F471525

General Info

Members Datasets Scaffolds Average Seq Length
638 290 630 210

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100452026|Ga0307409_1004520262
Length 232
Sequence MSVQNRPSPRLPSASRRSPASGRGYAVKECFLTLQGEGMQSGSRAVFLRFAGCNLWSGREQDRASAQCTFCDTDFVGTDGEGGGKFGDPEELAAHVERLWGEGREDRLVVVTGGEPMLQLDEALVEAMHARGFRVAVESNGTLPATAGIDWLCISPKAGTAVVQRSGNELKLVWPQAGIDPADLEGWAFDHFLVQPMDCEQRAEALDAAIALAMERPKWRLSLQAHKVIGLP

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
4 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
5 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
6 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
7 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
8 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
193 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
198 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
199 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
200 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
201 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
202 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
286 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
287 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
288 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
289 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0.16
Rhizoplane 2.66
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008549 3300001979 Bacteria 4071
2 JGI24740J21852_10011893 3300001979 Bacteria 3300
3 JGI24737J22298_10000139 3300001990 Bacteria 22332
4 JGI24737J22298_10006334 3300001990 Bacteria 4047
5 JGI24737J22298_10020485 3300001990 Bacteria 2111
6 JGI24735J21928_10003189 3300002067 Bacteria 5607
7 JGI24738J21930_10003779 3300002075 Bacteria 3784
8 JGI24738J21930_10006669 3300002075 Bacteria 2686
9 Ga0055530_10000332 3300003791 Bacteria 42713
10 Ga0055531_10000384 3300003794 Bacteria 42713
11 Ga0070658_10000165 3300005327 Bacteria 57646
12 Ga0070658_10093280 3300005327 Bacteria 2483
13 Ga0070658_10125223 3300005327 Bacteria 2138
14 Ga0070676_10149520 3300005328 Bacteria 1494
15 Ga0070683_100003336 3300005329 Bacteria 12986
16 Ga0070683_100155467 3300005329 Bacteria 2169
17 Ga0070690_100004009 3300005330 Bacteria 8147
18 Ga0070670_100101501 3300005331 Bacteria 2477
19 Ga0070670_100273816 3300005331 Bacteria 1473
20 Ga0068869_100004289 3300005334 Bacteria 8852
21 Ga0070666_10007235 3300005335 Bacteria 6841
22 Ga0070666_10008069 3300005335 Bacteria 6518
23 Ga0070680_100020619 3300005336 Bacteria 5233
24 Ga0068868_100003061 3300005338 Bacteria 11644
25 Ga0068868_100007425 3300005338 Bacteria 7805
26 Ga0068868_100011768 3300005338 Bacteria 6377
27 Ga0068868_100262267 3300005338 Bacteria 1457
28 Ga0070660_100000009 3300005339 Bacteria 145691
29 Ga0070660_100015323 3300005339 Bacteria 5533
30 Ga0070660_100024872 3300005339 Bacteria 4447
31 Ga0070660_100036443 3300005339 Bacteria 3726
32 Ga0070660_100241976 3300005339 Bacteria 1470
33 Ga0070689_100087959 3300005340 Bacteria 2445
34 Ga0070689_100361944 3300005340 Bacteria 1219
35 Ga0070689_100377209 3300005340 Bacteria 1195
36 Ga0070687_100231287 3300005343 Bacteria 1138
37 Ga0070661_100004664 3300005344 Bacteria 9443
38 Ga0070661_100025955 3300005344 Bacteria 4210
39 Ga0070661_100059404 3300005344 Bacteria 2804
40 Ga0070668_100049993 3300005347 Bacteria 3218
41 Ga0070669_100025171 3300005353 Bacteria 4273
42 Ga0070675_100044023 3300005354 Bacteria 3650
43 Ga0070671_100023503 3300005355 Bacteria 5045
44 Ga0070671_100079096 3300005355 Bacteria 2748
45 Ga0070671_100099485 3300005355 Bacteria 2439
46 Ga0070671_100182543 3300005355 Bacteria 1776
47 Ga0070671_100248541 3300005355 Bacteria 1511
48 Ga0070673_100000446 3300005364 Bacteria 21860
49 Ga0070673_100001436 3300005364 Bacteria 13933
50 Ga0070673_100146726 3300005364 Bacteria 1995
51 Ga0070673_100657816 3300005364 Bacteria 959
52 Ga0070688_100011769 3300005365 Bacteria 4877
53 Ga0070659_100000048 3300005366 Bacteria 98245
54 Ga0070659_100001857 3300005366 Bacteria 15173
55 Ga0070659_100019853 3300005366 Bacteria 5100
56 Ga0070659_100022668 3300005366 Bacteria 4795
57 Ga0070659_100035024 3300005366 Bacteria 3907
58 Ga0070659_100155484 3300005366 Bacteria 1867
59 Ga0070667_100006690 3300005367 Bacteria 9578
60 Ga0070667_100007807 3300005367 Bacteria 8872
61 Ga0070667_100033661 3300005367 Bacteria 4286
62 Ga0070709_10826795 3300005434 Bacteria 728
63 Ga0070714_100019356 3300005435 Bacteria 5543
64 Ga0070714_100251389 3300005435 Bacteria 1634
65 Ga0070714_100300429 3300005435 Bacteria 1496
66 Ga0070714_100491506 3300005435 Bacteria 1169
67 Ga0070713_100352346 3300005436 Bacteria 1366
68 Ga0070713_100381073 3300005436 Bacteria 1314
69 Ga0070701_10112587 3300005438 Bacteria 1523
70 Ga0070663_100000206 3300005455 Bacteria 29502
71 Ga0070662_100001541 3300005457 Bacteria 14213
72 Ga0070662_100140661 3300005457 Bacteria 1870
73 Ga0070662_100156438 3300005457 Bacteria 1779
74 Ga0070662_100460721 3300005457 Bacteria 1056
75 Ga0070662_100659604 3300005457 Bacteria 883
76 Ga0070681_10029148 3300005458 Bacteria 5541
77 Ga0068867_100000783 3300005459 Bacteria 21489
78 Ga0068867_100086353 3300005459 Bacteria 2374
79 Ga0070685_10388674 3300005466 Bacteria 963
80 Ga0070679_100024260 3300005530 Bacteria 5943
81 Ga0070679_100565983 3300005530 Bacteria 1080
82 Ga0070679_100703979 3300005530 Bacteria 953
83 Ga0070684_100024921 3300005535 Bacteria 5022
84 Ga0068853_100000128 3300005539 Bacteria 51089
85 Ga0068853_100001812 3300005539 Bacteria 15714
86 Ga0068853_100008324 3300005539 Bacteria 8330
87 Ga0068853_100068180 3300005539 Bacteria 3092
88 Ga0068853_100068562 3300005539 Bacteria 3084
89 Ga0070672_100006530 3300005543 Bacteria 7841
90 Ga0070672_100032899 3300005543 Bacteria 3920
91 Ga0070686_100033475 3300005544 Bacteria 3158
92 Ga0070696_100312398 3300005546 Bacteria 1207
93 Ga0070693_100000442 3300005547 Bacteria 18676
94 Ga0070693_100001354 3300005547 Bacteria 11024
95 Ga0070665_100007376 3300005548 Bacteria 11185
96 Ga0070665_100201176 3300005548 Bacteria 1992
97 Ga0068855_100001099 3300005563 Bacteria 33610
98 Ga0068855_100013196 3300005563 Bacteria 9966
99 Ga0068855_100058901 3300005563 Bacteria 4496
100 Ga0070664_100000103 3300005564 Bacteria 54853
101 Ga0070664_100012104 3300005564 Bacteria 7008
102 Ga0070664_100059891 3300005564 Bacteria 3240
103 Ga0070664_100081093 3300005564 Bacteria 2795
104 Ga0070664_100195508 3300005564 Bacteria 1803
105 Ga0070664_100459666 3300005564 Bacteria 1169
106 Ga0068857_100016760 3300005577 Bacteria 6419
107 Ga0068857_100069677 3300005577 Bacteria 3132
108 Ga0068857_100104155 3300005577 Bacteria 2547
109 Ga0068857_100263208 3300005577 Bacteria 1583
110 Ga0068854_100054864 3300005578 Bacteria 2868
111 Ga0068854_100073006 3300005578 Bacteria 2513
112 Ga0068854_100088971 3300005578 Bacteria 2294
113 Ga0068856_100000628 3300005614 Bacteria 38462
114 Ga0068856_100060163 3300005614 Bacteria 3753
115 Ga0070702_100163265 3300005615 Bacteria 1442
116 Ga0070702_100386252 3300005615 Bacteria 997
117 Ga0068852_100003881 3300005616 Bacteria 10506
118 Ga0068852_100069152 3300005616 Bacteria 3093
119 Ga0068852_100104438 3300005616 Bacteria 2564
120 Ga0068852_100191862 3300005616 Bacteria 1928
121 Ga0068852_100280322 3300005616 Bacteria 1606
122 Ga0068852_100980769 3300005616 Bacteria 863
123 Ga0068859_100010266 3300005617 Bacteria 9425
124 Ga0068859_100139046 3300005617 Bacteria 2502
125 Ga0068859_100515567 3300005617 Bacteria 1291
126 Ga0068864_100020762 3300005618 Bacteria 5497
127 Ga0068864_100045926 3300005618 Bacteria 3747
128 Ga0068864_100174079 3300005618 Bacteria 1964
129 Ga0068866_10050559 3300005718 Bacteria 2111
130 Ga0068851_10016573 3300005834 Bacteria 3528
131 Ga0068851_10084511 3300005834 Bacteria 1662
132 Ga0068851_10164347 3300005834 Bacteria 1221
133 Ga0068863_100009975 3300005841 Bacteria 9246
134 Ga0068863_100267292 3300005841 Bacteria 1655
135 Ga0068858_100004213 3300005842 Bacteria 14161
136 Ga0068858_100008278 3300005842 Bacteria 9997
137 Ga0068858_100016585 3300005842 Bacteria 6918
138 Ga0068860_100038414 3300005843 Bacteria 4579
139 Ga0070712_100026912 3300006175 Bacteria 3837
140 Ga0070712_100035420 3300006175 Bacteria 3388
141 Ga0075367_10004493 3300006178 Bacteria 6818
142 Ga0097621_100016835 3300006237 Bacteria 5539
143 Ga0097621_100026258 3300006237 Bacteria 4566
144 Ga0097621_100034264 3300006237 Bacteria 4049
145 Ga0097621_100605896 3300006237 Bacteria 1001
146 Ga0068871_100181331 3300006358 Bacteria 1810
147 Ga0068871_100192279 3300006358 Bacteria 1758
148 Ga0068871_100507786 3300006358 Bacteria 1087
149 Ga0068865_100002068 3300006881 Bacteria 11853
150 Ga0097620_100003214 3300006931 Bacteria 16634
151 Ga0097620_100010266 3300006931 Bacteria 9425
152 Ga0097620_100139031 3300006931 Bacteria 2502
153 Ga0097620_100515546 3300006931 Bacteria 1291
154 Ga0079104_1015083 3300006946 Bacteria 2304
155 Ga0075435_100723981 3300007076 Bacteria 865
156 Ga0105240_10086142 3300009093 Bacteria 3847
157 Ga0105240_10671053 3300009093 Bacteria 1134
158 Ga0105245_10001091 3300009098 Bacteria 24614
159 Ga0105245_10042780 3300009098 Bacteria 4040
160 Ga0105245_10527559 3300009098 Bacteria 1200
161 Ga0105243_10075398 3300009148 Bacteria 2738
162 Ga0105241_10015776 3300009174 Bacteria 5534
163 Ga0105242_10008858 3300009176 Bacteria 7724
164 Ga0105242_10025177 3300009176 Bacteria 4705
165 Ga0105248_10000297 3300009177 Bacteria 59111
166 Ga0105248_10000414 3300009177 Bacteria 49092
167 Ga0105248_10006323 3300009177 Bacteria 12999
168 Ga0105248_10033619 3300009177 Bacteria 5728
169 Ga0105248_10075926 3300009177 Bacteria 3777
170 Ga0105248_10096794 3300009177 Bacteria 3325
171 Ga0105248_10180354 3300009177 Bacteria 2380
172 Ga0105248_10182740 3300009177 Bacteria 2363
173 Ga0105248_10714779 3300009177 Bacteria 1130
174 Ga0105237_10082574 3300009545 Bacteria 3204
175 Ga0105237_10337564 3300009545 Bacteria 1511
176 Ga0105238_10030461 3300009551 Bacteria 5493
177 Ga0105238_10041328 3300009551 Bacteria 4670
178 Ga0105238_10056524 3300009551 Bacteria 3936
179 Ga0105238_10063110 3300009551 Bacteria 3705
180 Ga0105238_10097118 3300009551 Bacteria 2932
181 Ga0105238_10098701 3300009551 Bacteria 2904
182 Ga0105238_10449095 3300009551 Bacteria 1286
183 Ga0105238_10831750 3300009551 Bacteria 940
184 Ga0105239_10050138 3300010375 Bacteria 4579
185 Ga0105239_11032517 3300010375 Bacteria 946
186 Ga0157373_10025005 3300013100 Bacteria 4323
187 Ga0157373_10059921 3300013100 Bacteria 2697
188 Ga0157373_10178265 3300013100 Bacteria 1496
189 Ga0157373_10361044 3300013100 Bacteria 1037
190 Ga0157371_10169001 3300013102 Bacteria 1562
191 Ga0157371_10452361 3300013102 Bacteria 944
192 Ga0157370_10035973 3300013104 Bacteria 4809
193 Ga0157370_10183019 3300013104 Bacteria 1946
194 Ga0157369_10002180 3300013105 Bacteria 23585
195 Ga0157369_10428190 3300013105 Bacteria 1372
196 Ga0157369_10524142 3300013105 Bacteria 1226
197 Ga0157369_10741563 3300013105 Bacteria 1011
198 Ga0157369_11048311 3300013105 Bacteria 834
199 Ga0157374_10011307 3300013296 Bacteria 7720
200 Ga0157374_10202842 3300013296 Bacteria 1942
201 Ga0157378_10002757 3300013297 Bacteria 15650
202 Ga0157378_10031060 3300013297 Bacteria 4717
203 Ga0163162_10618092 3300013306 Bacteria 1209
204 Ga0157372_10001198 3300013307 Bacteria 28062
205 Ga0157372_10006297 3300013307 Bacteria 12618
206 Ga0157372_10315474 3300013307 Bacteria 1820
207 Ga0157372_10764136 3300013307 Bacteria 1124
208 Ga0157375_10174290 3300013308 Bacteria 2300
209 Ga0157375_10202627 3300013308 Bacteria 2140
210 Ga0157375_10834632 3300013308 Bacteria 1069
211 Ga0163163_10447252 3300014325 Bacteria 1352
212 Ga0157379_10066941 3300014968 Bacteria 3212
213 Ga0157379_10124251 3300014968 Bacteria 2322
214 Ga0209050_1000196 3300025298 Bacteria 135678
215 Ga0209257_1000228 3300025304 Bacteria 133390
216 Ga0207697_10000395 3300025315 Bacteria 24502
217 Ga0207656_10036350 3300025321 Bacteria 2067
218 Ga0207656_10278728 3300025321 Bacteria 824
219 Ga0207682_10148014 3300025893 Bacteria 1057
220 Ga0207642_10012228 3300025899 Bacteria 3092
221 Ga0207688_10003889 3300025901 Bacteria 8146
222 Ga0207688_10144834 3300025901 Bacteria 1400
223 Ga0207680_10004995 3300025903 Bacteria 6319
224 Ga0207680_10081029 3300025903 Bacteria 2039
225 Ga0207680_10091511 3300025903 Bacteria 1936
226 Ga0207647_10001213 3300025904 Bacteria 19829
227 Ga0207647_10006843 3300025904 Bacteria 8268
228 Ga0207647_10007549 3300025904 Bacteria 7844
229 Ga0207647_10035313 3300025904 Bacteria 3186
230 Ga0207647_10040748 3300025904 Bacteria 2923
231 Ga0207699_10159640 3300025906 Bacteria 1500
232 Ga0207645_10102997 3300025907 Bacteria 1843
233 Ga0207643_10183037 3300025908 Bacteria 1269
234 Ga0207705_10000687 3300025909 Bacteria 28005
235 Ga0207705_10010806 3300025909 Bacteria 6628
236 Ga0207705_10017971 3300025909 Bacteria 5057
237 Ga0207705_10153738 3300025909 Bacteria 1725
238 Ga0207705_10156274 3300025909 Bacteria 1711
239 Ga0207705_10351883 3300025909 Bacteria 1135
240 Ga0207705_10407975 3300025909 Bacteria 1051
241 Ga0207707_10124744 3300025912 Bacteria 2252
242 Ga0207707_10303004 3300025912 Bacteria 1382
243 Ga0207695_10021882 3300025913 Bacteria 7279
244 Ga0207695_10106503 3300025913 Bacteria 2790
245 Ga0207695_10488736 3300025913 Bacteria 1113
246 Ga0207671_10018200 3300025914 Bacteria 5398
247 Ga0207693_10025117 3300025915 Bacteria 4726
248 Ga0207693_10051844 3300025915 Bacteria 3218
249 Ga0207662_10036490 3300025918 Bacteria 2873
250 Ga0207662_10138557 3300025918 Bacteria 1540
251 Ga0207657_10000328 3300025919 Bacteria 50486
252 Ga0207657_10004948 3300025919 Bacteria 14020
253 Ga0207657_10021872 3300025919 Bacteria 6006
254 Ga0207657_10053502 3300025919 Bacteria 3497
255 Ga0207657_10120977 3300025919 Bacteria 2154
256 Ga0207657_10186556 3300025919 Bacteria 1674
257 Ga0207657_10197227 3300025919 Bacteria 1621
258 Ga0207649_10000266 3300025920 Bacteria 41245
259 Ga0207649_10012449 3300025920 Bacteria 4721
260 Ga0207649_10124375 3300025920 Bacteria 1743
261 Ga0207652_10113438 3300025921 Bacteria 2406
262 Ga0207652_10343137 3300025921 Bacteria 1348
263 Ga0207694_10012943 3300025924 Bacteria 6283
264 Ga0207694_10065141 3300025924 Bacteria 2841
265 Ga0207694_10204035 3300025924 Bacteria 1609
266 Ga0207650_10192962 3300025925 Bacteria 1628
267 Ga0207650_10213544 3300025925 Bacteria 1550
268 Ga0207659_10001230 3300025926 Bacteria 15325
269 Ga0207659_10045060 3300025926 Bacteria 3107
270 Ga0207687_10013213 3300025927 Bacteria 5392
271 Ga0207700_10360673 3300025928 Bacteria 1267
272 Ga0207664_10150196 3300025929 Bacteria 1978
273 Ga0207664_10278136 3300025929 Bacteria 1468
274 Ga0207644_10020579 3300025931 Bacteria 4488
275 Ga0207644_10033102 3300025931 Bacteria 3609
276 Ga0207644_10045298 3300025931 Bacteria 3129
277 Ga0207644_10108920 3300025931 Bacteria 2092
278 Ga0207644_10179244 3300025931 Bacteria 1659
279 Ga0207644_10226016 3300025931 Bacteria 1485
280 Ga0207690_10000036 3300025932 Bacteria 143853
281 Ga0207690_10001858 3300025932 Bacteria 12978
282 Ga0207690_10015838 3300025932 Bacteria 4576
283 Ga0207690_10022443 3300025932 Bacteria 3928
284 Ga0207690_10032424 3300025932 Bacteria 3352
285 Ga0207690_10087864 3300025932 Bacteria 2188
286 Ga0207690_10243415 3300025932 Bacteria 1386
287 Ga0207690_10360111 3300025932 Bacteria 1152
288 Ga0207706_10000343 3300025933 Bacteria 50497
289 Ga0207706_10003563 3300025933 Bacteria 14869
290 Ga0207706_10007986 3300025933 Bacteria 9772
291 Ga0207706_10018619 3300025933 Bacteria 6247
292 Ga0207706_10056327 3300025933 Bacteria 3466
293 Ga0207706_10162443 3300025933 Bacteria 1963
294 Ga0207706_10355816 3300025933 Bacteria 1273
295 Ga0207706_10647945 3300025933 Bacteria 905
296 Ga0207686_10022649 3300025934 Bacteria 3620
297 Ga0207686_10540713 3300025934 Bacteria 909
298 Ga0207670_10043542 3300025936 Bacteria 2965
299 Ga0207670_10071690 3300025936 Bacteria 2397
300 Ga0207670_10259115 3300025936 Bacteria 1347
301 Ga0207669_10026267 3300025937 Bacteria 3164
302 Ga0207669_10071518 3300025937 Bacteria 2180
303 Ga0207704_10007716 3300025938 Bacteria 5102
304 Ga0207691_10003655 3300025940 Bacteria 14921
305 Ga0207691_10011643 3300025940 Bacteria 8444
306 Ga0207691_10220553 3300025940 Bacteria 1644
307 Ga0207711_10001320 3300025941 Bacteria 23464
308 Ga0207711_10001646 3300025941 Bacteria 20609
309 Ga0207711_10003531 3300025941 Bacteria 13537
310 Ga0207711_10015976 3300025941 Bacteria 6227
311 Ga0207711_10103991 3300025941 Bacteria 2515
312 Ga0207711_10285631 3300025941 Bacteria 1520
313 Ga0207711_10452490 3300025941 Bacteria 1195
314 Ga0207689_10000064 3300025942 Bacteria 84222
315 Ga0207689_10047262 3300025942 Bacteria 3555
316 Ga0207689_10057515 3300025942 Bacteria 3199
317 Ga0207661_10005937 3300025944 Bacteria 8623
318 Ga0207661_10156444 3300025944 Bacteria 1975
319 Ga0207661_10463149 3300025944 Bacteria 1156
320 Ga0207679_10000093 3300025945 Bacteria 78331
321 Ga0207679_10041973 3300025945 Bacteria 3284
322 Ga0207679_10081648 3300025945 Bacteria 2473
323 Ga0207679_10448970 3300025945 Bacteria 1143
324 Ga0207667_10002660 3300025949 Bacteria 22079
325 Ga0207667_10052389 3300025949 Bacteria 4298
326 Ga0207667_10112196 3300025949 Bacteria 2811
327 Ga0207667_10382992 3300025949 Bacteria 1433
328 Ga0207667_11184107 3300025949 Bacteria 744
329 Ga0207651_10005110 3300025960 Bacteria 6699
330 Ga0207651_10017646 3300025960 Bacteria 4222
331 Ga0207640_10003887 3300025981 Bacteria 8065
332 Ga0207640_10039525 3300025981 Bacteria 2987
333 Ga0207640_10084736 3300025981 Bacteria 2177
334 Ga0207640_10387550 3300025981 Bacteria 1134
335 Ga0207658_10008692 3300025986 Bacteria 6899
336 Ga0207658_10014467 3300025986 Bacteria 5403
337 Ga0207658_10015737 3300025986 Bacteria 5193
338 Ga0207677_10004612 3300026023 Bacteria 7411
339 Ga0207677_10010570 3300026023 Bacteria 5231
340 Ga0207677_10021327 3300026023 Bacteria 3956
341 Ga0207677_10040808 3300026023 Bacteria 3063
342 Ga0207677_10267707 3300026023 Bacteria 1396
343 Ga0207703_10009696 3300026035 Bacteria 7558
344 Ga0207703_10228396 3300026035 Bacteria 1667
345 Ga0207639_10000181 3300026041 Bacteria 49444
346 Ga0207639_10001001 3300026041 Bacteria 19216
347 Ga0207639_10007544 3300026041 Bacteria 7419
348 Ga0207639_10012668 3300026041 Bacteria 5881
349 Ga0207639_10104115 3300026041 Bacteria 2301
350 Ga0207639_10207876 3300026041 Bacteria 1683
351 Ga0207639_10812081 3300026041 Bacteria 872
352 Ga0207678_10016076 3300026067 Bacteria 6571
353 Ga0207678_10439851 3300026067 Bacteria 1132
354 Ga0207708_10323191 3300026075 Bacteria 1260
355 Ga0207702_10000619 3300026078 Bacteria 39068
356 Ga0207702_10227219 3300026078 Bacteria 1742
357 Ga0207641_10009194 3300026088 Bacteria 8154
358 Ga0207641_10128150 3300026088 Bacteria 2275
359 Ga0207648_10001433 3300026089 Bacteria 26248
360 Ga0207648_10012796 3300026089 Bacteria 7839
361 Ga0207676_10008272 3300026095 Bacteria 7398
362 Ga0207676_10022808 3300026095 Bacteria 4608
363 Ga0207676_10737792 3300026095 Bacteria 957
364 Ga0207674_10000362 3300026116 Bacteria 58887
365 Ga0207674_10006311 3300026116 Bacteria 13969
366 Ga0207698_10001267 3300026142 Bacteria 14725
367 Ga0207698_10005169 3300026142 Bacteria 8023
368 Ga0207698_10032294 3300026142 Bacteria 3791
369 Ga0207698_10130214 3300026142 Bacteria 2148
370 Ga0207698_10407881 3300026142 Bacteria 1300
371 Ga0268266_10043975 3300028379 Bacteria 3817
372 Ga0268264_10028095 3300028381 Bacteria 4601
373 Ga0307517_10147460 3300028786 Bacteria 1627
374 Ga0316182_1275706 3300030745 Bacteria 2131
375 Ga0265320_10107652 3300031240 Bacteria 1279
376 Ga0307408_100015823 3300031548 Bacteria 5026
377 Ga0265314_10005218 3300031711 Bacteria 11786
378 Ga0307405_10007792 3300031731 Bacteria 5389
379 Ga0307405_10013530 3300031731 Bacteria 4356
380 Ga0307405_10501509 3300031731 Bacteria 973
381 Ga0307413_10010199 3300031824 Bacteria 4541
382 Ga0307413_10029365 3300031824 Bacteria 3075
383 Ga0307413_10052076 3300031824 Bacteria 2470
384 Ga0307410_10005283 3300031852 Bacteria 6813
385 Ga0307410_10022349 3300031852 Bacteria 3907
386 Ga0307410_10023263 3300031852 Bacteria 3848
387 Ga0307410_10148658 3300031852 Bacteria 1741
388 Ga0307410_10231187 3300031852 Bacteria 1428
389 Ga0307406_10172156 3300031901 Bacteria 1568
390 Ga0307406_10473810 3300031901 Bacteria 1010
391 Ga0307407_10037682 3300031903 Bacteria 2673
392 Ga0307412_10015024 3300031911 Bacteria 4580
393 Ga0307412_10018297 3300031911 Bacteria 4213
394 Ga0307412_10154327 3300031911 Bacteria 1698
395 Ga0307409_100016356 3300031995 Bacteria 4905
396 Ga0307409_100017678 3300031995 Bacteria 4762
397 Ga0307409_100022190 3300031995 Bacteria 4370
398 Ga0307409_100077353 3300031995 Bacteria 2672
399 Ga0307409_100233720 3300031995 Bacteria 1668
400 Ga0307409_100334247 3300031995 Bacteria 1423
401 Ga0307409_100452026 3300031995 Bacteria 1240
402 Ga0307416_100031238 3300032002 Bacteria 4006
403 Ga0307416_100042709 3300032002 Bacteria 3542
404 Ga0307416_100132859 3300032002 Bacteria 2245
405 Ga0307416_100189337 3300032002 Bacteria 1938
406 Ga0307414_10003907 3300032004 Bacteria 8032
407 Ga0307414_10008735 3300032004 Bacteria 5774
408 Ga0307414_10068537 3300032004 Bacteria 2546
409 Ga0307414_10161782 3300032004 Bacteria 1779
410 Ga0307414_10691994 3300032004 Bacteria 922
411 Ga0307414_10854181 3300032004 Bacteria 832
412 Ga0307411_10062642 3300032005 Bacteria 2481
413 Ga0307411_10145241 3300032005 Bacteria 1755
414 Ga0307411_10169322 3300032005 Bacteria 1645
415 Ga0307411_10224898 3300032005 Bacteria 1458
416 Ga0307415_100001022 3300032126 Bacteria 12921
417 Ga0307415_100059281 3300032126 Bacteria 2639
418 Ga0307415_100190657 3300032126 Bacteria 1617
419 Ga0307415_100547343 3300032126 Bacteria 1021
420 Ga0307415_100810204 3300032126 Bacteria 855
421 Ga0307415_100955601 3300032126 Bacteria 793
422 Ga0373923_0024351 3300035111 Bacteria 2388
423 Ga0373941_0062330 3300035115 Bacteria 1217
424 Ga0373953_0008522 3300035117 Bacteria 3487
425 Ga0373954_0014179 3300035118 Bacteria 3553
426 Ga0373956_0129933 3300035119 Bacteria 1179
427 Ga0373957_0093949 3300035120 Bacteria 1195
428 Ga0373943_0047225 3300035170 Bacteria 2104
429 Ga0373946_0052697 3300035171 Bacteria 1707
430 Ga0373955_0171458 3300035172 Bacteria 1284
431 Ga0373955_0181052 3300035172 Bacteria 1250
432 Ga0373924_0012481 3300035410 Bacteria 3175
433 Ga0373924_0033713 3300035410 Bacteria 2069
434 Ga0373935_0013673 3300035692 Bacteria 4899
435 Ga0373933_0024198 3300035724 Bacteria 3476
436 Ga0373933_0032271 3300035724 Bacteria 3043
437 Ga0373947_0083889 3300035725 Bacteria 1976
438 Ga0373937_0023839 3300036401 Bacteria 5517
439 Ga0373937_0116212 3300036401 Bacteria 2491
440 Ga0373937_0735746 3300036401 Bacteria 933
441 Ga0373925_0017538 3300037068 Bacteria 5191
442 Ga0373925_0417114 3300037068 Bacteria 1096
443 Ga0395899_0005641 3300037312 Bacteria 9713
444 Ga0395899_0055572 3300037312 Bacteria 2928
445 Ga0395899_0102371 3300037312 Bacteria 2066
446 Ga0395899_0110605 3300037312 Bacteria 1976
447 Ga0395899_0214659 3300037312 Bacteria 1335
448 Ga0395900_0008585 3300037418 Bacteria 10500
449 Ga0395900_0046362 3300037418 Bacteria 4475
450 Ga0395900_0078348 3300037418 Bacteria 3396
451 Ga0395900_0244413 3300037418 Bacteria 1799
452 Ga0395900_0308688 3300037418 Bacteria 1565
453 Ga0395900_0337410 3300037418 Bacteria 1483
454 Ga0395900_0602316 3300037418 Bacteria 1039
455 Ga0395900_0861606 3300037418 Bacteria 831
456 Ga0395900_1021730 3300037418 Bacteria 746
457 Ga0395898_0018636 3300037466 Bacteria 7076
458 Ga0395898_0189075 3300037466 Bacteria 1968
459 Ga0395898_0411747 3300037466 Bacteria 1289
460 Ga0395898_0423447 3300037466 Bacteria 1269
461 Ga0395905_0001643 3300037471 Bacteria 26485
462 Ga0395905_0006708 3300037471 Bacteria 11526
463 Ga0395905_0017198 3300037471 Bacteria 6869
464 Ga0395905_0021280 3300037471 Bacteria 6137
465 Ga0395905_0028612 3300037471 Bacteria 5253
466 Ga0395905_0029023 3300037471 Bacteria 5214
467 Ga0395905_0051871 3300037471 Bacteria 3842
468 Ga0395905_0092678 3300037471 Bacteria 2833
469 Ga0395905_0266508 3300037471 Bacteria 1598
470 Ga0395905_0277926 3300037471 Bacteria 1560
471 Ga0395905_0308970 3300037471 Bacteria 1469
472 Ga0395905_0403210 3300037471 Bacteria 1262
473 Ga0395905_0579052 3300037471 Bacteria 1024
474 Ga0395905_0740337 3300037471 Bacteria 885
475 Ga0395901_0011073 3300038443 Bacteria 9140
476 Ga0395901_0051327 3300038443 Bacteria 4288
477 Ga0395901_0080177 3300038443 Bacteria 3407
478 Ga0395901_0210708 3300038443 Bacteria 2034
479 Ga0395901_0211297 3300038443 Bacteria 2031
480 Ga0395901_0219707 3300038443 Bacteria 1986
481 Ga0395901_0247874 3300038443 Bacteria 1856
482 Ga0395901_0510036 3300038443 Bacteria 1223
483 Ga0395901_0679560 3300038443 Bacteria 1029
484 Ga0395901_0958842 3300038443 Bacteria 834
485 Ga0439439_0057648 3300041406 Bacteria 1027
486 Ga0439461_0000953 3300041410 Bacteria 4337
487 Ga0439466_0087119 3300041411 Bacteria 981
488 Ga0439465_0021114 3300041413 Bacteria 2041
489 Ga0439431_0000563 3300041997 Bacteria 7873
490 Ga0439431_0026902 3300041997 Bacteria 1411
491 Ga0439433_0025223 3300041999 Bacteria 1342
492 Ga0439442_001886 3300042002 Bacteria 4110
493 Ga0439448_0106082 3300042005 Bacteria 957
494 Ga0439432_004764 3300042006 Bacteria 4939
495 Ga0439432_007739 3300042006 Bacteria 3795
496 Ga0439432_062866 3300042006 Bacteria 1142
497 Ga0439449_0007785 3300042007 Bacteria 4068
498 Ga0439449_0018057 3300042007 Bacteria 2648
499 Ga0439452_010735 3300042010 Bacteria 2651
500 Ga0439452_013439 3300042010 Bacteria 2299
501 Ga0439455_0082190 3300042012 Bacteria 876
502 Ga0439457_019302 3300042014 Bacteria 1514
503 Ga0439462_0002116 3300042015 Bacteria 4560
504 Ga0439462_0002981 3300042015 Bacteria 4015
505 Ga0439462_0003345 3300042015 Bacteria 3840
506 Ga0450920_019086 3300042122 Bacteria 1315
507 Ga0450910_020656 3300042147 Bacteria 994
508 Ga0439446_0004477 3300042156 Bacteria 3544
509 Ga0439458_0002355 3300042157 Bacteria 4635
510 Ga0439434_0003047 3300042435 Bacteria 4915
511 Ga0439435_0007674 3300042436 Bacteria 2479
512 Ga0439459_0045532 3300042438 Bacteria 947
513 Ga0439464_0000505 3300042439 Bacteria 7960
514 Ga0466972_0198158 3300044658 Bacteria 941
515 Ga0466966_0334809 3300044684 Bacteria 909
516 Ga0466966_0399262 3300044684 Bacteria 826
517 Ga0466963_0098010 3300044694 Bacteria 2003
518 Ga0466963_0206326 3300044694 Bacteria 1374
519 Ga0466963_0213257 3300044694 Bacteria 1351
520 Ga0466963_0214319 3300044694 Bacteria 1348
521 Ga0466963_0334260 3300044694 Bacteria 1066
522 Ga0466957_0009572 3300044842 Bacteria 5534
523 Ga0466958_0016445 3300045836 Bacteria 4260
524 Ga0466958_0070932 3300045836 Bacteria 2133
525 Ga0466958_0139002 3300045836 Bacteria 1529
526 Ga0466958_0485974 3300045836 Bacteria 801
527 Ga0466958_0580060 3300045836 Bacteria 729
528 Ga0466967_0000133 3300045976 Bacteria 28499
529 Ga0466967_0046579 3300045976 Bacteria 3776
530 Ga0466967_0121035 3300045976 Bacteria 2418
531 Ga0466967_0214774 3300045976 Bacteria 1825
532 Ga0466967_0290441 3300045976 Bacteria 1571
533 Ga0466967_0367695 3300045976 Bacteria 1394
534 Ga0466967_1051046 3300045976 Bacteria 811
535 Ga0495592_0005965 3300046454 Bacteria 9055
536 Ga0495592_0063692 3300046454 Bacteria 2704
537 Ga0495653_0036851 3300046463 Bacteria 3849
538 Ga0495582_0052086 3300046473 Bacteria 2257
539 Ga0495605_0021457 3300046474 Bacteria 3421
540 Ga0495664_0132475 3300046477 Bacteria 1510
541 Ga0495664_0163719 3300046477 Bacteria 1349
542 Ga0495585_0013212 3300046492 Bacteria 4837
543 Ga0495596_0001537 3300046500 Bacteria 13172
544 Ga0495608_0065445 3300046511 Bacteria 2381
545 Ga0495618_0038467 3300046514 Bacteria 3007
546 Ga0495628_0076019 3300046516 Bacteria 2614
547 Ga0495630_0015746 3300046517 Bacteria 5525
548 Ga0495648_0042974 3300046524 Bacteria 2838
549 Ga0495663_0043457 3300046525 Bacteria 1372
550 Ga0495642_0189865 3300046528 Bacteria 895
551 Ga0495652_0140706 3300046529 Bacteria 1898
552 Ga0495652_0192655 3300046529 Bacteria 1554
553 Ga0495640_0009778 3300046533 Bacteria 7451
554 Ga0495587_0017376 3300046536 Bacteria 4469
555 Ga0495587_0095791 3300046536 Bacteria 1713
556 Ga0495598_0001093 3300046537 Bacteria 5209
557 Ga0495645_0008560 3300046543 Bacteria 7145
558 Ga0495645_0344917 3300046543 Bacteria 961
559 Ga0495633_0009481 3300046558 Bacteria 5372
560 Ga0495635_0020339 3300046663 Bacteria 4624
561 Ga0495661_0052184 3300046665 Bacteria 2465
562 Ga0495657_0039708 3300046675 Bacteria 3233
563 Ga0495599_0061649 3300046678 Bacteria 2343
564 Ga0495599_0064199 3300046678 Bacteria 2294
565 Ga0495623_0084451 3300046679 Bacteria 1959
566 Ga0495623_0093081 3300046679 Bacteria 1846
567 Ga0495658_0018540 3300046683 Bacteria 3620
568 Ga0495669_0010853 3300046684 Bacteria 3856
569 Ga0495613_0121804 3300046689 Bacteria 1873
570 Ga0495624_0039648 3300046690 Bacteria 3019
571 Ga0495670_0032290 3300046691 Bacteria 2603
572 Ga0495589_0002666 3300046794 Bacteria 9870
573 Ga0495604_0129697 3300047317 Bacteria 1814
574 Ga0495604_0290466 3300047317 Bacteria 1101
575 Ga0495672_0002926 3300047320 Bacteria 15087
576 Ga0495676_0217383 3300047321 Bacteria 1319
577 Ga0495676_0342410 3300047321 Bacteria 1001
578 Ga0495683_0005799 3300047323 Bacteria 6798
579 Ga0495677_0017333 3300047445 Bacteria 2612
580 Ga0495677_0177487 3300047445 Bacteria 825
581 Ga0495684_0009222 3300047471 Bacteria 7619
582 Ga0495686_0086693 3300047472 Bacteria 1905
583 Ga0495593_0078136 3300047673 Bacteria 1714
584 Ga0496101_0073073 3300048904 Bacteria 2519
585 Ga0496101_0085324 3300048904 Bacteria 2340
586 Ga0496102_0274902 3300048905 Bacteria 1588
587 Ga0496104_0502613 3300048907 Bacteria 1123
588 Ga0496105_0294417 3300048908 Bacteria 1306
589 Ga0496106_0120790 3300048909 Bacteria 2048
590 Ga0496106_0531212 3300048909 Bacteria 944
591 Ga0496107_0201335 3300048910 Bacteria 1480
592 Ga0496108_0284916 3300048911 Bacteria 1438
593 Ga0496109_0038485 3300048912 Bacteria 4324
594 Ga0496109_0097557 3300048912 Bacteria 2724
595 Ga0496110_0010972 3300048913 Bacteria 7392
596 Ga0496110_0483076 3300048913 Bacteria 1128
597 Ga0496112_0007779 3300048915 Bacteria 9539
598 Ga0496112_0018391 3300048915 Bacteria 6578
599 Ga0496114_0000023 3300048917 Bacteria 219092
600 Ga0496123_0073772 3300048926 Bacteria 2115
601 Ga0496124_0001391 3300048927 Bacteria 36283
602 Ga0496124_0014216 3300048927 Bacteria 7711
603 Ga0496124_0159289 3300048927 Bacteria 1761
604 Ga0496125_0242838 3300048928 Bacteria 1142
605 Ga0496125_0367203 3300048928 Bacteria 853
606 Ga0496126_0110404 3300048929 Bacteria 2396
607 Ga0501034_0001342 3300049571 Bacteria 33243
608 Ga0501034_0045361 3300049571 Bacteria 4442
609 Ga0501069_0003696 3300049585 Bacteria 7871
610 Ga0501070_0073364 3300049586 Bacteria 2831
611 Ga0501074_0063590 3300049590 Bacteria 2658
612 Ga0501080_1276936 3300049742 Bacteria 629
613 Ga0501241_001096 3300049758 Bacteria 5701
614 nmdc:mga03n38_355252_c1 3300050490 Bacteria 798
615 nmdc:mga00v17_1503_c1 3300050491 Bacteria 12176
616 nmdc:mga06z11_6567_c1 3300050494 Bacteria 4745
617 nmdc:mga07m45_99717_c1 3300050496 Bacteria 1668
618 nmdc:mga05p37_364249_c1 3300050507 Bacteria 1698
619 nmdc:mga0rr50_506777_c1 3300050513 Bacteria 1026
620 Ga0495601_0013872 3300053077 Bacteria 4851
621 Ga0495612_0013700 3300053078 Bacteria 3266
622 Ga0495619_0017325 3300053085 Bacteria 4562
623 Ga0500643_000113 3300053087 Bacteria 84494
624 Ga0500594_0129594 3300053118 Bacteria 798
625 Ga0500595_000845 3300053119 Bacteria 17481
626 Ga0500559_0022982 3300053136 Bacteria 2646
627 Ga0500604_0034392 3300053151 Bacteria 1503
628 Ga0500645_003965 3300053730 Bacteria 5826
629 Ga0500645_016872 3300053730 Bacteria 2295
630 Ga0501082_0159598 3300060353 Bacteria 1959

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0110404 Ga0496126_0110404_102_749 181
2 3300031911 Ga0307412_10015024 Ga0307412_100150245 187
3 3300044694 Ga0466963_0098010 Ga0466963_0098010_1226_1789 187
4 3300044694 Ga0466963_0206326 Ga0466963_0206326_114_677 187
5 3300044694 Ga0466963_0214319 Ga0466963_0214319_482_1045 187
6 3300045836 Ga0466958_0016445 Ga0466958_0016445_3001_3564 187
7 3300045836 Ga0466958_0485974 Ga0466958_0485974_28_591 187
8 3300045836 Ga0466958_0580060 Ga0466958_0580060_149_712 187
9 3300045976 Ga0466967_0367695 Ga0466967_0367695_355_918 187
10 3300046528 Ga0495642_0189865 Ga0495642_0189865_305_868 187
11 3300047445 Ga0495677_0177487 Ga0495677_0177487_252_815 187
12 3300048927 Ga0496124_0001391 Ga0496124_0001391_6126_6758 187
13 iso_pu_bacteria 2896429255 2896430684 190
14 3300053151 Ga0500604_0034392 Ga0500604_0034392_91_723 193
15 3300005616 Ga0068852_100280322 Ga0068852_1002803223 194
16 3300013105 Ga0157369_10524142 Ga0157369_105241422 194
17 3300013105 Ga0157369_11048311 Ga0157369_110483111 194
18 3300026142 Ga0207698_10005169 Ga0207698_100051695 194
19 3300031995 Ga0307409_100077353 Ga0307409_1000773532 194
20 3300032004 Ga0307414_10068537 Ga0307414_100685372 194
21 3300037418 Ga0395900_0046362 Ga0395900_0046362_3861_4445 194
22 3300044658 Ga0466972_0198158 Ga0466972_0198158_277_861 194
23 3300049742 Ga0501080_1276936 Ga0501080_1276936_29_613 194
24 3300053118 Ga0500594_0129594 Ga0500594_0129594_10_594 194
25 3300005577 Ga0068857_100263208 Ga0068857_1002632082 196
26 3300048927 Ga0496124_0159289 Ga0496124_0159289_55_687 196
27 3300025919 Ga0207657_10120977 Ga0207657_101209773 199
28 3300045836 Ga0466958_0070932 Ga0466958_0070932_360_959 199
29 3300031240 Ga0265320_10107652 Ga0265320_101076522 201
30 3300031711 Ga0265314_10005218 Ga0265314_1000521810 201
31 3300049571 Ga0501034_0001342 Ga0501034_0001342_25197_25838 201
32 3300045976 Ga0466967_0121035 Ga0466967_0121035_1147_1767 206
33 iso_pu_bacteria 2599185359 2600225564 206
34 iso_pu_bacteria 2643221622 2644125825 206
35 iso_pu_bacteria 2818991466 2819713996 206
36 iso_pu_bacteria 2830075706 2830078206 206
37 iso_pu_bacteria 2879163058 2879165084 206
38 iso_pu_bacteria 2928526807 2928528557 206
39 iso_pu_bacteria 2928968154 2928970104 206
40 3300031731 Ga0307405_10013530 Ga0307405_100135303 207
41 3300031852 Ga0307410_10005283 Ga0307410_100052835 207
42 3300031901 Ga0307406_10172156 Ga0307406_101721562 207
43 3300031903 Ga0307407_10037682 Ga0307407_100376824 207
44 3300031995 Ga0307409_100022190 Ga0307409_1000221906 207
45 3300032002 Ga0307416_100042709 Ga0307416_1000427092 207
46 3300032004 Ga0307414_10161782 Ga0307414_101617822 207
47 3300032126 Ga0307415_100190657 Ga0307415_1001906572 207
48 3300005340 Ga0070689_100377209 Ga0070689_1003772092 208
49 3300005438 Ga0070701_10112587 Ga0070701_101125872 208
50 3300005530 Ga0070679_100565983 Ga0070679_1005659832 208
51 3300005535 Ga0070684_100024921 Ga0070684_1000249215 208
52 3300005547 Ga0070693_100001354 Ga0070693_1000013545 208
53 3300005615 Ga0070702_100163265 Ga0070702_1001632652 208
54 3300005617 Ga0068859_100515567 Ga0068859_1005155672 208
55 3300005618 Ga0068864_100174079 Ga0068864_1001740792 208
56 3300005842 Ga0068858_100016585 Ga0068858_1000165858 208
57 3300006237 Ga0097621_100026258 Ga0097621_1000262588 208
58 3300006358 Ga0068871_100192279 Ga0068871_1001922792 208
59 3300006358 Ga0068871_100507786 Ga0068871_1005077862 208
60 3300006931 Ga0097620_100515546 Ga0097620_1005155462 208
61 3300007076 Ga0075435_100723981 Ga0075435_1007239812 208
62 3300009176 Ga0105242_10025177 Ga0105242_100251777 208
63 3300009177 Ga0105248_10075926 Ga0105248_100759263 208
64 3300009545 Ga0105237_10337564 Ga0105237_103375642 208
65 3300009551 Ga0105238_10030461 Ga0105238_100304613 208
66 3300009551 Ga0105238_10097118 Ga0105238_100971182 208
67 3300013105 Ga0157369_10002180 Ga0157369_1000218019 208
68 3300013296 Ga0157374_10011307 Ga0157374_100113077 208
69 3300013297 Ga0157378_10031060 Ga0157378_100310604 208
70 3300013306 Ga0163162_10618092 Ga0163162_106180922 208
71 3300013307 Ga0157372_10001198 Ga0157372_1000119816 208
72 3300013307 Ga0157372_10006297 Ga0157372_1000629711 208
73 3300013308 Ga0157375_10174290 Ga0157375_101742903 208
74 3300014968 Ga0157379_10124251 Ga0157379_101242514 208
75 3300025918 Ga0207662_10036490 Ga0207662_100364903 208
76 3300025924 Ga0207694_10065141 Ga0207694_100651413 208
77 3300025934 Ga0207686_10540713 Ga0207686_105407132 208
78 3300025936 Ga0207670_10259115 Ga0207670_102591152 208
79 3300025941 Ga0207711_10103991 Ga0207711_101039913 208
80 3300025949 Ga0207667_11184107 Ga0207667_111841071 208
81 3300026023 Ga0207677_10040808 Ga0207677_100408082 208
82 3300035172 Ga0373955_0181052 Ga0373955_0181052_313_942 208
83 3300035410 Ga0373924_0033713 Ga0373924_0033713_272_901 208
84 3300036401 Ga0373937_0116212 Ga0373937_0116212_1444_2073 208
85 3300037312 Ga0395899_0055572 Ga0395899_0055572_596_1225 208
86 3300037471 Ga0395905_0006708 Ga0395905_0006708_4606_5235 208
87 3300038443 Ga0395901_0051327 Ga0395901_0051327_2222_2851 208
88 3300046454 Ga0495592_0005965 Ga0495592_0005965_2989_3618 208
89 3300046463 Ga0495653_0036851 Ga0495653_0036851_569_1198 208
90 3300046511 Ga0495608_0065445 Ga0495608_0065445_1412_2041 208
91 3300046516 Ga0495628_0076019 Ga0495628_0076019_888_1517 208
92 3300046529 Ga0495652_0140706 Ga0495652_0140706_1004_1633 208
93 3300046536 Ga0495587_0017376 Ga0495587_0017376_3501_4130 208
94 3300046543 Ga0495645_0008560 Ga0495645_0008560_2168_2797 208
95 3300046675 Ga0495657_0039708 Ga0495657_0039708_886_1515 208
96 3300046678 Ga0495599_0061649 Ga0495599_0061649_94_723 208
97 3300046679 Ga0495623_0084451 Ga0495623_0084451_351_980 208
98 3300047317 Ga0495604_0290466 Ga0495604_0290466_295_924 208
99 3300049585 Ga0501069_0003696 Ga0501069_0003696_3402_4028 208
100 3300049586 Ga0501070_0073364 Ga0501070_0073364_1408_2034 208
101 3300050513 nmdc:mga0rr50_506777_c1 nmdc:mga0rr50_506777_c1_224_853 208
102 3300053077 Ga0495601_0013872 Ga0495601_0013872_1150_1779 208
103 3300053085 Ga0495619_0017325 Ga0495619_0017325_951_1580 208
104 3300060353 Ga0501082_0159598 Ga0501082_0159598_808_1434 208
105 3300005354 Ga0070675_100044023 Ga0070675_1000440233 209
106 3300005364 Ga0070673_100146726 Ga0070673_1001467264 209
107 3300005365 Ga0070688_100011769 Ga0070688_1000117694 209
108 3300005367 Ga0070667_100006690 Ga0070667_1000066906 209
109 3300005539 Ga0068853_100008324 Ga0068853_1000083248 209
110 3300005543 Ga0070672_100032899 Ga0070672_1000328993 209
111 3300005563 Ga0068855_100058901 Ga0068855_1000589012 209
112 3300005564 Ga0070664_100195508 Ga0070664_1001955083 209
113 3300005577 Ga0068857_100069677 Ga0068857_1000696772 209
114 3300005616 Ga0068852_100003881 Ga0068852_1000038819 209
115 3300005843 Ga0068860_100038414 Ga0068860_1000384147 209
116 3300006178 Ga0075367_10004493 Ga0075367_100044935 209
117 3300009177 Ga0105248_10033619 Ga0105248_100336195 209
118 3300009551 Ga0105238_10056524 Ga0105238_100565245 209
119 3300013308 Ga0157375_10202627 Ga0157375_102026272 209
120 3300025908 Ga0207643_10183037 Ga0207643_101830372 209
121 3300025909 Ga0207705_10153738 Ga0207705_101537382 209
122 3300025913 Ga0207695_10488736 Ga0207695_104887362 209
123 3300025921 Ga0207652_10113438 Ga0207652_101134381 209
124 3300025924 Ga0207694_10204035 Ga0207694_102040352 209
125 3300025926 Ga0207659_10001230 Ga0207659_100012304 209
126 3300025936 Ga0207670_10043542 Ga0207670_100435423 209
127 3300025940 Ga0207691_10011643 Ga0207691_100116439 209
128 3300025941 Ga0207711_10003531 Ga0207711_100035318 209
129 3300025942 Ga0207689_10047262 Ga0207689_100472622 209
130 3300025986 Ga0207658_10015737 Ga0207658_100157375 209
131 3300026023 Ga0207677_10267707 Ga0207677_102677072 209
132 3300026035 Ga0207703_10228396 Ga0207703_102283963 209
133 3300026041 Ga0207639_10007544 Ga0207639_100075447 209
134 3300026075 Ga0207708_10323191 Ga0207708_103231911 209
135 3300026116 Ga0207674_10006311 Ga0207674_100063115 209
136 3300026142 Ga0207698_10001267 Ga0207698_1000126713 209
137 3300028381 Ga0268264_10028095 Ga0268264_100280953 209
138 3300028786 Ga0307517_10147460 Ga0307517_101474602 209
139 3300035111 Ga0373923_0024351 Ga0373923_0024351_257_913 209
140 3300035117 Ga0373953_0008522 Ga0373953_0008522_2676_3332 209
141 3300035170 Ga0373943_0047225 Ga0373943_0047225_1406_2062 209
142 3300035171 Ga0373946_0052697 Ga0373946_0052697_1002_1634 209
143 3300035410 Ga0373924_0012481 Ga0373924_0012481_2190_2846 209
144 3300035724 Ga0373933_0024198 Ga0373933_0024198_2171_2827 209
145 3300035725 Ga0373947_0083889 Ga0373947_0083889_79_735 209
146 3300036401 Ga0373937_0023839 Ga0373937_0023839_4075_4731 209
147 3300037068 Ga0373925_0017538 Ga0373925_0017538_3230_3886 209
148 3300037068 Ga0373925_0417114 Ga0373925_0417114_431_1063 209
149 3300042005 Ga0439448_0106082 Ga0439448_0106082_74_703 209
150 3300042006 Ga0439432_062866 Ga0439432_062866_52_681 209
151 3300042007 Ga0439449_0018057 Ga0439449_0018057_619_1248 209
152 3300042012 Ga0439455_0082190 Ga0439455_0082190_97_726 209
153 3300042157 Ga0439458_0002355 Ga0439458_0002355_643_1272 209
154 3300044694 Ga0466963_0334260 Ga0466963_0334260_406_1035 209
155 3300046454 Ga0495592_0063692 Ga0495592_0063692_1107_1763 209
156 3300046473 Ga0495582_0052086 Ga0495582_0052086_1559_2215 209
157 3300046477 Ga0495664_0163719 Ga0495664_0163719_476_1132 209
158 3300046492 Ga0495585_0013212 Ga0495585_0013212_2474_3103 209
159 3300046514 Ga0495618_0038467 Ga0495618_0038467_1679_2335 209
160 3300046517 Ga0495630_0015746 Ga0495630_0015746_4425_5081 209
161 3300046525 Ga0495663_0043457 Ga0495663_0043457_672_1301 209
162 3300046529 Ga0495652_0192655 Ga0495652_0192655_351_1007 209
163 3300046533 Ga0495640_0009778 Ga0495640_0009778_3824_4480 209
164 3300046536 Ga0495587_0095791 Ga0495587_0095791_813_1469 209
165 3300046537 Ga0495598_0001093 Ga0495598_0001093_3460_4089 209
166 3300046543 Ga0495645_0344917 Ga0495645_0344917_48_704 209
167 3300046558 Ga0495633_0009481 Ga0495633_0009481_873_1502 209
168 3300046663 Ga0495635_0020339 Ga0495635_0020339_1362_2018 209
169 3300046665 Ga0495661_0052184 Ga0495661_0052184_1595_2224 209
170 3300046678 Ga0495599_0064199 Ga0495599_0064199_781_1437 209
171 3300046683 Ga0495658_0018540 Ga0495658_0018540_1651_2307 209
172 3300046684 Ga0495669_0010853 Ga0495669_0010853_3101_3730 209
173 3300046689 Ga0495613_0121804 Ga0495613_0121804_1123_1779 209
174 3300046690 Ga0495624_0039648 Ga0495624_0039648_1810_2466 209
175 3300046691 Ga0495670_0032290 Ga0495670_0032290_959_1588 209
176 3300047317 Ga0495604_0129697 Ga0495604_0129697_479_1135 209
177 3300047445 Ga0495677_0017333 Ga0495677_0017333_346_975 209
178 3300047471 Ga0495684_0009222 Ga0495684_0009222_2349_3005 209
179 3300047673 Ga0495593_0078136 Ga0495593_0078136_475_1131 209
180 3300048909 Ga0496106_0531212 Ga0496106_0531212_160_789 209
181 3300048913 Ga0496110_0483076 Ga0496110_0483076_243_872 209
182 3300049571 Ga0501034_0045361 Ga0501034_0045361_3221_3853 209
183 3300050490 nmdc:mga03n38_355252_c1 nmdc:mga03n38_355252_c1_33_665 209
184 3300050491 nmdc:mga00v17_1503_c1 nmdc:mga00v17_1503_c1_8073_8705 209
185 3300050494 nmdc:mga06z11_6567_c1 nmdc:mga06z11_6567_c1_3490_4122 209
186 3300050496 nmdc:mga07m45_99717_c1 nmdc:mga07m45_99717_c1_564_1196 209
187 3300053078 Ga0495612_0013700 Ga0495612_0013700_2171_2827 209
188 3300053730 Ga0500645_016872 Ga0500645_016872_956_1588 209
189 3300001979 JGI24740J21852_10008549 JGI24740J21852_100085495 210
190 3300001979 JGI24740J21852_10011893 JGI24740J21852_100118935 210
191 3300001990 JGI24737J22298_10000139 JGI24737J22298_1000013930 210
192 3300001990 JGI24737J22298_10006334 JGI24737J22298_100063343 210
193 3300001990 JGI24737J22298_10020485 JGI24737J22298_100204853 210
194 3300002067 JGI24735J21928_10003189 JGI24735J21928_100031894 210
195 3300002075 JGI24738J21930_10003779 JGI24738J21930_100037794 210
196 3300002075 JGI24738J21930_10006669 JGI24738J21930_100066694 210
197 3300003791 Ga0055530_10000332 Ga0055530_1000033213 210
198 3300003794 Ga0055531_10000384 Ga0055531_1000038413 210
199 3300005327 Ga0070658_10000165 Ga0070658_1000016553 210
200 3300005327 Ga0070658_10093280 Ga0070658_100932803 210
201 3300005327 Ga0070658_10125223 Ga0070658_101252233 210
202 3300005328 Ga0070676_10149520 Ga0070676_101495202 210
203 3300005329 Ga0070683_100003336 Ga0070683_1000033368 210
204 3300005329 Ga0070683_100155467 Ga0070683_1001554672 210
205 3300005330 Ga0070690_100004009 Ga0070690_1000040094 210
206 3300005331 Ga0070670_100101501 Ga0070670_1001015011 210
207 3300005331 Ga0070670_100273816 Ga0070670_1002738163 210
208 3300005334 Ga0068869_100004289 Ga0068869_1000042897 210
209 3300005335 Ga0070666_10007235 Ga0070666_1000723512 210
210 3300005335 Ga0070666_10008069 Ga0070666_100080697 210
211 3300005336 Ga0070680_100020619 Ga0070680_1000206195 210
212 3300005338 Ga0068868_100003061 Ga0068868_10000306113 210
213 3300005338 Ga0068868_100007425 Ga0068868_1000074253 210
214 3300005338 Ga0068868_100011768 Ga0068868_1000117689 210
215 3300005338 Ga0068868_100262267 Ga0068868_1002622672 210
216 3300005339 Ga0070660_100000009 Ga0070660_100000009129 210
217 3300005339 Ga0070660_100015323 Ga0070660_1000153236 210
218 3300005339 Ga0070660_100024872 Ga0070660_1000248727 210
219 3300005339 Ga0070660_100036443 Ga0070660_1000364433 210
220 3300005339 Ga0070660_100241976 Ga0070660_1002419762 210
221 3300005340 Ga0070689_100087959 Ga0070689_1000879592 210
222 3300005340 Ga0070689_100361944 Ga0070689_1003619442 210
223 3300005343 Ga0070687_100231287 Ga0070687_1002312871 210
224 3300005344 Ga0070661_100004664 Ga0070661_1000046644 210
225 3300005344 Ga0070661_100025955 Ga0070661_1000259557 210
226 3300005344 Ga0070661_100059404 Ga0070661_1000594045 210
227 3300005347 Ga0070668_100049993 Ga0070668_1000499932 210
228 3300005353 Ga0070669_100025171 Ga0070669_1000251715 210
229 3300005355 Ga0070671_100023503 Ga0070671_1000235037 210
230 3300005355 Ga0070671_100079096 Ga0070671_1000790962 210
231 3300005355 Ga0070671_100099485 Ga0070671_1000994853 210
232 3300005355 Ga0070671_100182543 Ga0070671_1001825432 210
233 3300005355 Ga0070671_100248541 Ga0070671_1002485412 210
234 3300005364 Ga0070673_100000446 Ga0070673_10000044627 210
235 3300005364 Ga0070673_100001436 Ga0070673_10000143617 210
236 3300005364 Ga0070673_100657816 Ga0070673_1006578162 210
237 3300005366 Ga0070659_100000048 Ga0070659_10000004899 210
238 3300005366 Ga0070659_100001857 Ga0070659_1000018573 210
239 3300005366 Ga0070659_100019853 Ga0070659_1000198534 210
240 3300005366 Ga0070659_100022668 Ga0070659_1000226684 210
241 3300005366 Ga0070659_100035024 Ga0070659_1000350245 210
242 3300005366 Ga0070659_100155484 Ga0070659_1001554843 210
243 3300005367 Ga0070667_100007807 Ga0070667_1000078075 210
244 3300005367 Ga0070667_100033661 Ga0070667_1000336613 210
245 3300005434 Ga0070709_10826795 Ga0070709_108267951 210
246 3300005435 Ga0070714_100019356 Ga0070714_1000193565 210
247 3300005435 Ga0070714_100251389 Ga0070714_1002513891 210
248 3300005435 Ga0070714_100300429 Ga0070714_1003004292 210
249 3300005435 Ga0070714_100491506 Ga0070714_1004915062 210
250 3300005436 Ga0070713_100352346 Ga0070713_1003523461 210
251 3300005436 Ga0070713_100381073 Ga0070713_1003810731 210
252 3300005455 Ga0070663_100000206 Ga0070663_10000020629 210
253 3300005457 Ga0070662_100001541 Ga0070662_1000015414 210
254 3300005457 Ga0070662_100140661 Ga0070662_1001406612 210
255 3300005457 Ga0070662_100156438 Ga0070662_1001564383 210
256 3300005457 Ga0070662_100460721 Ga0070662_1004607212 210
257 3300005457 Ga0070662_100659604 Ga0070662_1006596041 210
258 3300005458 Ga0070681_10029148 Ga0070681_100291485 210
259 3300005459 Ga0068867_100000783 Ga0068867_10000078329 210
260 3300005459 Ga0068867_100086353 Ga0068867_1000863533 210
261 3300005466 Ga0070685_10388674 Ga0070685_103886742 210
262 3300005530 Ga0070679_100024260 Ga0070679_1000242606 210
263 3300005530 Ga0070679_100703979 Ga0070679_1007039792 210
264 3300005539 Ga0068853_100000128 Ga0068853_10000012853 210
265 3300005539 Ga0068853_100001812 Ga0068853_10000181218 210
266 3300005539 Ga0068853_100068180 Ga0068853_1000681804 210
267 3300005539 Ga0068853_100068562 Ga0068853_1000685621 210
268 3300005543 Ga0070672_100006530 Ga0070672_10000653010 210
269 3300005544 Ga0070686_100033475 Ga0070686_1000334755 210
270 3300005546 Ga0070696_100312398 Ga0070696_1003123982 210
271 3300005547 Ga0070693_100000442 Ga0070693_1000004427 210
272 3300005548 Ga0070665_100007376 Ga0070665_1000073764 210
273 3300005548 Ga0070665_100201176 Ga0070665_1002011762 210
274 3300005563 Ga0068855_100001099 Ga0068855_10000109940 210
275 3300005563 Ga0068855_100013196 Ga0068855_1000131965 210
276 3300005564 Ga0070664_100000103 Ga0070664_10000010332 210
277 3300005564 Ga0070664_100012104 Ga0070664_1000121043 210
278 3300005564 Ga0070664_100059891 Ga0070664_1000598915 210
279 3300005564 Ga0070664_100081093 Ga0070664_1000810932 210
280 3300005564 Ga0070664_100459666 Ga0070664_1004596662 210
281 3300005577 Ga0068857_100016760 Ga0068857_1000167608 210
282 3300005577 Ga0068857_100104155 Ga0068857_1001041554 210
283 3300005578 Ga0068854_100054864 Ga0068854_1000548643 210
284 3300005578 Ga0068854_100073006 Ga0068854_1000730063 210
285 3300005578 Ga0068854_100088971 Ga0068854_1000889712 210
286 3300005614 Ga0068856_100000628 Ga0068856_10000062828 210
287 3300005614 Ga0068856_100060163 Ga0068856_1000601635 210
288 3300005615 Ga0070702_100386252 Ga0070702_1003862521 210
289 3300005616 Ga0068852_100069152 Ga0068852_1000691521 210
290 3300005616 Ga0068852_100104438 Ga0068852_1001044384 210
291 3300005616 Ga0068852_100191862 Ga0068852_1001918623 210
292 3300005616 Ga0068852_100980769 Ga0068852_1009807692 210
293 3300005617 Ga0068859_100010266 Ga0068859_1000102663 210
294 3300005617 Ga0068859_100139046 Ga0068859_1001390463 210
295 3300005618 Ga0068864_100020762 Ga0068864_1000207623 210
296 3300005618 Ga0068864_100045926 Ga0068864_1000459265 210
297 3300005718 Ga0068866_10050559 Ga0068866_100505593 210
298 3300005834 Ga0068851_10016573 Ga0068851_100165732 210
299 3300005834 Ga0068851_10084511 Ga0068851_100845113 210
300 3300005834 Ga0068851_10164347 Ga0068851_101643473 210
301 3300005841 Ga0068863_100009975 Ga0068863_10000997513 210
302 3300005841 Ga0068863_100267292 Ga0068863_1002672923 210
303 3300005842 Ga0068858_100004213 Ga0068858_10000421317 210
304 3300005842 Ga0068858_100008278 Ga0068858_1000082789 210
305 3300006175 Ga0070712_100026912 Ga0070712_1000269126 210
306 3300006175 Ga0070712_100035420 Ga0070712_1000354204 210
307 3300006237 Ga0097621_100016835 Ga0097621_1000168351 210
308 3300006237 Ga0097621_100034264 Ga0097621_1000342641 210
309 3300006237 Ga0097621_100605896 Ga0097621_1006058962 210
310 3300006358 Ga0068871_100181331 Ga0068871_1001813314 210
311 3300006881 Ga0068865_100002068 Ga0068865_10000206814 210
312 3300006931 Ga0097620_100003214 Ga0097620_1000032142 210
313 3300006931 Ga0097620_100010266 Ga0097620_1000102663 210
314 3300006931 Ga0097620_100139031 Ga0097620_1001390313 210
315 3300006946 Ga0079104_1015083 Ga0079104_10150832 210
316 3300009093 Ga0105240_10086142 Ga0105240_100861425 210
317 3300009093 Ga0105240_10671053 Ga0105240_106710532 210
318 3300009098 Ga0105245_10001091 Ga0105245_1000109122 210
319 3300009098 Ga0105245_10042780 Ga0105245_100427808 210
320 3300009098 Ga0105245_10527559 Ga0105245_105275593 210
321 3300009148 Ga0105243_10075398 Ga0105243_100753982 210
322 3300009174 Ga0105241_10015776 Ga0105241_100157768 210
323 3300009176 Ga0105242_10008858 Ga0105242_100088583 210
324 3300009177 Ga0105248_10000297 Ga0105248_1000029736 210
325 3300009177 Ga0105248_10000414 Ga0105248_1000041411 210
326 3300009177 Ga0105248_10006323 Ga0105248_1000632311 210
327 3300009177 Ga0105248_10096794 Ga0105248_100967943 210
328 3300009177 Ga0105248_10180354 Ga0105248_101803542 210
329 3300009177 Ga0105248_10182740 Ga0105248_101827403 210
330 3300009177 Ga0105248_10714779 Ga0105248_107147792 210
331 3300009545 Ga0105237_10082574 Ga0105237_100825742 210
332 3300009551 Ga0105238_10041328 Ga0105238_100413287 210
333 3300009551 Ga0105238_10063110 Ga0105238_100631104 210
334 3300009551 Ga0105238_10098701 Ga0105238_100987013 210
335 3300009551 Ga0105238_10449095 Ga0105238_104490952 210
336 3300009551 Ga0105238_10831750 Ga0105238_108317502 210
337 3300010375 Ga0105239_10050138 Ga0105239_100501385 210
338 3300010375 Ga0105239_11032517 Ga0105239_110325172 210
339 3300013100 Ga0157373_10025005 Ga0157373_100250055 210
340 3300013100 Ga0157373_10059921 Ga0157373_100599213 210
341 3300013100 Ga0157373_10178265 Ga0157373_101782653 210
342 3300013100 Ga0157373_10361044 Ga0157373_103610442 210
343 3300013102 Ga0157371_10169001 Ga0157371_101690013 210
344 3300013102 Ga0157371_10452361 Ga0157371_104523612 210
345 3300013104 Ga0157370_10035973 Ga0157370_100359733 210
346 3300013104 Ga0157370_10183019 Ga0157370_101830192 210
347 3300013105 Ga0157369_10428190 Ga0157369_104281902 210
348 3300013105 Ga0157369_10741563 Ga0157369_107415632 210
349 3300013296 Ga0157374_10202842 Ga0157374_102028423 210
350 3300013297 Ga0157378_10002757 Ga0157378_100027576 210
351 3300013307 Ga0157372_10315474 Ga0157372_103154742 210
352 3300013307 Ga0157372_10764136 Ga0157372_107641363 210
353 3300013308 Ga0157375_10834632 Ga0157375_108346322 210
354 3300014325 Ga0163163_10447252 Ga0163163_104472522 210
355 3300014968 Ga0157379_10066941 Ga0157379_100669414 210
356 3300025298 Ga0209050_1000196 Ga0209050_100019637 210
357 3300025304 Ga0209257_1000228 Ga0209257_100022837 210
358 3300025315 Ga0207697_10000395 Ga0207697_1000039532 210
359 3300025321 Ga0207656_10036350 Ga0207656_100363503 210
360 3300025321 Ga0207656_10278728 Ga0207656_102787281 210
361 3300025893 Ga0207682_10148014 Ga0207682_101480142 210
362 3300025899 Ga0207642_10012228 Ga0207642_100122283 210
363 3300025901 Ga0207688_10003889 Ga0207688_100038892 210
364 3300025901 Ga0207688_10144834 Ga0207688_101448342 210
365 3300025903 Ga0207680_10004995 Ga0207680_100049955 210
366 3300025903 Ga0207680_10081029 Ga0207680_100810291 210
367 3300025903 Ga0207680_10091511 Ga0207680_100915114 210
368 3300025904 Ga0207647_10001213 Ga0207647_1000121318 210
369 3300025904 Ga0207647_10006843 Ga0207647_100068433 210
370 3300025904 Ga0207647_10007549 Ga0207647_100075497 210
371 3300025904 Ga0207647_10035313 Ga0207647_100353135 210
372 3300025904 Ga0207647_10040748 Ga0207647_100407482 210
373 3300025906 Ga0207699_10159640 Ga0207699_101596403 210
374 3300025907 Ga0207645_10102997 Ga0207645_101029972 210
375 3300025909 Ga0207705_10000687 Ga0207705_1000068720 210
376 3300025909 Ga0207705_10010806 Ga0207705_100108062 210
377 3300025909 Ga0207705_10017971 Ga0207705_100179712 210
378 3300025909 Ga0207705_10156274 Ga0207705_101562742 210
379 3300025909 Ga0207705_10351883 Ga0207705_103518832 210
380 3300025909 Ga0207705_10407975 Ga0207705_104079752 210
381 3300025912 Ga0207707_10124744 Ga0207707_101247444 210
382 3300025912 Ga0207707_10303004 Ga0207707_103030041 210
383 3300025913 Ga0207695_10021882 Ga0207695_1002188210 210
384 3300025913 Ga0207695_10106503 Ga0207695_101065032 210
385 3300025914 Ga0207671_10018200 Ga0207671_100182006 210
386 3300025915 Ga0207693_10025117 Ga0207693_100251174 210
387 3300025915 Ga0207693_10051844 Ga0207693_100518442 210
388 3300025918 Ga0207662_10138557 Ga0207662_101385572 210
389 3300025919 Ga0207657_10000328 Ga0207657_1000032828 210
390 3300025919 Ga0207657_10004948 Ga0207657_100049483 210
391 3300025919 Ga0207657_10021872 Ga0207657_100218723 210
392 3300025919 Ga0207657_10053502 Ga0207657_100535023 210
393 3300025919 Ga0207657_10186556 Ga0207657_101865562 210
394 3300025919 Ga0207657_10197227 Ga0207657_101972273 210
395 3300025920 Ga0207649_10000266 Ga0207649_1000026644 210
396 3300025920 Ga0207649_10012449 Ga0207649_100124494 210
397 3300025920 Ga0207649_10124375 Ga0207649_101243752 210
398 3300025921 Ga0207652_10343137 Ga0207652_103431372 210
399 3300025924 Ga0207694_10012943 Ga0207694_1001294310 210
400 3300025925 Ga0207650_10192962 Ga0207650_101929622 210
401 3300025925 Ga0207650_10213544 Ga0207650_102135443 210
402 3300025926 Ga0207659_10045060 Ga0207659_100450602 210
403 3300025927 Ga0207687_10013213 Ga0207687_100132135 210
404 3300025928 Ga0207700_10360673 Ga0207700_103606732 210
405 3300025929 Ga0207664_10150196 Ga0207664_101501963 210
406 3300025929 Ga0207664_10278136 Ga0207664_102781362 210
407 3300025931 Ga0207644_10020579 Ga0207644_100205793 210
408 3300025931 Ga0207644_10033102 Ga0207644_100331022 210
409 3300025931 Ga0207644_10045298 Ga0207644_100452985 210
410 3300025931 Ga0207644_10108920 Ga0207644_101089203 210
411 3300025931 Ga0207644_10179244 Ga0207644_101792443 210
412 3300025931 Ga0207644_10226016 Ga0207644_102260163 210
413 3300025932 Ga0207690_10000036 Ga0207690_1000003682 210
414 3300025932 Ga0207690_10001858 Ga0207690_1000185811 210
415 3300025932 Ga0207690_10015838 Ga0207690_100158388 210
416 3300025932 Ga0207690_10022443 Ga0207690_100224432 210
417 3300025932 Ga0207690_10032424 Ga0207690_100324245 210
418 3300025932 Ga0207690_10087864 Ga0207690_100878644 210
419 3300025932 Ga0207690_10243415 Ga0207690_102434153 210
420 3300025932 Ga0207690_10360111 Ga0207690_103601111 210
421 3300025933 Ga0207706_10000343 Ga0207706_1000034328 210
422 3300025933 Ga0207706_10003563 Ga0207706_1000356318 210
423 3300025933 Ga0207706_10007986 Ga0207706_1000798612 210
424 3300025933 Ga0207706_10018619 Ga0207706_100186193 210
425 3300025933 Ga0207706_10056327 Ga0207706_100563273 210
426 3300025933 Ga0207706_10162443 Ga0207706_101624432 210
427 3300025933 Ga0207706_10355816 Ga0207706_103558162 210
428 3300025933 Ga0207706_10647945 Ga0207706_106479451 210
429 3300025934 Ga0207686_10022649 Ga0207686_100226492 210
430 3300025936 Ga0207670_10071690 Ga0207670_100716904 210
431 3300025937 Ga0207669_10026267 Ga0207669_100262675 210
432 3300025937 Ga0207669_10071518 Ga0207669_100715184 210
433 3300025938 Ga0207704_10007716 Ga0207704_100077167 210
434 3300025940 Ga0207691_10003655 Ga0207691_1000365518 210
435 3300025940 Ga0207691_10220553 Ga0207691_102205533 210
436 3300025941 Ga0207711_10001320 Ga0207711_100013207 210
437 3300025941 Ga0207711_10001646 Ga0207711_1000164622 210
438 3300025941 Ga0207711_10015976 Ga0207711_100159764 210
439 3300025941 Ga0207711_10285631 Ga0207711_102856312 210
440 3300025941 Ga0207711_10452490 Ga0207711_104524902 210
441 3300025942 Ga0207689_10000064 Ga0207689_1000006496 210
442 3300025942 Ga0207689_10057515 Ga0207689_100575155 210
443 3300025944 Ga0207661_10005937 Ga0207661_100059377 210
444 3300025944 Ga0207661_10156444 Ga0207661_101564442 210
445 3300025944 Ga0207661_10463149 Ga0207661_104631492 210
446 3300025945 Ga0207679_10000093 Ga0207679_1000009383 210
447 3300025945 Ga0207679_10041973 Ga0207679_100419735 210
448 3300025945 Ga0207679_10081648 Ga0207679_100816483 210
449 3300025945 Ga0207679_10448970 Ga0207679_104489702 210
450 3300025949 Ga0207667_10002660 Ga0207667_1000266022 210
451 3300025949 Ga0207667_10052389 Ga0207667_100523893 210
452 3300025949 Ga0207667_10112196 Ga0207667_101121963 210
453 3300025949 Ga0207667_10382992 Ga0207667_103829923 210
454 3300025960 Ga0207651_10005110 Ga0207651_100051103 210
455 3300025960 Ga0207651_10017646 Ga0207651_100176467 210
456 3300025981 Ga0207640_10003887 Ga0207640_100038873 210
457 3300025981 Ga0207640_10039525 Ga0207640_100395255 210
458 3300025981 Ga0207640_10084736 Ga0207640_100847363 210
459 3300025981 Ga0207640_10387550 Ga0207640_103875502 210
460 3300025986 Ga0207658_10008692 Ga0207658_100086923 210
461 3300025986 Ga0207658_10014467 Ga0207658_100144676 210
462 3300026023 Ga0207677_10004612 Ga0207677_1000461211 210
463 3300026023 Ga0207677_10010570 Ga0207677_100105705 210
464 3300026023 Ga0207677_10021327 Ga0207677_100213272 210
465 3300026035 Ga0207703_10009696 Ga0207703_100096969 210
466 3300026041 Ga0207639_10000181 Ga0207639_1000018150 210
467 3300026041 Ga0207639_10001001 Ga0207639_1000100111 210
468 3300026041 Ga0207639_10012668 Ga0207639_100126685 210
469 3300026041 Ga0207639_10104115 Ga0207639_101041153 210
470 3300026041 Ga0207639_10207876 Ga0207639_102078762 210
471 3300026041 Ga0207639_10812081 Ga0207639_108120812 210
472 3300026067 Ga0207678_10016076 Ga0207678_100160768 210
473 3300026067 Ga0207678_10439851 Ga0207678_104398512 210
474 3300026078 Ga0207702_10000619 Ga0207702_1000061918 210
475 3300026078 Ga0207702_10227219 Ga0207702_102272193 210
476 3300026088 Ga0207641_10009194 Ga0207641_100091941 210
477 3300026088 Ga0207641_10128150 Ga0207641_101281504 210
478 3300026089 Ga0207648_10001433 Ga0207648_100014334 210
479 3300026089 Ga0207648_10012796 Ga0207648_100127963 210
480 3300026095 Ga0207676_10008272 Ga0207676_100082724 210
481 3300026095 Ga0207676_10022808 Ga0207676_100228085 210
482 3300026095 Ga0207676_10737792 Ga0207676_107377922 210
483 3300026116 Ga0207674_10000362 Ga0207674_100003623 210
484 3300026142 Ga0207698_10032294 Ga0207698_100322947 210
485 3300026142 Ga0207698_10130214 Ga0207698_101302143 210
486 3300026142 Ga0207698_10407881 Ga0207698_104078812 210
487 3300028379 Ga0268266_10043975 Ga0268266_100439755 210
488 3300030745 Ga0316182_1275706 Ga0316182_12757062 210
489 3300031548 Ga0307408_100015823 Ga0307408_1000158235 210
490 3300031731 Ga0307405_10007792 Ga0307405_100077923 210
491 3300031731 Ga0307405_10501509 Ga0307405_105015091 210
492 3300031824 Ga0307413_10010199 Ga0307413_100101993 210
493 3300031824 Ga0307413_10029365 Ga0307413_100293652 210
494 3300031824 Ga0307413_10052076 Ga0307413_100520763 210
495 3300031852 Ga0307410_10022349 Ga0307410_100223494 210
496 3300031852 Ga0307410_10023263 Ga0307410_100232632 210
497 3300031852 Ga0307410_10148658 Ga0307410_101486582 210
498 3300031852 Ga0307410_10231187 Ga0307410_102311873 210
499 3300031901 Ga0307406_10473810 Ga0307406_104738101 210
500 3300031911 Ga0307412_10018297 Ga0307412_100182973 210
501 3300031911 Ga0307412_10154327 Ga0307412_101543272 210
502 3300031995 Ga0307409_100016356 Ga0307409_1000163562 210
503 3300031995 Ga0307409_100017678 Ga0307409_1000176784 210
504 3300031995 Ga0307409_100233720 Ga0307409_1002337202 210
505 3300031995 Ga0307409_100334247 Ga0307409_1003342472 210
506 3300031995 Ga0307409_100452026 Ga0307409_1004520262 210
507 3300032002 Ga0307416_100031238 Ga0307416_1000312384 210
508 3300032002 Ga0307416_100132859 Ga0307416_1001328593 210
509 3300032002 Ga0307416_100189337 Ga0307416_1001893372 210
510 3300032004 Ga0307414_10003907 Ga0307414_100039075 210
511 3300032004 Ga0307414_10008735 Ga0307414_100087356 210
512 3300032004 Ga0307414_10691994 Ga0307414_106919941 210
513 3300032004 Ga0307414_10854181 Ga0307414_108541811 210
514 3300032005 Ga0307411_10062642 Ga0307411_100626422 210
515 3300032005 Ga0307411_10145241 Ga0307411_101452412 210
516 3300032005 Ga0307411_10169322 Ga0307411_101693222 210
517 3300032005 Ga0307411_10224898 Ga0307411_102248983 210
518 3300032126 Ga0307415_100001022 Ga0307415_10000102211 210
519 3300032126 Ga0307415_100059281 Ga0307415_1000592815 210
520 3300032126 Ga0307415_100547343 Ga0307415_1005473432 210
521 3300032126 Ga0307415_100810204 Ga0307415_1008102042 210
522 3300032126 Ga0307415_100955601 Ga0307415_1009556012 210
523 3300035115 Ga0373941_0062330 Ga0373941_0062330_59_691 210
524 3300035118 Ga0373954_0014179 Ga0373954_0014179_2513_3145 210
525 3300035119 Ga0373956_0129933 Ga0373956_0129933_175_807 210
526 3300035120 Ga0373957_0093949 Ga0373957_0093949_263_895 210
527 3300035172 Ga0373955_0171458 Ga0373955_0171458_238_870 210
528 3300035692 Ga0373935_0013673 Ga0373935_0013673_1047_1691 210
529 3300035724 Ga0373933_0032271 Ga0373933_0032271_2265_2897 210
530 3300036401 Ga0373937_0735746 Ga0373937_0735746_266_898 210
531 3300037312 Ga0395899_0005641 Ga0395899_0005641_4911_5543 210
532 3300037312 Ga0395899_0102371 Ga0395899_0102371_435_1067 210
533 3300037312 Ga0395899_0110605 Ga0395899_0110605_726_1358 210
534 3300037312 Ga0395899_0214659 Ga0395899_0214659_388_1020 210
535 3300037418 Ga0395900_0008585 Ga0395900_0008585_5459_6091 210
536 3300037418 Ga0395900_0078348 Ga0395900_0078348_844_1476 210
537 3300037418 Ga0395900_0244413 Ga0395900_0244413_360_992 210
538 3300037418 Ga0395900_0308688 Ga0395900_0308688_757_1389 210
539 3300037418 Ga0395900_0337410 Ga0395900_0337410_274_906 210
540 3300037418 Ga0395900_0602316 Ga0395900_0602316_131_763 210
541 3300037418 Ga0395900_0861606 Ga0395900_0861606_78_710 210
542 3300037418 Ga0395900_1021730 Ga0395900_1021730_23_655 210
543 3300037466 Ga0395898_0018636 Ga0395898_0018636_2402_3034 210
544 3300037466 Ga0395898_0189075 Ga0395898_0189075_925_1557 210
545 3300037466 Ga0395898_0411747 Ga0395898_0411747_330_962 210
546 3300037466 Ga0395898_0423447 Ga0395898_0423447_365_997 210
547 3300037471 Ga0395905_0001643 Ga0395905_0001643_504_1136 210
548 3300037471 Ga0395905_0017198 Ga0395905_0017198_5201_5833 210
549 3300037471 Ga0395905_0021280 Ga0395905_0021280_4235_4867 210
550 3300037471 Ga0395905_0028612 Ga0395905_0028612_1902_2534 210
551 3300037471 Ga0395905_0029023 Ga0395905_0029023_3925_4557 210
552 3300037471 Ga0395905_0051871 Ga0395905_0051871_745_1377 210
553 3300037471 Ga0395905_0092678 Ga0395905_0092678_165_797 210
554 3300037471 Ga0395905_0266508 Ga0395905_0266508_778_1410 210
555 3300037471 Ga0395905_0277926 Ga0395905_0277926_748_1380 210
556 3300037471 Ga0395905_0308970 Ga0395905_0308970_213_845 210
557 3300037471 Ga0395905_0403210 Ga0395905_0403210_81_713 210
558 3300037471 Ga0395905_0579052 Ga0395905_0579052_11_643 210
559 3300037471 Ga0395905_0740337 Ga0395905_0740337_30_662 210
560 3300038443 Ga0395901_0011073 Ga0395901_0011073_5723_6355 210
561 3300038443 Ga0395901_0080177 Ga0395901_0080177_2727_3359 210
562 3300038443 Ga0395901_0210708 Ga0395901_0210708_562_1194 210
563 3300038443 Ga0395901_0211297 Ga0395901_0211297_724_1356 210
564 3300038443 Ga0395901_0219707 Ga0395901_0219707_1102_1734 210
565 3300038443 Ga0395901_0247874 Ga0395901_0247874_503_1135 210
566 3300038443 Ga0395901_0510036 Ga0395901_0510036_550_1182 210
567 3300038443 Ga0395901_0679560 Ga0395901_0679560_311_1009 210
568 3300038443 Ga0395901_0958842 Ga0395901_0958842_53_685 210
569 3300041406 Ga0439439_0057648 Ga0439439_0057648_374_1009 210
570 3300041410 Ga0439461_0000953 Ga0439461_0000953_2149_2781 210
571 3300041411 Ga0439466_0087119 Ga0439466_0087119_43_675 210
572 3300041413 Ga0439465_0021114 Ga0439465_0021114_1293_1925 210
573 3300041997 Ga0439431_0000563 Ga0439431_0000563_6203_6835 210
574 3300041997 Ga0439431_0026902 Ga0439431_0026902_393_1025 210
575 3300041999 Ga0439433_0025223 Ga0439433_0025223_342_977 210
576 3300042002 Ga0439442_001886 Ga0439442_001886_1795_2427 210
577 3300042006 Ga0439432_004764 Ga0439432_004764_4276_4908 210
578 3300042006 Ga0439432_007739 Ga0439432_007739_1640_2272 210
579 3300042007 Ga0439449_0007785 Ga0439449_0007785_1859_2494 210
580 3300042010 Ga0439452_010735 Ga0439452_010735_690_1322 210
581 3300042010 Ga0439452_013439 Ga0439452_013439_1620_2252 210
582 3300042014 Ga0439457_019302 Ga0439457_019302_142_777 210
583 3300042015 Ga0439462_0002116 Ga0439462_0002116_3812_4444 210
584 3300042015 Ga0439462_0002981 Ga0439462_0002981_2588_3220 210
585 3300042015 Ga0439462_0003345 Ga0439462_0003345_2214_2849 210
586 3300042122 Ga0450920_019086 Ga0450920_019086_212_844 210
587 3300042147 Ga0450910_020656 Ga0450910_020656_96_728 210
588 3300042156 Ga0439446_0004477 Ga0439446_0004477_1531_2163 210
589 3300042435 Ga0439434_0003047 Ga0439434_0003047_3975_4607 210
590 3300042436 Ga0439435_0007674 Ga0439435_0007674_1642_2277 210
591 3300042438 Ga0439459_0045532 Ga0439459_0045532_53_685 210
592 3300042439 Ga0439464_0000505 Ga0439464_0000505_3272_3904 210
593 3300044684 Ga0466966_0334809 Ga0466966_0334809_89_721 210
594 3300044684 Ga0466966_0399262 Ga0466966_0399262_15_647 210
595 3300044694 Ga0466963_0213257 Ga0466963_0213257_491_1123 210
596 3300044842 Ga0466957_0009572 Ga0466957_0009572_4580_5212 210
597 3300045836 Ga0466958_0139002 Ga0466958_0139002_352_984 210
598 3300045976 Ga0466967_0000133 Ga0466967_0000133_27027_27659 210
599 3300045976 Ga0466967_0046579 Ga0466967_0046579_3051_3683 210
600 3300045976 Ga0466967_0214774 Ga0466967_0214774_122_754 210
601 3300045976 Ga0466967_0290441 Ga0466967_0290441_664_1296 210
602 3300045976 Ga0466967_1051046 Ga0466967_1051046_29_661 210
603 3300046474 Ga0495605_0021457 Ga0495605_0021457_1516_2151 210
604 3300046477 Ga0495664_0132475 Ga0495664_0132475_149_784 210
605 3300046500 Ga0495596_0001537 Ga0495596_0001537_10298_10933 210
606 3300046524 Ga0495648_0042974 Ga0495648_0042974_194_829 210
607 3300046679 Ga0495623_0093081 Ga0495623_0093081_122_754 210
608 3300046794 Ga0495589_0002666 Ga0495589_0002666_1194_1829 210
609 3300047320 Ga0495672_0002926 Ga0495672_0002926_10776_11411 210
610 3300047321 Ga0495676_0217383 Ga0495676_0217383_108_743 210
611 3300047321 Ga0495676_0342410 Ga0495676_0342410_25_660 210
612 3300047323 Ga0495683_0005799 Ga0495683_0005799_3315_3950 210
613 3300047472 Ga0495686_0086693 Ga0495686_0086693_1205_1837 210
614 3300048904 Ga0496101_0073073 Ga0496101_0073073_526_1158 210
615 3300048904 Ga0496101_0085324 Ga0496101_0085324_388_1020 210
616 3300048905 Ga0496102_0274902 Ga0496102_0274902_769_1401 210
617 3300048907 Ga0496104_0502613 Ga0496104_0502613_415_1047 210
618 3300048908 Ga0496105_0294417 Ga0496105_0294417_49_681 210
619 3300048909 Ga0496106_0120790 Ga0496106_0120790_33_665 210
620 3300048910 Ga0496107_0201335 Ga0496107_0201335_349_981 210
621 3300048911 Ga0496108_0284916 Ga0496108_0284916_97_729 210
622 3300048912 Ga0496109_0038485 Ga0496109_0038485_1528_2160 210
623 3300048912 Ga0496109_0097557 Ga0496109_0097557_137_769 210
624 3300048913 Ga0496110_0010972 Ga0496110_0010972_6046_6678 210
625 3300048915 Ga0496112_0007779 Ga0496112_0007779_417_1049 210
626 3300048915 Ga0496112_0018391 Ga0496112_0018391_746_1378 210
627 3300048917 Ga0496114_0000023 Ga0496114_0000023_100693_101382 210
628 3300048926 Ga0496123_0073772 Ga0496123_0073772_613_1245 210
629 3300048927 Ga0496124_0014216 Ga0496124_0014216_5546_6178 210
630 3300048928 Ga0496125_0242838 Ga0496125_0242838_286_918 210
631 3300048928 Ga0496125_0367203 Ga0496125_0367203_156_788 210
632 3300049590 Ga0501074_0063590 Ga0501074_0063590_639_1271 210
633 3300049758 Ga0501241_001096 Ga0501241_001096_3684_4316 210
634 3300050507 nmdc:mga05p37_364249_c1 nmdc:mga05p37_364249_c1_687_1322 210
635 3300053087 Ga0500643_000113 Ga0500643_000113_78028_78660 210
636 3300053119 Ga0500595_000845 Ga0500595_000845_209_841 210
637 3300053136 Ga0500559_0022982 Ga0500559_0022982_140_772 210
638 3300053730 Ga0500645_003965 Ga0500645_003965_4389_5021 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

62

171

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4njh-assembly1.cif.gz_B crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin 0.9406 3 210
4njh-assembly1.cif.gz_B crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin 0.9319 3 210
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.7118 1 200
6nhl-assembly1.cif.gz_B-2 crystal structure of quee from escherichia coli 0.6828 1 200
6nhl-assembly1.cif.gz_A crystal structure of quee from escherichia coli 0.6776 1 200
ID Description Score Start End Superfamily
4njjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9416 3 210 3.20.20.70
4njjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9328 3 210 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7126 3 210 3.20.20.70
af_P64554_2_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7035 3 210 3.20.20.70
af_Q2G1X7_4_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6977 4 207 3.20.20.70
ID Description Score Start End GO Terms
AF-T1AMR5-F1-model_v4 Radical SAM domain-containing protein 0.9839 40 170 GO:0003824
GO:0046872
GO:0051539
AF-A0A2M6ZU27-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9813 1 168 GO:0008616
GO:0016829
GO:0046872
GO:0051539
AF-A0A2N2HHH9-F1-model_v4 7-carboxy-7-deazaguanine synthase 0.9806 1 177 GO:0008616
GO:0046872
GO:0051539
AF-A0A383C6W6-F1-model_v4 Radical SAM core domain-containing protein 0.9805 3 138 GO:0003824
GO:0046872
GO:0051539
AF-A0A3N5GZG2-F1-model_v4 7-carboxy-7-deazaguanine synthase (EC 4.3.99.3) 0.9776 1 170 GO:0008616
GO:0016829
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
93.15 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map