0083900
1105 Ga0501043_0154152
1106 Ga0501043_0217309
1107 Ga0501043_0316426
1108 Ga0501043_0401617
1109 Ga0501043_0472735
1110 Ga0501046_0001568
1111 Ga0501046_0005980
1112 Ga0501046_0061370
1113 Ga0501046_0128621
1114 Ga0501046_0360373
1115 Ga0501046_0394323
1116 Ga0501047_0000683
1117 Ga0501047_0005239
1118 Ga0501047_0009202
1119 Ga0501047_0075624
1120 Ga0501047_0364467
1121 Ga0501047_0400968
1122 Ga0501048_0003910
1123 Ga0501048_0008101
1124 Ga0501048_0021795
1125 Ga0501048_0037048
1126 Ga0501048_0100614
1127 Ga0501048_0158438
1128 Ga0501067_0000667
1129 Ga0501067_0009669
1130 Ga0501067_0205300
1131 Ga0501068_0003026
1132 Ga0501068_0053918
1133 Ga0501068_0089813
1134 Ga0501068_0095915
1135 Ga0501069_0000864
1136 Ga0501069_0027420
1137 Ga0501069_0192414
1138 Ga0501070_0008973
1139 Ga0501071_0005860
1140 Ga0501071_0011875
1141 Ga0501071_0066591
1142 Ga0501071_0069872
1143 Ga0501071_0091418
1144 Ga0501071_0176035
1145 Ga0501072_0012375
1146 Ga0501072_0016556
1147 Ga0501072_0231667
1148 Ga0501072_0401912
1149 Ga0501073_0003170
1150 Ga0501073_0035585
1151 Ga0501073_0057562
1152 Ga0501073_0413027
1153 Ga0501074_0000197
1154 Ga0501074_0009925
1155 Ga0501074_0023665
1156 Ga0501074_0184702
1157 Ga0501075_0027354
1158 Ga0501075_0036901
1159 Ga0501075_0085337
1160 Ga0501075_0186971
1161 Ga0501075_0209684
1162 Ga0501076_0005432
1163 Ga0501076_0016095
1164 Ga0501076_0023133
1165 Ga0501076_0070014
1166 Ga0501076_0250217
1167 Ga0501077_0111430
1168 Ga0501077_0223332
1169 Ga0501079_0004503
1170 Ga0501079_0009932
1171 Ga0501079_0076858
1172 Ga0501079_0214010
1173 Ga0501080_0019686
1174 Ga0501080_0058390
1175 Ga0501080_0180386
1176 Ga0501081_0002534
1177 Ga0501081_0035860
1178 Ga0501081_0093269
1179 Ga0501081_0101974
1180 Ga0501081_0188436
1181 Ga0501083_0013465
1182 Ga0501083_0037698
1183 Ga0501083_0081811
1184 Ga0501035_0001894
1185 Ga0501035_0033177
1186 Ga0501035_0036767
1187 Ga0501035_0213458
1188 Ga0501044_0000893
1189 Ga0501044_0008686
1190 Ga0501044_0105850
1191 Ga0501044_0224700
1192 Ga0501045_0012886
1193 Ga0501045_0018832
1194 Ga0501045_0045897
1195 nmdc:mga03n38_164917_c1
1196 nmdc:mga00v17_120788_c1
1197 nmdc:mga00v17_68344_c1
1198 nmdc:mga00v17_72632_c1
1199 nmdc:mga0yw44_168000_c1
1200 nmdc:mga0yw44_32281_c1
1201 nmdc:mga0k408_14329_c1
1202 nmdc:mga0k408_28460_c1
1203 nmdc:mga0k408_93623_c1
1204 nmdc:mga06z11_5856_c1
1205 nmdc:mga04h51_83202_c1
1206 nmdc:mga05p37_124923_c1
1207 nmdc:mga05p37_12748_c1
1208 nmdc:mga05p37_30361_c1
1209 nmdc:mga05p37_37_c1
1210 nmdc:mga05p37_487798_c1
1211 nmdc:mga05p37_565_c1
1212 nmdc:mga09592_282253_c1
1213 nmdc:mga09592_32507_c1
1214 nmdc:mga09592_370404_c1
1215 nmdc:mga09592_399308_c1
1216 nmdc:mga09592_53130_c1
1217 nmdc:mga09592_5795_c1
1218 nmdc:mga0qj67_18259_c1
1219 nmdc:mga0qj67_19242_c1
1220 nmdc:mga0qj67_24240_c1
1221 nmdc:mga0qj67_63382_c1
1222 nmdc:mga06r32_12799_c1
1223 nmdc:mga06r32_146582_c1
1224 nmdc:mga06r32_3414_c1
1225 nmdc:mga06r32_64352_c1
1226 nmdc:mga06r32_7395_c1
1227 nmdc:mga08y16_1431_c1
1228 nmdc:mga08y16_169206_c1
1229 nmdc:mga08y16_21_c1
1230 nmdc:mga08y16_306604_c1
1231 nmdc:mga08y16_403_c1
1232 nmdc:mga08y16_68581_c1
1233 nmdc:mga08y16_90524_c1
1234 nmdc:mga08y16_9345_c1
1235 nmdc:mga0n895_108571_c1
1236 nmdc:mga0n895_13549_c1
1237 nmdc:mga0n895_14549_c1
1238 nmdc:mga0n895_230530_c1
1239 nmdc:mga0n895_267526_c1
1240 nmdc:mga0rr50_13975_c1
1241 nmdc:mga0rr50_161805_c1
1242 nmdc:mga0rr50_212477_c1
1243 nmdc:mga0rr50_64382_c1
1244 nmdc:mga0rr50_80071_c1
1245 nmdc:mga08x19_157928_c1
1246 nmdc:mga08x19_467569_c1
1247 nmdc:mga0a205_143116_c1
1248 nmdc:mga0a205_60121_c1
1249 nmdc:mga0sz30_92294_c2
1250 Ga0495601_0020582
1251 Ga0495595_0080757
1252 Ga0495619_0067928
1253 Ga0495619_0112646
1254 Ga0500555_000105
1255 Ga0500616_0000272
1256 Ga0500645_000251
1257 Ga0501084_0007171
1258 Ga0501084_0008323
1259 Ga0501084_0020752
1260 Ga0501084_0139516
1261 Ga0501084_0158989
1262 Ga0501084_0387664
1263 Ga0590074_000304
1264 Ga0590075_000096
1265 Ga0590077_000326
1266 Ga0590077_007262
1267 Ga0501082_0019093
1268 Ga0501082_0040112
1269 Ga0501082_0052224
1270 Ga0501082_0073041
1271 Ga0501082_0129871
1272 Ga0501082_0259917
1273 Ga0530510_0000198
1274 Ga0530510_0012625
1275 Ga0530510_0069602
1276 Ga0530510_0338342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

7

119

0.86

PF00581

Rhodanese

Rhodanese-like domain

146

259

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uar-assembly1.cif.gz_A crystal structure of rhodanese from thermus thermophilus hb8 0.8819 6 275
1h4m-assembly1.cif.gz_X sulfurtransferase from azotobacter vinelandii in complex with phosphate 0.8818 9 272
3hwi-assembly2.cif.gz_B crystal structure of probable thiosulfate sulfurtransferase cysa2 (rhodanese-like protein) from mycobacterium tuberculosis 0.8809 7 274
3olh-assembly1.cif.gz_A human 3-mercaptopyruvate sulfurtransferase 0.8808 9 262
3hwi-assembly2.cif.gz_B crystal structure of probable thiosulfate sulfurtransferase cysa2 (rhodanese-like protein) from mycobacterium tuberculosis 0.8685 7 274
ID Description Score Start End Superfamily
1h4mX02 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9437 147 271 3.40.250.10
af_Q9USJ1_158_295_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9322 145 267 3.40.250.10
af_P9WHF5_161_279_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9298 149 269 3.40.250.10
1h4mX02 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9293 147 271 3.40.250.10
af_Q24JL3_210_336_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9283 147 269 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A521SJA2-F1-model_v4 Sulfurtransferase 0.9896 6 273 GO:0004792
AF-A0A2V8MM35-F1-model_v4 Rhodanese domain-containing protein 0.9875 5 274 GO:0004792
AF-A0A523K416-F1-model_v4 Sulfurtransferase 0.9841 30 275 GO:0004792
AF-V6AVX9-F1-model_v4 Rhodanese domain protein 0.9832 10 271 GO:0004792
AF-A0A537GAP3-F1-model_v4 Sulfurtransferase 0.9824 10 271 GO:0016740

Map