F471525
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 638 | 290 | 630 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100452026|Ga0307409_1004520262 |
| Length | 232 |
| Sequence | MSVQNRPSPRLPSASRRSPASGRGYAVKECFLTLQGEGMQSGSRAVFLRFAGCNLWSGREQDRASAQCTFCDTDFVGTDGEGGGKFGDPEELAAHVERLWGEGREDRLVVVTGGEPMLQLDEALVEAMHARGFRVAVESNGTLPATAGIDWLCISPKAGTAVVQRSGNELKLVWPQAGIDPADLEGWAFDHFLVQPMDCEQRAEALDAAIALAMERPKWRLSLQAHKVIGLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 2 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 3 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 4 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 5 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 6 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 7 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 8 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 152 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 153 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 188 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 189 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 190 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 191 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 192 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 193 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 194 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 195 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 196 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 197 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 198 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 199 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 200 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 201 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 202 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 203 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 204 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 205 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 206 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 207 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 208 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 209 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 275 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 276 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 277 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 285 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 286 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 287 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 288 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 290 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.75 |
| Metatranscriptomes | 0 |
| Isolates | 1.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.51 |
| Nodule | 0.16 |
| Rhizoplane | 2.66 |
| Rhizosphere | 92.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008549 | 3300001979 | Bacteria | 4071 |
| 2 | JGI24740J21852_10011893 | 3300001979 | Bacteria | 3300 |
| 3 | JGI24737J22298_10000139 | 3300001990 | Bacteria | 22332 |
| 4 | JGI24737J22298_10006334 | 3300001990 | Bacteria | 4047 |
| 5 | JGI24737J22298_10020485 | 3300001990 | Bacteria | 2111 |
| 6 | JGI24735J21928_10003189 | 3300002067 | Bacteria | 5607 |
| 7 | JGI24738J21930_10003779 | 3300002075 | Bacteria | 3784 |
| 8 | JGI24738J21930_10006669 | 3300002075 | Bacteria | 2686 |
| 9 | Ga0055530_10000332 | 3300003791 | Bacteria | 42713 |
| 10 | Ga0055531_10000384 | 3300003794 | Bacteria | 42713 |
| 11 | Ga0070658_10000165 | 3300005327 | Bacteria | 57646 |
| 12 | Ga0070658_10093280 | 3300005327 | Bacteria | 2483 |
| 13 | Ga0070658_10125223 | 3300005327 | Bacteria | 2138 |
| 14 | Ga0070676_10149520 | 3300005328 | Bacteria | 1494 |
| 15 | Ga0070683_100003336 | 3300005329 | Bacteria | 12986 |
| 16 | Ga0070683_100155467 | 3300005329 | Bacteria | 2169 |
| 17 | Ga0070690_100004009 | 3300005330 | Bacteria | 8147 |
| 18 | Ga0070670_100101501 | 3300005331 | Bacteria | 2477 |
| 19 | Ga0070670_100273816 | 3300005331 | Bacteria | 1473 |
| 20 | Ga0068869_100004289 | 3300005334 | Bacteria | 8852 |
| 21 | Ga0070666_10007235 | 3300005335 | Bacteria | 6841 |
| 22 | Ga0070666_10008069 | 3300005335 | Bacteria | 6518 |
| 23 | Ga0070680_100020619 | 3300005336 | Bacteria | 5233 |
| 24 | Ga0068868_100003061 | 3300005338 | Bacteria | 11644 |
| 25 | Ga0068868_100007425 | 3300005338 | Bacteria | 7805 |
| 26 | Ga0068868_100011768 | 3300005338 | Bacteria | 6377 |
| 27 | Ga0068868_100262267 | 3300005338 | Bacteria | 1457 |
| 28 | Ga0070660_100000009 | 3300005339 | Bacteria | 145691 |
| 29 | Ga0070660_100015323 | 3300005339 | Bacteria | 5533 |
| 30 | Ga0070660_100024872 | 3300005339 | Bacteria | 4447 |
| 31 | Ga0070660_100036443 | 3300005339 | Bacteria | 3726 |
| 32 | Ga0070660_100241976 | 3300005339 | Bacteria | 1470 |
| 33 | Ga0070689_100087959 | 3300005340 | Bacteria | 2445 |
| 34 | Ga0070689_100361944 | 3300005340 | Bacteria | 1219 |
| 35 | Ga0070689_100377209 | 3300005340 | Bacteria | 1195 |
| 36 | Ga0070687_100231287 | 3300005343 | Bacteria | 1138 |
| 37 | Ga0070661_100004664 | 3300005344 | Bacteria | 9443 |
| 38 | Ga0070661_100025955 | 3300005344 | Bacteria | 4210 |
| 39 | Ga0070661_100059404 | 3300005344 | Bacteria | 2804 |
| 40 | Ga0070668_100049993 | 3300005347 | Bacteria | 3218 |
| 41 | Ga0070669_100025171 | 3300005353 | Bacteria | 4273 |
| 42 | Ga0070675_100044023 | 3300005354 | Bacteria | 3650 |
| 43 | Ga0070671_100023503 | 3300005355 | Bacteria | 5045 |
| 44 | Ga0070671_100079096 | 3300005355 | Bacteria | 2748 |
| 45 | Ga0070671_100099485 | 3300005355 | Bacteria | 2439 |
| 46 | Ga0070671_100182543 | 3300005355 | Bacteria | 1776 |
| 47 | Ga0070671_100248541 | 3300005355 | Bacteria | 1511 |
| 48 | Ga0070673_100000446 | 3300005364 | Bacteria | 21860 |
| 49 | Ga0070673_100001436 | 3300005364 | Bacteria | 13933 |
| 50 | Ga0070673_100146726 | 3300005364 | Bacteria | 1995 |
| 51 | Ga0070673_100657816 | 3300005364 | Bacteria | 959 |
| 52 | Ga0070688_100011769 | 3300005365 | Bacteria | 4877 |
| 53 | Ga0070659_100000048 | 3300005366 | Bacteria | 98245 |
| 54 | Ga0070659_100001857 | 3300005366 | Bacteria | 15173 |
| 55 | Ga0070659_100019853 | 3300005366 | Bacteria | 5100 |
| 56 | Ga0070659_100022668 | 3300005366 | Bacteria | 4795 |
| 57 | Ga0070659_100035024 | 3300005366 | Bacteria | 3907 |
| 58 | Ga0070659_100155484 | 3300005366 | Bacteria | 1867 |
| 59 | Ga0070667_100006690 | 3300005367 | Bacteria | 9578 |
| 60 | Ga0070667_100007807 | 3300005367 | Bacteria | 8872 |
| 61 | Ga0070667_100033661 | 3300005367 | Bacteria | 4286 |
| 62 | Ga0070709_10826795 | 3300005434 | Bacteria | 728 |
| 63 | Ga0070714_100019356 | 3300005435 | Bacteria | 5543 |
| 64 | Ga0070714_100251389 | 3300005435 | Bacteria | 1634 |
| 65 | Ga0070714_100300429 | 3300005435 | Bacteria | 1496 |
| 66 | Ga0070714_100491506 | 3300005435 | Bacteria | 1169 |
| 67 | Ga0070713_100352346 | 3300005436 | Bacteria | 1366 |
| 68 | Ga0070713_100381073 | 3300005436 | Bacteria | 1314 |
| 69 | Ga0070701_10112587 | 3300005438 | Bacteria | 1523 |
| 70 | Ga0070663_100000206 | 3300005455 | Bacteria | 29502 |
| 71 | Ga0070662_100001541 | 3300005457 | Bacteria | 14213 |
| 72 | Ga0070662_100140661 | 3300005457 | Bacteria | 1870 |
| 73 | Ga0070662_100156438 | 3300005457 | Bacteria | 1779 |
| 74 | Ga0070662_100460721 | 3300005457 | Bacteria | 1056 |
| 75 | Ga0070662_100659604 | 3300005457 | Bacteria | 883 |
| 76 | Ga0070681_10029148 | 3300005458 | Bacteria | 5541 |
| 77 | Ga0068867_100000783 | 3300005459 | Bacteria | 21489 |
| 78 | Ga0068867_100086353 | 3300005459 | Bacteria | 2374 |
| 79 | Ga0070685_10388674 | 3300005466 | Bacteria | 963 |
| 80 | Ga0070679_100024260 | 3300005530 | Bacteria | 5943 |
| 81 | Ga0070679_100565983 | 3300005530 | Bacteria | 1080 |
| 82 | Ga0070679_100703979 | 3300005530 | Bacteria | 953 |
| 83 | Ga0070684_100024921 | 3300005535 | Bacteria | 5022 |
| 84 | Ga0068853_100000128 | 3300005539 | Bacteria | 51089 |
| 85 | Ga0068853_100001812 | 3300005539 | Bacteria | 15714 |
| 86 | Ga0068853_100008324 | 3300005539 | Bacteria | 8330 |
| 87 | Ga0068853_100068180 | 3300005539 | Bacteria | 3092 |
| 88 | Ga0068853_100068562 | 3300005539 | Bacteria | 3084 |
| 89 | Ga0070672_100006530 | 3300005543 | Bacteria | 7841 |
| 90 | Ga0070672_100032899 | 3300005543 | Bacteria | 3920 |
| 91 | Ga0070686_100033475 | 3300005544 | Bacteria | 3158 |
| 92 | Ga0070696_100312398 | 3300005546 | Bacteria | 1207 |
| 93 | Ga0070693_100000442 | 3300005547 | Bacteria | 18676 |
| 94 | Ga0070693_100001354 | 3300005547 | Bacteria | 11024 |
| 95 | Ga0070665_100007376 | 3300005548 | Bacteria | 11185 |
| 96 | Ga0070665_100201176 | 3300005548 | Bacteria | 1992 |
| 97 | Ga0068855_100001099 | 3300005563 | Bacteria | 33610 |
| 98 | Ga0068855_100013196 | 3300005563 | Bacteria | 9966 |
| 99 | Ga0068855_100058901 | 3300005563 | Bacteria | 4496 |
| 100 | Ga0070664_100000103 | 3300005564 | Bacteria | 54853 |
| 101 | Ga0070664_100012104 | 3300005564 | Bacteria | 7008 |
| 102 | Ga0070664_100059891 | 3300005564 | Bacteria | 3240 |
| 103 | Ga0070664_100081093 | 3300005564 | Bacteria | 2795 |
| 104 | Ga0070664_100195508 | 3300005564 | Bacteria | 1803 |
| 105 | Ga0070664_100459666 | 3300005564 | Bacteria | 1169 |
| 106 | Ga0068857_100016760 | 3300005577 | Bacteria | 6419 |
| 107 | Ga0068857_100069677 | 3300005577 | Bacteria | 3132 |
| 108 | Ga0068857_100104155 | 3300005577 | Bacteria | 2547 |
| 109 | Ga0068857_100263208 | 3300005577 | Bacteria | 1583 |
| 110 | Ga0068854_100054864 | 3300005578 | Bacteria | 2868 |
| 111 | Ga0068854_100073006 | 3300005578 | Bacteria | 2513 |
| 112 | Ga0068854_100088971 | 3300005578 | Bacteria | 2294 |
| 113 | Ga0068856_100000628 | 3300005614 | Bacteria | 38462 |
| 114 | Ga0068856_100060163 | 3300005614 | Bacteria | 3753 |
| 115 | Ga0070702_100163265 | 3300005615 | Bacteria | 1442 |
| 116 | Ga0070702_100386252 | 3300005615 | Bacteria | 997 |
| 117 | Ga0068852_100003881 | 3300005616 | Bacteria | 10506 |
| 118 | Ga0068852_100069152 | 3300005616 | Bacteria | 3093 |
| 119 | Ga0068852_100104438 | 3300005616 | Bacteria | 2564 |
| 120 | Ga0068852_100191862 | 3300005616 | Bacteria | 1928 |
| 121 | Ga0068852_100280322 | 3300005616 | Bacteria | 1606 |
| 122 | Ga0068852_100980769 | 3300005616 | Bacteria | 863 |
| 123 | Ga0068859_100010266 | 3300005617 | Bacteria | 9425 |
| 124 | Ga0068859_100139046 | 3300005617 | Bacteria | 2502 |
| 125 | Ga0068859_100515567 | 3300005617 | Bacteria | 1291 |
| 126 | Ga0068864_100020762 | 3300005618 | Bacteria | 5497 |
| 127 | Ga0068864_100045926 | 3300005618 | Bacteria | 3747 |
| 128 | Ga0068864_100174079 | 3300005618 | Bacteria | 1964 |
| 129 | Ga0068866_10050559 | 3300005718 | Bacteria | 2111 |
| 130 | Ga0068851_10016573 | 3300005834 | Bacteria | 3528 |
| 131 | Ga0068851_10084511 | 3300005834 | Bacteria | 1662 |
| 132 | Ga0068851_10164347 | 3300005834 | Bacteria | 1221 |
| 133 | Ga0068863_100009975 | 3300005841 | Bacteria | 9246 |
| 134 | Ga0068863_100267292 | 3300005841 | Bacteria | 1655 |
| 135 | Ga0068858_100004213 | 3300005842 | Bacteria | 14161 |
| 136 | Ga0068858_100008278 | 3300005842 | Bacteria | 9997 |
| 137 | Ga0068858_100016585 | 3300005842 | Bacteria | 6918 |
| 138 | Ga0068860_100038414 | 3300005843 | Bacteria | 4579 |
| 139 | Ga0070712_100026912 | 3300006175 | Bacteria | 3837 |
| 140 | Ga0070712_100035420 | 3300006175 | Bacteria | 3388 |
| 141 | Ga0075367_10004493 | 3300006178 | Bacteria | 6818 |
| 142 | Ga0097621_100016835 | 3300006237 | Bacteria | 5539 |
| 143 | Ga0097621_100026258 | 3300006237 | Bacteria | 4566 |
| 144 | Ga0097621_100034264 | 3300006237 | Bacteria | 4049 |
| 145 | Ga0097621_100605896 | 3300006237 | Bacteria | 1001 |
| 146 | Ga0068871_100181331 | 3300006358 | Bacteria | 1810 |
| 147 | Ga0068871_100192279 | 3300006358 | Bacteria | 1758 |
| 148 | Ga0068871_100507786 | 3300006358 | Bacteria | 1087 |
| 149 | Ga0068865_100002068 | 3300006881 | Bacteria | 11853 |
| 150 | Ga0097620_100003214 | 3300006931 | Bacteria | 16634 |
| 151 | Ga0097620_100010266 | 3300006931 | Bacteria | 9425 |
| 152 | Ga0097620_100139031 | 3300006931 | Bacteria | 2502 |
| 153 | Ga0097620_100515546 | 3300006931 | Bacteria | 1291 |
| 154 | Ga0079104_1015083 | 3300006946 | Bacteria | 2304 |
| 155 | Ga0075435_100723981 | 3300007076 | Bacteria | 865 |
| 156 | Ga0105240_10086142 | 3300009093 | Bacteria | 3847 |
| 157 | Ga0105240_10671053 | 3300009093 | Bacteria | 1134 |
| 158 | Ga0105245_10001091 | 3300009098 | Bacteria | 24614 |
| 159 | Ga0105245_10042780 | 3300009098 | Bacteria | 4040 |
| 160 | Ga0105245_10527559 | 3300009098 | Bacteria | 1200 |
| 161 | Ga0105243_10075398 | 3300009148 | Bacteria | 2738 |
| 162 | Ga0105241_10015776 | 3300009174 | Bacteria | 5534 |
| 163 | Ga0105242_10008858 | 3300009176 | Bacteria | 7724 |
| 164 | Ga0105242_10025177 | 3300009176 | Bacteria | 4705 |
| 165 | Ga0105248_10000297 | 3300009177 | Bacteria | 59111 |
| 166 | Ga0105248_10000414 | 3300009177 | Bacteria | 49092 |
| 167 | Ga0105248_10006323 | 3300009177 | Bacteria | 12999 |
| 168 | Ga0105248_10033619 | 3300009177 | Bacteria | 5728 |
| 169 | Ga0105248_10075926 | 3300009177 | Bacteria | 3777 |
| 170 | Ga0105248_10096794 | 3300009177 | Bacteria | 3325 |
| 171 | Ga0105248_10180354 | 3300009177 | Bacteria | 2380 |
| 172 | Ga0105248_10182740 | 3300009177 | Bacteria | 2363 |
| 173 | Ga0105248_10714779 | 3300009177 | Bacteria | 1130 |
| 174 | Ga0105237_10082574 | 3300009545 | Bacteria | 3204 |
| 175 | Ga0105237_10337564 | 3300009545 | Bacteria | 1511 |
| 176 | Ga0105238_10030461 | 3300009551 | Bacteria | 5493 |
| 177 | Ga0105238_10041328 | 3300009551 | Bacteria | 4670 |
| 178 | Ga0105238_10056524 | 3300009551 | Bacteria | 3936 |
| 179 | Ga0105238_10063110 | 3300009551 | Bacteria | 3705 |
| 180 | Ga0105238_10097118 | 3300009551 | Bacteria | 2932 |
| 181 | Ga0105238_10098701 | 3300009551 | Bacteria | 2904 |
| 182 | Ga0105238_10449095 | 3300009551 | Bacteria | 1286 |
| 183 | Ga0105238_10831750 | 3300009551 | Bacteria | 940 |
| 184 | Ga0105239_10050138 | 3300010375 | Bacteria | 4579 |
| 185 | Ga0105239_11032517 | 3300010375 | Bacteria | 946 |
| 186 | Ga0157373_10025005 | 3300013100 | Bacteria | 4323 |
| 187 | Ga0157373_10059921 | 3300013100 | Bacteria | 2697 |
| 188 | Ga0157373_10178265 | 3300013100 | Bacteria | 1496 |
| 189 | Ga0157373_10361044 | 3300013100 | Bacteria | 1037 |
| 190 | Ga0157371_10169001 | 3300013102 | Bacteria | 1562 |
| 191 | Ga0157371_10452361 | 3300013102 | Bacteria | 944 |
| 192 | Ga0157370_10035973 | 3300013104 | Bacteria | 4809 |
| 193 | Ga0157370_10183019 | 3300013104 | Bacteria | 1946 |
| 194 | Ga0157369_10002180 | 3300013105 | Bacteria | 23585 |
| 195 | Ga0157369_10428190 | 3300013105 | Bacteria | 1372 |
| 196 | Ga0157369_10524142 | 3300013105 | Bacteria | 1226 |
| 197 | Ga0157369_10741563 | 3300013105 | Bacteria | 1011 |
| 198 | Ga0157369_11048311 | 3300013105 | Bacteria | 834 |
| 199 | Ga0157374_10011307 | 3300013296 | Bacteria | 7720 |
| 200 | Ga0157374_10202842 | 3300013296 | Bacteria | 1942 |
| 201 | Ga0157378_10002757 | 3300013297 | Bacteria | 15650 |
| 202 | Ga0157378_10031060 | 3300013297 | Bacteria | 4717 |
| 203 | Ga0163162_10618092 | 3300013306 | Bacteria | 1209 |
| 204 | Ga0157372_10001198 | 3300013307 | Bacteria | 28062 |
| 205 | Ga0157372_10006297 | 3300013307 | Bacteria | 12618 |
| 206 | Ga0157372_10315474 | 3300013307 | Bacteria | 1820 |
| 207 | Ga0157372_10764136 | 3300013307 | Bacteria | 1124 |
| 208 | Ga0157375_10174290 | 3300013308 | Bacteria | 2300 |
| 209 | Ga0157375_10202627 | 3300013308 | Bacteria | 2140 |
| 210 | Ga0157375_10834632 | 3300013308 | Bacteria | 1069 |
| 211 | Ga0163163_10447252 | 3300014325 | Bacteria | 1352 |
| 212 | Ga0157379_10066941 | 3300014968 | Bacteria | 3212 |
| 213 | Ga0157379_10124251 | 3300014968 | Bacteria | 2322 |
| 214 | Ga0209050_1000196 | 3300025298 | Bacteria | 135678 |
| 215 | Ga0209257_1000228 | 3300025304 | Bacteria | 133390 |
| 216 | Ga0207697_10000395 | 3300025315 | Bacteria | 24502 |
| 217 | Ga0207656_10036350 | 3300025321 | Bacteria | 2067 |
| 218 | Ga0207656_10278728 | 3300025321 | Bacteria | 824 |
| 219 | Ga0207682_10148014 | 3300025893 | Bacteria | 1057 |
| 220 | Ga0207642_10012228 | 3300025899 | Bacteria | 3092 |
| 221 | Ga0207688_10003889 | 3300025901 | Bacteria | 8146 |
| 222 | Ga0207688_10144834 | 3300025901 | Bacteria | 1400 |
| 223 | Ga0207680_10004995 | 3300025903 | Bacteria | 6319 |
| 224 | Ga0207680_10081029 | 3300025903 | Bacteria | 2039 |
| 225 | Ga0207680_10091511 | 3300025903 | Bacteria | 1936 |
| 226 | Ga0207647_10001213 | 3300025904 | Bacteria | 19829 |
| 227 | Ga0207647_10006843 | 3300025904 | Bacteria | 8268 |
| 228 | Ga0207647_10007549 | 3300025904 | Bacteria | 7844 |
| 229 | Ga0207647_10035313 | 3300025904 | Bacteria | 3186 |
| 230 | Ga0207647_10040748 | 3300025904 | Bacteria | 2923 |
| 231 | Ga0207699_10159640 | 3300025906 | Bacteria | 1500 |
| 232 | Ga0207645_10102997 | 3300025907 | Bacteria | 1843 |
| 233 | Ga0207643_10183037 | 3300025908 | Bacteria | 1269 |
| 234 | Ga0207705_10000687 | 3300025909 | Bacteria | 28005 |
| 235 | Ga0207705_10010806 | 3300025909 | Bacteria | 6628 |
| 236 | Ga0207705_10017971 | 3300025909 | Bacteria | 5057 |
| 237 | Ga0207705_10153738 | 3300025909 | Bacteria | 1725 |
| 238 | Ga0207705_10156274 | 3300025909 | Bacteria | 1711 |
| 239 | Ga0207705_10351883 | 3300025909 | Bacteria | 1135 |
| 240 | Ga0207705_10407975 | 3300025909 | Bacteria | 1051 |
| 241 | Ga0207707_10124744 | 3300025912 | Bacteria | 2252 |
| 242 | Ga0207707_10303004 | 3300025912 | Bacteria | 1382 |
| 243 | Ga0207695_10021882 | 3300025913 | Bacteria | 7279 |
| 244 | Ga0207695_10106503 | 3300025913 | Bacteria | 2790 |
| 245 | Ga0207695_10488736 | 3300025913 | Bacteria | 1113 |
| 246 | Ga0207671_10018200 | 3300025914 | Bacteria | 5398 |
| 247 | Ga0207693_10025117 | 3300025915 | Bacteria | 4726 |
| 248 | Ga0207693_10051844 | 3300025915 | Bacteria | 3218 |
| 249 | Ga0207662_10036490 | 3300025918 | Bacteria | 2873 |
| 250 | Ga0207662_10138557 | 3300025918 | Bacteria | 1540 |
| 251 | Ga0207657_10000328 | 3300025919 | Bacteria | 50486 |
| 252 | Ga0207657_10004948 | 3300025919 | Bacteria | 14020 |
| 253 | Ga0207657_10021872 | 3300025919 | Bacteria | 6006 |
| 254 | Ga0207657_10053502 | 3300025919 | Bacteria | 3497 |
| 255 | Ga0207657_10120977 | 3300025919 | Bacteria | 2154 |
| 256 | Ga0207657_10186556 | 3300025919 | Bacteria | 1674 |
| 257 | Ga0207657_10197227 | 3300025919 | Bacteria | 1621 |
| 258 | Ga0207649_10000266 | 3300025920 | Bacteria | 41245 |
| 259 | Ga0207649_10012449 | 3300025920 | Bacteria | 4721 |
| 260 | Ga0207649_10124375 | 3300025920 | Bacteria | 1743 |
| 261 | Ga0207652_10113438 | 3300025921 | Bacteria | 2406 |
| 262 | Ga0207652_10343137 | 3300025921 | Bacteria | 1348 |
| 263 | Ga0207694_10012943 | 3300025924 | Bacteria | 6283 |
| 264 | Ga0207694_10065141 | 3300025924 | Bacteria | 2841 |
| 265 | Ga0207694_10204035 | 3300025924 | Bacteria | 1609 |
| 266 | Ga0207650_10192962 | 3300025925 | Bacteria | 1628 |
| 267 | Ga0207650_10213544 | 3300025925 | Bacteria | 1550 |
| 268 | Ga0207659_10001230 | 3300025926 | Bacteria | 15325 |
| 269 | Ga0207659_10045060 | 3300025926 | Bacteria | 3107 |
| 270 | Ga0207687_10013213 | 3300025927 | Bacteria | 5392 |
| 271 | Ga0207700_10360673 | 3300025928 | Bacteria | 1267 |
| 272 | Ga0207664_10150196 | 3300025929 | Bacteria | 1978 |
| 273 | Ga0207664_10278136 | 3300025929 | Bacteria | 1468 |
| 274 | Ga0207644_10020579 | 3300025931 | Bacteria | 4488 |
| 275 | Ga0207644_10033102 | 3300025931 | Bacteria | 3609 |
| 276 | Ga0207644_10045298 | 3300025931 | Bacteria | 3129 |
| 277 | Ga0207644_10108920 | 3300025931 | Bacteria | 2092 |
| 278 | Ga0207644_10179244 | 3300025931 | Bacteria | 1659 |
| 279 | Ga0207644_10226016 | 3300025931 | Bacteria | 1485 |
| 280 | Ga0207690_10000036 | 3300025932 | Bacteria | 143853 |
| 281 | Ga0207690_10001858 | 3300025932 | Bacteria | 12978 |
| 282 | Ga0207690_10015838 | 3300025932 | Bacteria | 4576 |
| 283 | Ga0207690_10022443 | 3300025932 | Bacteria | 3928 |
| 284 | Ga0207690_10032424 | 3300025932 | Bacteria | 3352 |
| 285 | Ga0207690_10087864 | 3300025932 | Bacteria | 2188 |
| 286 | Ga0207690_10243415 | 3300025932 | Bacteria | 1386 |
| 287 | Ga0207690_10360111 | 3300025932 | Bacteria | 1152 |
| 288 | Ga0207706_10000343 | 3300025933 | Bacteria | 50497 |
| 289 | Ga0207706_10003563 | 3300025933 | Bacteria | 14869 |
| 290 | Ga0207706_10007986 | 3300025933 | Bacteria | 9772 |
| 291 | Ga0207706_10018619 | 3300025933 | Bacteria | 6247 |
| 292 | Ga0207706_10056327 | 3300025933 | Bacteria | 3466 |
| 293 | Ga0207706_10162443 | 3300025933 | Bacteria | 1963 |
| 294 | Ga0207706_10355816 | 3300025933 | Bacteria | 1273 |
| 295 | Ga0207706_10647945 | 3300025933 | Bacteria | 905 |
| 296 | Ga0207686_10022649 | 3300025934 | Bacteria | 3620 |
| 297 | Ga0207686_10540713 | 3300025934 | Bacteria | 909 |
| 298 | Ga0207670_10043542 | 3300025936 | Bacteria | 2965 |
| 299 | Ga0207670_10071690 | 3300025936 | Bacteria | 2397 |
| 300 | Ga0207670_10259115 | 3300025936 | Bacteria | 1347 |
| 301 | Ga0207669_10026267 | 3300025937 | Bacteria | 3164 |
| 302 | Ga0207669_10071518 | 3300025937 | Bacteria | 2180 |
| 303 | Ga0207704_10007716 | 3300025938 | Bacteria | 5102 |
| 304 | Ga0207691_10003655 | 3300025940 | Bacteria | 14921 |
| 305 | Ga0207691_10011643 | 3300025940 | Bacteria | 8444 |
| 306 | Ga0207691_10220553 | 3300025940 | Bacteria | 1644 |
| 307 | Ga0207711_10001320 | 3300025941 | Bacteria | 23464 |
| 308 | Ga0207711_10001646 | 3300025941 | Bacteria | 20609 |
| 309 | Ga0207711_10003531 | 3300025941 | Bacteria | 13537 |
| 310 | Ga0207711_10015976 | 3300025941 | Bacteria | 6227 |
| 311 | Ga0207711_10103991 | 3300025941 | Bacteria | 2515 |
| 312 | Ga0207711_10285631 | 3300025941 | Bacteria | 1520 |
| 313 | Ga0207711_10452490 | 3300025941 | Bacteria | 1195 |
| 314 | Ga0207689_10000064 | 3300025942 | Bacteria | 84222 |
| 315 | Ga0207689_10047262 | 3300025942 | Bacteria | 3555 |
| 316 | Ga0207689_10057515 | 3300025942 | Bacteria | 3199 |
| 317 | Ga0207661_10005937 | 3300025944 | Bacteria | 8623 |
| 318 | Ga0207661_10156444 | 3300025944 | Bacteria | 1975 |
| 319 | Ga0207661_10463149 | 3300025944 | Bacteria | 1156 |
| 320 | Ga0207679_10000093 | 3300025945 | Bacteria | 78331 |
| 321 | Ga0207679_10041973 | 3300025945 | Bacteria | 3284 |
| 322 | Ga0207679_10081648 | 3300025945 | Bacteria | 2473 |
| 323 | Ga0207679_10448970 | 3300025945 | Bacteria | 1143 |
| 324 | Ga0207667_10002660 | 3300025949 | Bacteria | 22079 |
| 325 | Ga0207667_10052389 | 3300025949 | Bacteria | 4298 |
| 326 | Ga0207667_10112196 | 3300025949 | Bacteria | 2811 |
| 327 | Ga0207667_10382992 | 3300025949 | Bacteria | 1433 |
| 328 | Ga0207667_11184107 | 3300025949 | Bacteria | 744 |
| 329 | Ga0207651_10005110 | 3300025960 | Bacteria | 6699 |
| 330 | Ga0207651_10017646 | 3300025960 | Bacteria | 4222 |
| 331 | Ga0207640_10003887 | 3300025981 | Bacteria | 8065 |
| 332 | Ga0207640_10039525 | 3300025981 | Bacteria | 2987 |
| 333 | Ga0207640_10084736 | 3300025981 | Bacteria | 2177 |
| 334 | Ga0207640_10387550 | 3300025981 | Bacteria | 1134 |
| 335 | Ga0207658_10008692 | 3300025986 | Bacteria | 6899 |
| 336 | Ga0207658_10014467 | 3300025986 | Bacteria | 5403 |
| 337 | Ga0207658_10015737 | 3300025986 | Bacteria | 5193 |
| 338 | Ga0207677_10004612 | 3300026023 | Bacteria | 7411 |
| 339 | Ga0207677_10010570 | 3300026023 | Bacteria | 5231 |
| 340 | Ga0207677_10021327 | 3300026023 | Bacteria | 3956 |
| 341 | Ga0207677_10040808 | 3300026023 | Bacteria | 3063 |
| 342 | Ga0207677_10267707 | 3300026023 | Bacteria | 1396 |
| 343 | Ga0207703_10009696 | 3300026035 | Bacteria | 7558 |
| 344 | Ga0207703_10228396 | 3300026035 | Bacteria | 1667 |
| 345 | Ga0207639_10000181 | 3300026041 | Bacteria | 49444 |
| 346 | Ga0207639_10001001 | 3300026041 | Bacteria | 19216 |
| 347 | Ga0207639_10007544 | 3300026041 | Bacteria | 7419 |
| 348 | Ga0207639_10012668 | 3300026041 | Bacteria | 5881 |
| 349 | Ga0207639_10104115 | 3300026041 | Bacteria | 2301 |
| 350 | Ga0207639_10207876 | 3300026041 | Bacteria | 1683 |
| 351 | Ga0207639_10812081 | 3300026041 | Bacteria | 872 |
| 352 | Ga0207678_10016076 | 3300026067 | Bacteria | 6571 |
| 353 | Ga0207678_10439851 | 3300026067 | Bacteria | 1132 |
| 354 | Ga0207708_10323191 | 3300026075 | Bacteria | 1260 |
| 355 | Ga0207702_10000619 | 3300026078 | Bacteria | 39068 |
| 356 | Ga0207702_10227219 | 3300026078 | Bacteria | 1742 |
| 357 | Ga0207641_10009194 | 3300026088 | Bacteria | 8154 |
| 358 | Ga0207641_10128150 | 3300026088 | Bacteria | 2275 |
| 359 | Ga0207648_10001433 | 3300026089 | Bacteria | 26248 |
| 360 | Ga0207648_10012796 | 3300026089 | Bacteria | 7839 |
| 361 | Ga0207676_10008272 | 3300026095 | Bacteria | 7398 |
| 362 | Ga0207676_10022808 | 3300026095 | Bacteria | 4608 |
| 363 | Ga0207676_10737792 | 3300026095 | Bacteria | 957 |
| 364 | Ga0207674_10000362 | 3300026116 | Bacteria | 58887 |
| 365 | Ga0207674_10006311 | 3300026116 | Bacteria | 13969 |
| 366 | Ga0207698_10001267 | 3300026142 | Bacteria | 14725 |
| 367 | Ga0207698_10005169 | 3300026142 | Bacteria | 8023 |
| 368 | Ga0207698_10032294 | 3300026142 | Bacteria | 3791 |
| 369 | Ga0207698_10130214 | 3300026142 | Bacteria | 2148 |
| 370 | Ga0207698_10407881 | 3300026142 | Bacteria | 1300 |
| 371 | Ga0268266_10043975 | 3300028379 | Bacteria | 3817 |
| 372 | Ga0268264_10028095 | 3300028381 | Bacteria | 4601 |
| 373 | Ga0307517_10147460 | 3300028786 | Bacteria | 1627 |
| 374 | Ga0316182_1275706 | 3300030745 | Bacteria | 2131 |
| 375 | Ga0265320_10107652 | 3300031240 | Bacteria | 1279 |
| 376 | Ga0307408_100015823 | 3300031548 | Bacteria | 5026 |
| 377 | Ga0265314_10005218 | 3300031711 | Bacteria | 11786 |
| 378 | Ga0307405_10007792 | 3300031731 | Bacteria | 5389 |
| 379 | Ga0307405_10013530 | 3300031731 | Bacteria | 4356 |
| 380 | Ga0307405_10501509 | 3300031731 | Bacteria | 973 |
| 381 | Ga0307413_10010199 | 3300031824 | Bacteria | 4541 |
| 382 | Ga0307413_10029365 | 3300031824 | Bacteria | 3075 |
| 383 | Ga0307413_10052076 | 3300031824 | Bacteria | 2470 |
| 384 | Ga0307410_10005283 | 3300031852 | Bacteria | 6813 |
| 385 | Ga0307410_10022349 | 3300031852 | Bacteria | 3907 |
| 386 | Ga0307410_10023263 | 3300031852 | Bacteria | 3848 |
| 387 | Ga0307410_10148658 | 3300031852 | Bacteria | 1741 |
| 388 | Ga0307410_10231187 | 3300031852 | Bacteria | 1428 |
| 389 | Ga0307406_10172156 | 3300031901 | Bacteria | 1568 |
| 390 | Ga0307406_10473810 | 3300031901 | Bacteria | 1010 |
| 391 | Ga0307407_10037682 | 3300031903 | Bacteria | 2673 |
| 392 | Ga0307412_10015024 | 3300031911 | Bacteria | 4580 |
| 393 | Ga0307412_10018297 | 3300031911 | Bacteria | 4213 |
| 394 | Ga0307412_10154327 | 3300031911 | Bacteria | 1698 |
| 395 | Ga0307409_100016356 | 3300031995 | Bacteria | 4905 |
| 396 | Ga0307409_100017678 | 3300031995 | Bacteria | 4762 |
| 397 | Ga0307409_100022190 | 3300031995 | Bacteria | 4370 |
| 398 | Ga0307409_100077353 | 3300031995 | Bacteria | 2672 |
| 399 | Ga0307409_100233720 | 3300031995 | Bacteria | 1668 |
| 400 | Ga0307409_100334247 | 3300031995 | Bacteria | 1423 |
| 401 | Ga0307409_100452026 | 3300031995 | Bacteria | 1240 |
| 402 | Ga0307416_100031238 | 3300032002 | Bacteria | 4006 |
| 403 | Ga0307416_100042709 | 3300032002 | Bacteria | 3542 |
| 404 | Ga0307416_100132859 | 3300032002 | Bacteria | 2245 |
| 405 | Ga0307416_100189337 | 3300032002 | Bacteria | 1938 |
| 406 | Ga0307414_10003907 | 3300032004 | Bacteria | 8032 |
| 407 | Ga0307414_10008735 | 3300032004 | Bacteria | 5774 |
| 408 | Ga0307414_10068537 | 3300032004 | Bacteria | 2546 |
| 409 | Ga0307414_10161782 | 3300032004 | Bacteria | 1779 |
| 410 | Ga0307414_10691994 | 3300032004 | Bacteria | 922 |
| 411 | Ga0307414_10854181 | 3300032004 | Bacteria | 832 |
| 412 | Ga0307411_10062642 | 3300032005 | Bacteria | 2481 |
| 413 | Ga0307411_10145241 | 3300032005 | Bacteria | 1755 |
| 414 | Ga0307411_10169322 | 3300032005 | Bacteria | 1645 |
| 415 | Ga0307411_10224898 | 3300032005 | Bacteria | 1458 |
| 416 | Ga0307415_100001022 | 3300032126 | Bacteria | 12921 |
| 417 | Ga0307415_100059281 | 3300032126 | Bacteria | 2639 |
| 418 | Ga0307415_100190657 | 3300032126 | Bacteria | 1617 |
| 419 | Ga0307415_100547343 | 3300032126 | Bacteria | 1021 |
| 420 | Ga0307415_100810204 | 3300032126 | Bacteria | 855 |
| 421 | Ga0307415_100955601 | 3300032126 | Bacteria | 793 |
| 422 | Ga0373923_0024351 | 3300035111 | Bacteria | 2388 |
| 423 | Ga0373941_0062330 | 3300035115 | Bacteria | 1217 |
| 424 | Ga0373953_0008522 | 3300035117 | Bacteria | 3487 |
| 425 | Ga0373954_0014179 | 3300035118 | Bacteria | 3553 |
| 426 | Ga0373956_0129933 | 3300035119 | Bacteria | 1179 |
| 427 | Ga0373957_0093949 | 3300035120 | Bacteria | 1195 |
| 428 | Ga0373943_0047225 | 3300035170 | Bacteria | 2104 |
| 429 | Ga0373946_0052697 | 3300035171 | Bacteria | 1707 |
| 430 | Ga0373955_0171458 | 3300035172 | Bacteria | 1284 |
| 431 | Ga0373955_0181052 | 3300035172 | Bacteria | 1250 |
| 432 | Ga0373924_0012481 | 3300035410 | Bacteria | 3175 |
| 433 | Ga0373924_0033713 | 3300035410 | Bacteria | 2069 |
| 434 | Ga0373935_0013673 | 3300035692 | Bacteria | 4899 |
| 435 | Ga0373933_0024198 | 3300035724 | Bacteria | 3476 |
| 436 | Ga0373933_0032271 | 3300035724 | Bacteria | 3043 |
| 437 | Ga0373947_0083889 | 3300035725 | Bacteria | 1976 |
| 438 | Ga0373937_0023839 | 3300036401 | Bacteria | 5517 |
| 439 | Ga0373937_0116212 | 3300036401 | Bacteria | 2491 |
| 440 | Ga0373937_0735746 | 3300036401 | Bacteria | 933 |
| 441 | Ga0373925_0017538 | 3300037068 | Bacteria | 5191 |
| 442 | Ga0373925_0417114 | 3300037068 | Bacteria | 1096 |
| 443 | Ga0395899_0005641 | 3300037312 | Bacteria | 9713 |
| 444 | Ga0395899_0055572 | 3300037312 | Bacteria | 2928 |
| 445 | Ga0395899_0102371 | 3300037312 | Bacteria | 2066 |
| 446 | Ga0395899_0110605 | 3300037312 | Bacteria | 1976 |
| 447 | Ga0395899_0214659 | 3300037312 | Bacteria | 1335 |
| 448 | Ga0395900_0008585 | 3300037418 | Bacteria | 10500 |
| 449 | Ga0395900_0046362 | 3300037418 | Bacteria | 4475 |
| 450 | Ga0395900_0078348 | 3300037418 | Bacteria | 3396 |
| 451 | Ga0395900_0244413 | 3300037418 | Bacteria | 1799 |
| 452 | Ga0395900_0308688 | 3300037418 | Bacteria | 1565 |
| 453 | Ga0395900_0337410 | 3300037418 | Bacteria | 1483 |
| 454 | Ga0395900_0602316 | 3300037418 | Bacteria | 1039 |
| 455 | Ga0395900_0861606 | 3300037418 | Bacteria | 831 |
| 456 | Ga0395900_1021730 | 3300037418 | Bacteria | 746 |
| 457 | Ga0395898_0018636 | 3300037466 | Bacteria | 7076 |
| 458 | Ga0395898_0189075 | 3300037466 | Bacteria | 1968 |
| 459 | Ga0395898_0411747 | 3300037466 | Bacteria | 1289 |
| 460 | Ga0395898_0423447 | 3300037466 | Bacteria | 1269 |
| 461 | Ga0395905_0001643 | 3300037471 | Bacteria | 26485 |
| 462 | Ga0395905_0006708 | 3300037471 | Bacteria | 11526 |
| 463 | Ga0395905_0017198 | 3300037471 | Bacteria | 6869 |
| 464 | Ga0395905_0021280 | 3300037471 | Bacteria | 6137 |
| 465 | Ga0395905_0028612 | 3300037471 | Bacteria | 5253 |
| 466 | Ga0395905_0029023 | 3300037471 | Bacteria | 5214 |
| 467 | Ga0395905_0051871 | 3300037471 | Bacteria | 3842 |
| 468 | Ga0395905_0092678 | 3300037471 | Bacteria | 2833 |
| 469 | Ga0395905_0266508 | 3300037471 | Bacteria | 1598 |
| 470 | Ga0395905_0277926 | 3300037471 | Bacteria | 1560 |
| 471 | Ga0395905_0308970 | 3300037471 | Bacteria | 1469 |
| 472 | Ga0395905_0403210 | 3300037471 | Bacteria | 1262 |
| 473 | Ga0395905_0579052 | 3300037471 | Bacteria | 1024 |
| 474 | Ga0395905_0740337 | 3300037471 | Bacteria | 885 |
| 475 | Ga0395901_0011073 | 3300038443 | Bacteria | 9140 |
| 476 | Ga0395901_0051327 | 3300038443 | Bacteria | 4288 |
| 477 | Ga0395901_0080177 | 3300038443 | Bacteria | 3407 |
| 478 | Ga0395901_0210708 | 3300038443 | Bacteria | 2034 |
| 479 | Ga0395901_0211297 | 3300038443 | Bacteria | 2031 |
| 480 | Ga0395901_0219707 | 3300038443 | Bacteria | 1986 |
| 481 | Ga0395901_0247874 | 3300038443 | Bacteria | 1856 |
| 482 | Ga0395901_0510036 | 3300038443 | Bacteria | 1223 |
| 483 | Ga0395901_0679560 | 3300038443 | Bacteria | 1029 |
| 484 | Ga0395901_0958842 | 3300038443 | Bacteria | 834 |
| 485 | Ga0439439_0057648 | 3300041406 | Bacteria | 1027 |
| 486 | Ga0439461_0000953 | 3300041410 | Bacteria | 4337 |
| 487 | Ga0439466_0087119 | 3300041411 | Bacteria | 981 |
| 488 | Ga0439465_0021114 | 3300041413 | Bacteria | 2041 |
| 489 | Ga0439431_0000563 | 3300041997 | Bacteria | 7873 |
| 490 | Ga0439431_0026902 | 3300041997 | Bacteria | 1411 |
| 491 | Ga0439433_0025223 | 3300041999 | Bacteria | 1342 |
| 492 | Ga0439442_001886 | 3300042002 | Bacteria | 4110 |
| 493 | Ga0439448_0106082 | 3300042005 | Bacteria | 957 |
| 494 | Ga0439432_004764 | 3300042006 | Bacteria | 4939 |
| 495 | Ga0439432_007739 | 3300042006 | Bacteria | 3795 |
| 496 | Ga0439432_062866 | 3300042006 | Bacteria | 1142 |
| 497 | Ga0439449_0007785 | 3300042007 | Bacteria | 4068 |
| 498 | Ga0439449_0018057 | 3300042007 | Bacteria | 2648 |
| 499 | Ga0439452_010735 | 3300042010 | Bacteria | 2651 |
| 500 | Ga0439452_013439 | 3300042010 | Bacteria | 2299 |
| 501 | Ga0439455_0082190 | 3300042012 | Bacteria | 876 |
| 502 | Ga0439457_019302 | 3300042014 | Bacteria | 1514 |
| 503 | Ga0439462_0002116 | 3300042015 | Bacteria | 4560 |
| 504 | Ga0439462_0002981 | 3300042015 | Bacteria | 4015 |
| 505 | Ga0439462_0003345 | 3300042015 | Bacteria | 3840 |
| 506 | Ga0450920_019086 | 3300042122 | Bacteria | 1315 |
| 507 | Ga0450910_020656 | 3300042147 | Bacteria | 994 |
| 508 | Ga0439446_0004477 | 3300042156 | Bacteria | 3544 |
| 509 | Ga0439458_0002355 | 3300042157 | Bacteria | 4635 |
| 510 | Ga0439434_0003047 | 3300042435 | Bacteria | 4915 |
| 511 | Ga0439435_0007674 | 3300042436 | Bacteria | 2479 |
| 512 | Ga0439459_0045532 | 3300042438 | Bacteria | 947 |
| 513 | Ga0439464_0000505 | 3300042439 | Bacteria | 7960 |
| 514 | Ga0466972_0198158 | 3300044658 | Bacteria | 941 |
| 515 | Ga0466966_0334809 | 3300044684 | Bacteria | 909 |
| 516 | Ga0466966_0399262 | 3300044684 | Bacteria | 826 |
| 517 | Ga0466963_0098010 | 3300044694 | Bacteria | 2003 |
| 518 | Ga0466963_0206326 | 3300044694 | Bacteria | 1374 |
| 519 | Ga0466963_0213257 | 3300044694 | Bacteria | 1351 |
| 520 | Ga0466963_0214319 | 3300044694 | Bacteria | 1348 |
| 521 | Ga0466963_0334260 | 3300044694 | Bacteria | 1066 |
| 522 | Ga0466957_0009572 | 3300044842 | Bacteria | 5534 |
| 523 | Ga0466958_0016445 | 3300045836 | Bacteria | 4260 |
| 524 | Ga0466958_0070932 | 3300045836 | Bacteria | 2133 |
| 525 | Ga0466958_0139002 | 3300045836 | Bacteria | 1529 |
| 526 | Ga0466958_0485974 | 3300045836 | Bacteria | 801 |
| 527 | Ga0466958_0580060 | 3300045836 | Bacteria | 729 |
| 528 | Ga0466967_0000133 | 3300045976 | Bacteria | 28499 |
| 529 | Ga0466967_0046579 | 3300045976 | Bacteria | 3776 |
| 530 | Ga0466967_0121035 | 3300045976 | Bacteria | 2418 |
| 531 | Ga0466967_0214774 | 3300045976 | Bacteria | 1825 |
| 532 | Ga0466967_0290441 | 3300045976 | Bacteria | 1571 |
| 533 | Ga0466967_0367695 | 3300045976 | Bacteria | 1394 |
| 534 | Ga0466967_1051046 | 3300045976 | Bacteria | 811 |
| 535 | Ga0495592_0005965 | 3300046454 | Bacteria | 9055 |
| 536 | Ga0495592_0063692 | 3300046454 | Bacteria | 2704 |
| 537 | Ga0495653_0036851 | 3300046463 | Bacteria | 3849 |
| 538 | Ga0495582_0052086 | 3300046473 | Bacteria | 2257 |
| 539 | Ga0495605_0021457 | 3300046474 | Bacteria | 3421 |
| 540 | Ga0495664_0132475 | 3300046477 | Bacteria | 1510 |
| 541 | Ga0495664_0163719 | 3300046477 | Bacteria | 1349 |
| 542 | Ga0495585_0013212 | 3300046492 | Bacteria | 4837 |
| 543 | Ga0495596_0001537 | 3300046500 | Bacteria | 13172 |
| 544 | Ga0495608_0065445 | 3300046511 | Bacteria | 2381 |
| 545 | Ga0495618_0038467 | 3300046514 | Bacteria | 3007 |
| 546 | Ga0495628_0076019 | 3300046516 | Bacteria | 2614 |
| 547 | Ga0495630_0015746 | 3300046517 | Bacteria | 5525 |
| 548 | Ga0495648_0042974 | 3300046524 | Bacteria | 2838 |
| 549 | Ga0495663_0043457 | 3300046525 | Bacteria | 1372 |
| 550 | Ga0495642_0189865 | 3300046528 | Bacteria | 895 |
| 551 | Ga0495652_0140706 | 3300046529 | Bacteria | 1898 |
| 552 | Ga0495652_0192655 | 3300046529 | Bacteria | 1554 |
| 553 | Ga0495640_0009778 | 3300046533 | Bacteria | 7451 |
| 554 | Ga0495587_0017376 | 3300046536 | Bacteria | 4469 |
| 555 | Ga0495587_0095791 | 3300046536 | Bacteria | 1713 |
| 556 | Ga0495598_0001093 | 3300046537 | Bacteria | 5209 |
| 557 | Ga0495645_0008560 | 3300046543 | Bacteria | 7145 |
| 558 | Ga0495645_0344917 | 3300046543 | Bacteria | 961 |
| 559 | Ga0495633_0009481 | 3300046558 | Bacteria | 5372 |
| 560 | Ga0495635_0020339 | 3300046663 | Bacteria | 4624 |
| 561 | Ga0495661_0052184 | 3300046665 | Bacteria | 2465 |
| 562 | Ga0495657_0039708 | 3300046675 | Bacteria | 3233 |
| 563 | Ga0495599_0061649 | 3300046678 | Bacteria | 2343 |
| 564 | Ga0495599_0064199 | 3300046678 | Bacteria | 2294 |
| 565 | Ga0495623_0084451 | 3300046679 | Bacteria | 1959 |
| 566 | Ga0495623_0093081 | 3300046679 | Bacteria | 1846 |
| 567 | Ga0495658_0018540 | 3300046683 | Bacteria | 3620 |
| 568 | Ga0495669_0010853 | 3300046684 | Bacteria | 3856 |
| 569 | Ga0495613_0121804 | 3300046689 | Bacteria | 1873 |
| 570 | Ga0495624_0039648 | 3300046690 | Bacteria | 3019 |
| 571 | Ga0495670_0032290 | 3300046691 | Bacteria | 2603 |
| 572 | Ga0495589_0002666 | 3300046794 | Bacteria | 9870 |
| 573 | Ga0495604_0129697 | 3300047317 | Bacteria | 1814 |
| 574 | Ga0495604_0290466 | 3300047317 | Bacteria | 1101 |
| 575 | Ga0495672_0002926 | 3300047320 | Bacteria | 15087 |
| 576 | Ga0495676_0217383 | 3300047321 | Bacteria | 1319 |
| 577 | Ga0495676_0342410 | 3300047321 | Bacteria | 1001 |
| 578 | Ga0495683_0005799 | 3300047323 | Bacteria | 6798 |
| 579 | Ga0495677_0017333 | 3300047445 | Bacteria | 2612 |
| 580 | Ga0495677_0177487 | 3300047445 | Bacteria | 825 |
| 581 | Ga0495684_0009222 | 3300047471 | Bacteria | 7619 |
| 582 | Ga0495686_0086693 | 3300047472 | Bacteria | 1905 |
| 583 | Ga0495593_0078136 | 3300047673 | Bacteria | 1714 |
| 584 | Ga0496101_0073073 | 3300048904 | Bacteria | 2519 |
| 585 | Ga0496101_0085324 | 3300048904 | Bacteria | 2340 |
| 586 | Ga0496102_0274902 | 3300048905 | Bacteria | 1588 |
| 587 | Ga0496104_0502613 | 3300048907 | Bacteria | 1123 |
| 588 | Ga0496105_0294417 | 3300048908 | Bacteria | 1306 |
| 589 | Ga0496106_0120790 | 3300048909 | Bacteria | 2048 |
| 590 | Ga0496106_0531212 | 3300048909 | Bacteria | 944 |
| 591 | Ga0496107_0201335 | 3300048910 | Bacteria | 1480 |
| 592 | Ga0496108_0284916 | 3300048911 | Bacteria | 1438 |
| 593 | Ga0496109_0038485 | 3300048912 | Bacteria | 4324 |
| 594 | Ga0496109_0097557 | 3300048912 | Bacteria | 2724 |
| 595 | Ga0496110_0010972 | 3300048913 | Bacteria | 7392 |
| 596 | Ga0496110_0483076 | 3300048913 | Bacteria | 1128 |
| 597 | Ga0496112_0007779 | 3300048915 | Bacteria | 9539 |
| 598 | Ga0496112_0018391 | 3300048915 | Bacteria | 6578 |
| 599 | Ga0496114_0000023 | 3300048917 | Bacteria | 219092 |
| 600 | Ga0496123_0073772 | 3300048926 | Bacteria | 2115 |
| 601 | Ga0496124_0001391 | 3300048927 | Bacteria | 36283 |
| 602 | Ga0496124_0014216 | 3300048927 | Bacteria | 7711 |
| 603 | Ga0496124_0159289 | 3300048927 | Bacteria | 1761 |
| 604 | Ga0496125_0242838 | 3300048928 | Bacteria | 1142 |
| 605 | Ga0496125_0367203 | 3300048928 | Bacteria | 853 |
| 606 | Ga0496126_0110404 | 3300048929 | Bacteria | 2396 |
| 607 | Ga0501034_0001342 | 3300049571 | Bacteria | 33243 |
| 608 | Ga0501034_0045361 | 3300049571 | Bacteria | 4442 |
| 609 | Ga0501069_0003696 | 3300049585 | Bacteria | 7871 |
| 610 | Ga0501070_0073364 | 3300049586 | Bacteria | 2831 |
| 611 | Ga0501074_0063590 | 3300049590 | Bacteria | 2658 |
| 612 | Ga0501080_1276936 | 3300049742 | Bacteria | 629 |
| 613 | Ga0501241_001096 | 3300049758 | Bacteria | 5701 |
| 614 | nmdc:mga03n38_355252_c1 | 3300050490 | Bacteria | 798 |
| 615 | nmdc:mga00v17_1503_c1 | 3300050491 | Bacteria | 12176 |
| 616 | nmdc:mga06z11_6567_c1 | 3300050494 | Bacteria | 4745 |
| 617 | nmdc:mga07m45_99717_c1 | 3300050496 | Bacteria | 1668 |
| 618 | nmdc:mga05p37_364249_c1 | 3300050507 | Bacteria | 1698 |
| 619 | nmdc:mga0rr50_506777_c1 | 3300050513 | Bacteria | 1026 |
| 620 | Ga0495601_0013872 | 3300053077 | Bacteria | 4851 |
| 621 | Ga0495612_0013700 | 3300053078 | Bacteria | 3266 |
| 622 | Ga0495619_0017325 | 3300053085 | Bacteria | 4562 |
| 623 | Ga0500643_000113 | 3300053087 | Bacteria | 84494 |
| 624 | Ga0500594_0129594 | 3300053118 | Bacteria | 798 |
| 625 | Ga0500595_000845 | 3300053119 | Bacteria | 17481 |
| 626 | Ga0500559_0022982 | 3300053136 | Bacteria | 2646 |
| 627 | Ga0500604_0034392 | 3300053151 | Bacteria | 1503 |
| 628 | Ga0500645_003965 | 3300053730 | Bacteria | 5826 |
| 629 | Ga0500645_016872 | 3300053730 | Bacteria | 2295 |
| 630 | Ga0501082_0159598 | 3300060353 | Bacteria | 1959 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0110404 | Ga0496126_0110404_102_749 | 181 |
| 2 | 3300031911 | Ga0307412_10015024 | Ga0307412_100150245 | 187 |
| 3 | 3300044694 | Ga0466963_0098010 | Ga0466963_0098010_1226_1789 | 187 |
| 4 | 3300044694 | Ga0466963_0206326 | Ga0466963_0206326_114_677 | 187 |
| 5 | 3300044694 | Ga0466963_0214319 | Ga0466963_0214319_482_1045 | 187 |
| 6 | 3300045836 | Ga0466958_0016445 | Ga0466958_0016445_3001_3564 | 187 |
| 7 | 3300045836 | Ga0466958_0485974 | Ga0466958_0485974_28_591 | 187 |
| 8 | 3300045836 | Ga0466958_0580060 | Ga0466958_0580060_149_712 | 187 |
| 9 | 3300045976 | Ga0466967_0367695 | Ga0466967_0367695_355_918 | 187 |
| 10 | 3300046528 | Ga0495642_0189865 | Ga0495642_0189865_305_868 | 187 |
| 11 | 3300047445 | Ga0495677_0177487 | Ga0495677_0177487_252_815 | 187 |
| 12 | 3300048927 | Ga0496124_0001391 | Ga0496124_0001391_6126_6758 | 187 |
| 13 | iso_pu_bacteria | 2896429255 | 2896430684 | 190 |
| 14 | 3300053151 | Ga0500604_0034392 | Ga0500604_0034392_91_723 | 193 |
| 15 | 3300005616 | Ga0068852_100280322 | Ga0068852_1002803223 | 194 |
| 16 | 3300013105 | Ga0157369_10524142 | Ga0157369_105241422 | 194 |
| 17 | 3300013105 | Ga0157369_11048311 | Ga0157369_110483111 | 194 |
| 18 | 3300026142 | Ga0207698_10005169 | Ga0207698_100051695 | 194 |
| 19 | 3300031995 | Ga0307409_100077353 | Ga0307409_1000773532 | 194 |
| 20 | 3300032004 | Ga0307414_10068537 | Ga0307414_100685372 | 194 |
| 21 | 3300037418 | Ga0395900_0046362 | Ga0395900_0046362_3861_4445 | 194 |
| 22 | 3300044658 | Ga0466972_0198158 | Ga0466972_0198158_277_861 | 194 |
| 23 | 3300049742 | Ga0501080_1276936 | Ga0501080_1276936_29_613 | 194 |
| 24 | 3300053118 | Ga0500594_0129594 | Ga0500594_0129594_10_594 | 194 |
| 25 | 3300005577 | Ga0068857_100263208 | Ga0068857_1002632082 | 196 |
| 26 | 3300048927 | Ga0496124_0159289 | Ga0496124_0159289_55_687 | 196 |
| 27 | 3300025919 | Ga0207657_10120977 | Ga0207657_101209773 | 199 |
| 28 | 3300045836 | Ga0466958_0070932 | Ga0466958_0070932_360_959 | 199 |
| 29 | 3300031240 | Ga0265320_10107652 | Ga0265320_101076522 | 201 |
| 30 | 3300031711 | Ga0265314_10005218 | Ga0265314_1000521810 | 201 |
| 31 | 3300049571 | Ga0501034_0001342 | Ga0501034_0001342_25197_25838 | 201 |
| 32 | 3300045976 | Ga0466967_0121035 | Ga0466967_0121035_1147_1767 | 206 |
| 33 | iso_pu_bacteria | 2599185359 | 2600225564 | 206 |
| 34 | iso_pu_bacteria | 2643221622 | 2644125825 | 206 |
| 35 | iso_pu_bacteria | 2818991466 | 2819713996 | 206 |
| 36 | iso_pu_bacteria | 2830075706 | 2830078206 | 206 |
| 37 | iso_pu_bacteria | 2879163058 | 2879165084 | 206 |
| 38 | iso_pu_bacteria | 2928526807 | 2928528557 | 206 |
| 39 | iso_pu_bacteria | 2928968154 | 2928970104 | 206 |
| 40 | 3300031731 | Ga0307405_10013530 | Ga0307405_100135303 | 207 |
| 41 | 3300031852 | Ga0307410_10005283 | Ga0307410_100052835 | 207 |
| 42 | 3300031901 | Ga0307406_10172156 | Ga0307406_101721562 | 207 |
| 43 | 3300031903 | Ga0307407_10037682 | Ga0307407_100376824 | 207 |
| 44 | 3300031995 | Ga0307409_100022190 | Ga0307409_1000221906 | 207 |
| 45 | 3300032002 | Ga0307416_100042709 | Ga0307416_1000427092 | 207 |
| 46 | 3300032004 | Ga0307414_10161782 | Ga0307414_101617822 | 207 |
| 47 | 3300032126 | Ga0307415_100190657 | Ga0307415_1001906572 | 207 |
| 48 | 3300005340 | Ga0070689_100377209 | Ga0070689_1003772092 | 208 |
| 49 | 3300005438 | Ga0070701_10112587 | Ga0070701_101125872 | 208 |
| 50 | 3300005530 | Ga0070679_100565983 | Ga0070679_1005659832 | 208 |
| 51 | 3300005535 | Ga0070684_100024921 | Ga0070684_1000249215 | 208 |
| 52 | 3300005547 | Ga0070693_100001354 | Ga0070693_1000013545 | 208 |
| 53 | 3300005615 | Ga0070702_100163265 | Ga0070702_1001632652 | 208 |
| 54 | 3300005617 | Ga0068859_100515567 | Ga0068859_1005155672 | 208 |
| 55 | 3300005618 | Ga0068864_100174079 | Ga0068864_1001740792 | 208 |
| 56 | 3300005842 | Ga0068858_100016585 | Ga0068858_1000165858 | 208 |
| 57 | 3300006237 | Ga0097621_100026258 | Ga0097621_1000262588 | 208 |
| 58 | 3300006358 | Ga0068871_100192279 | Ga0068871_1001922792 | 208 |
| 59 | 3300006358 | Ga0068871_100507786 | Ga0068871_1005077862 | 208 |
| 60 | 3300006931 | Ga0097620_100515546 | Ga0097620_1005155462 | 208 |
| 61 | 3300007076 | Ga0075435_100723981 | Ga0075435_1007239812 | 208 |
| 62 | 3300009176 | Ga0105242_10025177 | Ga0105242_100251777 | 208 |
| 63 | 3300009177 | Ga0105248_10075926 | Ga0105248_100759263 | 208 |
| 64 | 3300009545 | Ga0105237_10337564 | Ga0105237_103375642 | 208 |
| 65 | 3300009551 | Ga0105238_10030461 | Ga0105238_100304613 | 208 |
| 66 | 3300009551 | Ga0105238_10097118 | Ga0105238_100971182 | 208 |
| 67 | 3300013105 | Ga0157369_10002180 | Ga0157369_1000218019 | 208 |
| 68 | 3300013296 | Ga0157374_10011307 | Ga0157374_100113077 | 208 |
| 69 | 3300013297 | Ga0157378_10031060 | Ga0157378_100310604 | 208 |
| 70 | 3300013306 | Ga0163162_10618092 | Ga0163162_106180922 | 208 |
| 71 | 3300013307 | Ga0157372_10001198 | Ga0157372_1000119816 | 208 |
| 72 | 3300013307 | Ga0157372_10006297 | Ga0157372_1000629711 | 208 |
| 73 | 3300013308 | Ga0157375_10174290 | Ga0157375_101742903 | 208 |
| 74 | 3300014968 | Ga0157379_10124251 | Ga0157379_101242514 | 208 |
| 75 | 3300025918 | Ga0207662_10036490 | Ga0207662_100364903 | 208 |
| 76 | 3300025924 | Ga0207694_10065141 | Ga0207694_100651413 | 208 |
| 77 | 3300025934 | Ga0207686_10540713 | Ga0207686_105407132 | 208 |
| 78 | 3300025936 | Ga0207670_10259115 | Ga0207670_102591152 | 208 |
| 79 | 3300025941 | Ga0207711_10103991 | Ga0207711_101039913 | 208 |
| 80 | 3300025949 | Ga0207667_11184107 | Ga0207667_111841071 | 208 |
| 81 | 3300026023 | Ga0207677_10040808 | Ga0207677_100408082 | 208 |
| 82 | 3300035172 | Ga0373955_0181052 | Ga0373955_0181052_313_942 | 208 |
| 83 | 3300035410 | Ga0373924_0033713 | Ga0373924_0033713_272_901 | 208 |
| 84 | 3300036401 | Ga0373937_0116212 | Ga0373937_0116212_1444_2073 | 208 |
| 85 | 3300037312 | Ga0395899_0055572 | Ga0395899_0055572_596_1225 | 208 |
| 86 | 3300037471 | Ga0395905_0006708 | Ga0395905_0006708_4606_5235 | 208 |
| 87 | 3300038443 | Ga0395901_0051327 | Ga0395901_0051327_2222_2851 | 208 |
| 88 | 3300046454 | Ga0495592_0005965 | Ga0495592_0005965_2989_3618 | 208 |
| 89 | 3300046463 | Ga0495653_0036851 | Ga0495653_0036851_569_1198 | 208 |
| 90 | 3300046511 | Ga0495608_0065445 | Ga0495608_0065445_1412_2041 | 208 |
| 91 | 3300046516 | Ga0495628_0076019 | Ga0495628_0076019_888_1517 | 208 |
| 92 | 3300046529 | Ga0495652_0140706 | Ga0495652_0140706_1004_1633 | 208 |
| 93 | 3300046536 | Ga0495587_0017376 | Ga0495587_0017376_3501_4130 | 208 |
| 94 | 3300046543 | Ga0495645_0008560 | Ga0495645_0008560_2168_2797 | 208 |
| 95 | 3300046675 | Ga0495657_0039708 | Ga0495657_0039708_886_1515 | 208 |
| 96 | 3300046678 | Ga0495599_0061649 | Ga0495599_0061649_94_723 | 208 |
| 97 | 3300046679 | Ga0495623_0084451 | Ga0495623_0084451_351_980 | 208 |
| 98 | 3300047317 | Ga0495604_0290466 | Ga0495604_0290466_295_924 | 208 |
| 99 | 3300049585 | Ga0501069_0003696 | Ga0501069_0003696_3402_4028 | 208 |
| 100 | 3300049586 | Ga0501070_0073364 | Ga0501070_0073364_1408_2034 | 208 |
| 101 | 3300050513 | nmdc:mga0rr50_506777_c1 | nmdc:mga0rr50_506777_c1_224_853 | 208 |
| 102 | 3300053077 | Ga0495601_0013872 | Ga0495601_0013872_1150_1779 | 208 |
| 103 | 3300053085 | Ga0495619_0017325 | Ga0495619_0017325_951_1580 | 208 |
| 104 | 3300060353 | Ga0501082_0159598 | Ga0501082_0159598_808_1434 | 208 |
| 105 | 3300005354 | Ga0070675_100044023 | Ga0070675_1000440233 | 209 |
| 106 | 3300005364 | Ga0070673_100146726 | Ga0070673_1001467264 | 209 |
| 107 | 3300005365 | Ga0070688_100011769 | Ga0070688_1000117694 | 209 |
| 108 | 3300005367 | Ga0070667_100006690 | Ga0070667_1000066906 | 209 |
| 109 | 3300005539 | Ga0068853_100008324 | Ga0068853_1000083248 | 209 |
| 110 | 3300005543 | Ga0070672_100032899 | Ga0070672_1000328993 | 209 |
| 111 | 3300005563 | Ga0068855_100058901 | Ga0068855_1000589012 | 209 |
| 112 | 3300005564 | Ga0070664_100195508 | Ga0070664_1001955083 | 209 |
| 113 | 3300005577 | Ga0068857_100069677 | Ga0068857_1000696772 | 209 |
| 114 | 3300005616 | Ga0068852_100003881 | Ga0068852_1000038819 | 209 |
| 115 | 3300005843 | Ga0068860_100038414 | Ga0068860_1000384147 | 209 |
| 116 | 3300006178 | Ga0075367_10004493 | Ga0075367_100044935 | 209 |
| 117 | 3300009177 | Ga0105248_10033619 | Ga0105248_100336195 | 209 |
| 118 | 3300009551 | Ga0105238_10056524 | Ga0105238_100565245 | 209 |
| 119 | 3300013308 | Ga0157375_10202627 | Ga0157375_102026272 | 209 |
| 120 | 3300025908 | Ga0207643_10183037 | Ga0207643_101830372 | 209 |
| 121 | 3300025909 | Ga0207705_10153738 | Ga0207705_101537382 | 209 |
| 122 | 3300025913 | Ga0207695_10488736 | Ga0207695_104887362 | 209 |
| 123 | 3300025921 | Ga0207652_10113438 | Ga0207652_101134381 | 209 |
| 124 | 3300025924 | Ga0207694_10204035 | Ga0207694_102040352 | 209 |
| 125 | 3300025926 | Ga0207659_10001230 | Ga0207659_100012304 | 209 |
| 126 | 3300025936 | Ga0207670_10043542 | Ga0207670_100435423 | 209 |
| 127 | 3300025940 | Ga0207691_10011643 | Ga0207691_100116439 | 209 |
| 128 | 3300025941 | Ga0207711_10003531 | Ga0207711_100035318 | 209 |
| 129 | 3300025942 | Ga0207689_10047262 | Ga0207689_100472622 | 209 |
| 130 | 3300025986 | Ga0207658_10015737 | Ga0207658_100157375 | 209 |
| 131 | 3300026023 | Ga0207677_10267707 | Ga0207677_102677072 | 209 |
| 132 | 3300026035 | Ga0207703_10228396 | Ga0207703_102283963 | 209 |
| 133 | 3300026041 | Ga0207639_10007544 | Ga0207639_100075447 | 209 |
| 134 | 3300026075 | Ga0207708_10323191 | Ga0207708_103231911 | 209 |
| 135 | 3300026116 | Ga0207674_10006311 | Ga0207674_100063115 | 209 |
| 136 | 3300026142 | Ga0207698_10001267 | Ga0207698_1000126713 | 209 |
| 137 | 3300028381 | Ga0268264_10028095 | Ga0268264_100280953 | 209 |
| 138 | 3300028786 | Ga0307517_10147460 | Ga0307517_101474602 | 209 |
| 139 | 3300035111 | Ga0373923_0024351 | Ga0373923_0024351_257_913 | 209 |
| 140 | 3300035117 | Ga0373953_0008522 | Ga0373953_0008522_2676_3332 | 209 |
| 141 | 3300035170 | Ga0373943_0047225 | Ga0373943_0047225_1406_2062 | 209 |
| 142 | 3300035171 | Ga0373946_0052697 | Ga0373946_0052697_1002_1634 | 209 |
| 143 | 3300035410 | Ga0373924_0012481 | Ga0373924_0012481_2190_2846 | 209 |
| 144 | 3300035724 | Ga0373933_0024198 | Ga0373933_0024198_2171_2827 | 209 |
| 145 | 3300035725 | Ga0373947_0083889 | Ga0373947_0083889_79_735 | 209 |
| 146 | 3300036401 | Ga0373937_0023839 | Ga0373937_0023839_4075_4731 | 209 |
| 147 | 3300037068 | Ga0373925_0017538 | Ga0373925_0017538_3230_3886 | 209 |
| 148 | 3300037068 | Ga0373925_0417114 | Ga0373925_0417114_431_1063 | 209 |
| 149 | 3300042005 | Ga0439448_0106082 | Ga0439448_0106082_74_703 | 209 |
| 150 | 3300042006 | Ga0439432_062866 | Ga0439432_062866_52_681 | 209 |
| 151 | 3300042007 | Ga0439449_0018057 | Ga0439449_0018057_619_1248 | 209 |
| 152 | 3300042012 | Ga0439455_0082190 | Ga0439455_0082190_97_726 | 209 |
| 153 | 3300042157 | Ga0439458_0002355 | Ga0439458_0002355_643_1272 | 209 |
| 154 | 3300044694 | Ga0466963_0334260 | Ga0466963_0334260_406_1035 | 209 |
| 155 | 3300046454 | Ga0495592_0063692 | Ga0495592_0063692_1107_1763 | 209 |
| 156 | 3300046473 | Ga0495582_0052086 | Ga0495582_0052086_1559_2215 | 209 |
| 157 | 3300046477 | Ga0495664_0163719 | Ga0495664_0163719_476_1132 | 209 |
| 158 | 3300046492 | Ga0495585_0013212 | Ga0495585_0013212_2474_3103 | 209 |
| 159 | 3300046514 | Ga0495618_0038467 | Ga0495618_0038467_1679_2335 | 209 |
| 160 | 3300046517 | Ga0495630_0015746 | Ga0495630_0015746_4425_5081 | 209 |
| 161 | 3300046525 | Ga0495663_0043457 | Ga0495663_0043457_672_1301 | 209 |
| 162 | 3300046529 | Ga0495652_0192655 | Ga0495652_0192655_351_1007 | 209 |
| 163 | 3300046533 | Ga0495640_0009778 | Ga0495640_0009778_3824_4480 | 209 |
| 164 | 3300046536 | Ga0495587_0095791 | Ga0495587_0095791_813_1469 | 209 |
| 165 | 3300046537 | Ga0495598_0001093 | Ga0495598_0001093_3460_4089 | 209 |
| 166 | 3300046543 | Ga0495645_0344917 | Ga0495645_0344917_48_704 | 209 |
| 167 | 3300046558 | Ga0495633_0009481 | Ga0495633_0009481_873_1502 | 209 |
| 168 | 3300046663 | Ga0495635_0020339 | Ga0495635_0020339_1362_2018 | 209 |
| 169 | 3300046665 | Ga0495661_0052184 | Ga0495661_0052184_1595_2224 | 209 |
| 170 | 3300046678 | Ga0495599_0064199 | Ga0495599_0064199_781_1437 | 209 |
| 171 | 3300046683 | Ga0495658_0018540 | Ga0495658_0018540_1651_2307 | 209 |
| 172 | 3300046684 | Ga0495669_0010853 | Ga0495669_0010853_3101_3730 | 209 |
| 173 | 3300046689 | Ga0495613_0121804 | Ga0495613_0121804_1123_1779 | 209 |
| 174 | 3300046690 | Ga0495624_0039648 | Ga0495624_0039648_1810_2466 | 209 |
| 175 | 3300046691 | Ga0495670_0032290 | Ga0495670_0032290_959_1588 | 209 |
| 176 | 3300047317 | Ga0495604_0129697 | Ga0495604_0129697_479_1135 | 209 |
| 177 | 3300047445 | Ga0495677_0017333 | Ga0495677_0017333_346_975 | 209 |
| 178 | 3300047471 | Ga0495684_0009222 | Ga0495684_0009222_2349_3005 | 209 |
| 179 | 3300047673 | Ga0495593_0078136 | Ga0495593_0078136_475_1131 | 209 |
| 180 | 3300048909 | Ga0496106_0531212 | Ga0496106_0531212_160_789 | 209 |
| 181 | 3300048913 | Ga0496110_0483076 | Ga0496110_0483076_243_872 | 209 |
| 182 | 3300049571 | Ga0501034_0045361 | Ga0501034_0045361_3221_3853 | 209 |
| 183 | 3300050490 | nmdc:mga03n38_355252_c1 | nmdc:mga03n38_355252_c1_33_665 | 209 |
| 184 | 3300050491 | nmdc:mga00v17_1503_c1 | nmdc:mga00v17_1503_c1_8073_8705 | 209 |
| 185 | 3300050494 | nmdc:mga06z11_6567_c1 | nmdc:mga06z11_6567_c1_3490_4122 | 209 |
| 186 | 3300050496 | nmdc:mga07m45_99717_c1 | nmdc:mga07m45_99717_c1_564_1196 | 209 |
| 187 | 3300053078 | Ga0495612_0013700 | Ga0495612_0013700_2171_2827 | 209 |
| 188 | 3300053730 | Ga0500645_016872 | Ga0500645_016872_956_1588 | 209 |
| 189 | 3300001979 | JGI24740J21852_10008549 | JGI24740J21852_100085495 | 210 |
| 190 | 3300001979 | JGI24740J21852_10011893 | JGI24740J21852_100118935 | 210 |
| 191 | 3300001990 | JGI24737J22298_10000139 | JGI24737J22298_1000013930 | 210 |
| 192 | 3300001990 | JGI24737J22298_10006334 | JGI24737J22298_100063343 | 210 |
| 193 | 3300001990 | JGI24737J22298_10020485 | JGI24737J22298_100204853 | 210 |
| 194 | 3300002067 | JGI24735J21928_10003189 | JGI24735J21928_100031894 | 210 |
| 195 | 3300002075 | JGI24738J21930_10003779 | JGI24738J21930_100037794 | 210 |
| 196 | 3300002075 | JGI24738J21930_10006669 | JGI24738J21930_100066694 | 210 |
| 197 | 3300003791 | Ga0055530_10000332 | Ga0055530_1000033213 | 210 |
| 198 | 3300003794 | Ga0055531_10000384 | Ga0055531_1000038413 | 210 |
| 199 | 3300005327 | Ga0070658_10000165 | Ga0070658_1000016553 | 210 |
| 200 | 3300005327 | Ga0070658_10093280 | Ga0070658_100932803 | 210 |
| 201 | 3300005327 | Ga0070658_10125223 | Ga0070658_101252233 | 210 |
| 202 | 3300005328 | Ga0070676_10149520 | Ga0070676_101495202 | 210 |
| 203 | 3300005329 | Ga0070683_100003336 | Ga0070683_1000033368 | 210 |
| 204 | 3300005329 | Ga0070683_100155467 | Ga0070683_1001554672 | 210 |
| 205 | 3300005330 | Ga0070690_100004009 | Ga0070690_1000040094 | 210 |
| 206 | 3300005331 | Ga0070670_100101501 | Ga0070670_1001015011 | 210 |
| 207 | 3300005331 | Ga0070670_100273816 | Ga0070670_1002738163 | 210 |
| 208 | 3300005334 | Ga0068869_100004289 | Ga0068869_1000042897 | 210 |
| 209 | 3300005335 | Ga0070666_10007235 | Ga0070666_1000723512 | 210 |
| 210 | 3300005335 | Ga0070666_10008069 | Ga0070666_100080697 | 210 |
| 211 | 3300005336 | Ga0070680_100020619 | Ga0070680_1000206195 | 210 |
| 212 | 3300005338 | Ga0068868_100003061 | Ga0068868_10000306113 | 210 |
| 213 | 3300005338 | Ga0068868_100007425 | Ga0068868_1000074253 | 210 |
| 214 | 3300005338 | Ga0068868_100011768 | Ga0068868_1000117689 | 210 |
| 215 | 3300005338 | Ga0068868_100262267 | Ga0068868_1002622672 | 210 |
| 216 | 3300005339 | Ga0070660_100000009 | Ga0070660_100000009129 | 210 |
| 217 | 3300005339 | Ga0070660_100015323 | Ga0070660_1000153236 | 210 |
| 218 | 3300005339 | Ga0070660_100024872 | Ga0070660_1000248727 | 210 |
| 219 | 3300005339 | Ga0070660_100036443 | Ga0070660_1000364433 | 210 |
| 220 | 3300005339 | Ga0070660_100241976 | Ga0070660_1002419762 | 210 |
| 221 | 3300005340 | Ga0070689_100087959 | Ga0070689_1000879592 | 210 |
| 222 | 3300005340 | Ga0070689_100361944 | Ga0070689_1003619442 | 210 |
| 223 | 3300005343 | Ga0070687_100231287 | Ga0070687_1002312871 | 210 |
| 224 | 3300005344 | Ga0070661_100004664 | Ga0070661_1000046644 | 210 |
| 225 | 3300005344 | Ga0070661_100025955 | Ga0070661_1000259557 | 210 |
| 226 | 3300005344 | Ga0070661_100059404 | Ga0070661_1000594045 | 210 |
| 227 | 3300005347 | Ga0070668_100049993 | Ga0070668_1000499932 | 210 |
| 228 | 3300005353 | Ga0070669_100025171 | Ga0070669_1000251715 | 210 |
| 229 | 3300005355 | Ga0070671_100023503 | Ga0070671_1000235037 | 210 |
| 230 | 3300005355 | Ga0070671_100079096 | Ga0070671_1000790962 | 210 |
| 231 | 3300005355 | Ga0070671_100099485 | Ga0070671_1000994853 | 210 |
| 232 | 3300005355 | Ga0070671_100182543 | Ga0070671_1001825432 | 210 |
| 233 | 3300005355 | Ga0070671_100248541 | Ga0070671_1002485412 | 210 |
| 234 | 3300005364 | Ga0070673_100000446 | Ga0070673_10000044627 | 210 |
| 235 | 3300005364 | Ga0070673_100001436 | Ga0070673_10000143617 | 210 |
| 236 | 3300005364 | Ga0070673_100657816 | Ga0070673_1006578162 | 210 |
| 237 | 3300005366 | Ga0070659_100000048 | Ga0070659_10000004899 | 210 |
| 238 | 3300005366 | Ga0070659_100001857 | Ga0070659_1000018573 | 210 |
| 239 | 3300005366 | Ga0070659_100019853 | Ga0070659_1000198534 | 210 |
| 240 | 3300005366 | Ga0070659_100022668 | Ga0070659_1000226684 | 210 |
| 241 | 3300005366 | Ga0070659_100035024 | Ga0070659_1000350245 | 210 |
| 242 | 3300005366 | Ga0070659_100155484 | Ga0070659_1001554843 | 210 |
| 243 | 3300005367 | Ga0070667_100007807 | Ga0070667_1000078075 | 210 |
| 244 | 3300005367 | Ga0070667_100033661 | Ga0070667_1000336613 | 210 |
| 245 | 3300005434 | Ga0070709_10826795 | Ga0070709_108267951 | 210 |
| 246 | 3300005435 | Ga0070714_100019356 | Ga0070714_1000193565 | 210 |
| 247 | 3300005435 | Ga0070714_100251389 | Ga0070714_1002513891 | 210 |
| 248 | 3300005435 | Ga0070714_100300429 | Ga0070714_1003004292 | 210 |
| 249 | 3300005435 | Ga0070714_100491506 | Ga0070714_1004915062 | 210 |
| 250 | 3300005436 | Ga0070713_100352346 | Ga0070713_1003523461 | 210 |
| 251 | 3300005436 | Ga0070713_100381073 | Ga0070713_1003810731 | 210 |
| 252 | 3300005455 | Ga0070663_100000206 | Ga0070663_10000020629 | 210 |
| 253 | 3300005457 | Ga0070662_100001541 | Ga0070662_1000015414 | 210 |
| 254 | 3300005457 | Ga0070662_100140661 | Ga0070662_1001406612 | 210 |
| 255 | 3300005457 | Ga0070662_100156438 | Ga0070662_1001564383 | 210 |
| 256 | 3300005457 | Ga0070662_100460721 | Ga0070662_1004607212 | 210 |
| 257 | 3300005457 | Ga0070662_100659604 | Ga0070662_1006596041 | 210 |
| 258 | 3300005458 | Ga0070681_10029148 | Ga0070681_100291485 | 210 |
| 259 | 3300005459 | Ga0068867_100000783 | Ga0068867_10000078329 | 210 |
| 260 | 3300005459 | Ga0068867_100086353 | Ga0068867_1000863533 | 210 |
| 261 | 3300005466 | Ga0070685_10388674 | Ga0070685_103886742 | 210 |
| 262 | 3300005530 | Ga0070679_100024260 | Ga0070679_1000242606 | 210 |
| 263 | 3300005530 | Ga0070679_100703979 | Ga0070679_1007039792 | 210 |
| 264 | 3300005539 | Ga0068853_100000128 | Ga0068853_10000012853 | 210 |
| 265 | 3300005539 | Ga0068853_100001812 | Ga0068853_10000181218 | 210 |
| 266 | 3300005539 | Ga0068853_100068180 | Ga0068853_1000681804 | 210 |
| 267 | 3300005539 | Ga0068853_100068562 | Ga0068853_1000685621 | 210 |
| 268 | 3300005543 | Ga0070672_100006530 | Ga0070672_10000653010 | 210 |
| 269 | 3300005544 | Ga0070686_100033475 | Ga0070686_1000334755 | 210 |
| 270 | 3300005546 | Ga0070696_100312398 | Ga0070696_1003123982 | 210 |
| 271 | 3300005547 | Ga0070693_100000442 | Ga0070693_1000004427 | 210 |
| 272 | 3300005548 | Ga0070665_100007376 | Ga0070665_1000073764 | 210 |
| 273 | 3300005548 | Ga0070665_100201176 | Ga0070665_1002011762 | 210 |
| 274 | 3300005563 | Ga0068855_100001099 | Ga0068855_10000109940 | 210 |
| 275 | 3300005563 | Ga0068855_100013196 | Ga0068855_1000131965 | 210 |
| 276 | 3300005564 | Ga0070664_100000103 | Ga0070664_10000010332 | 210 |
| 277 | 3300005564 | Ga0070664_100012104 | Ga0070664_1000121043 | 210 |
| 278 | 3300005564 | Ga0070664_100059891 | Ga0070664_1000598915 | 210 |
| 279 | 3300005564 | Ga0070664_100081093 | Ga0070664_1000810932 | 210 |
| 280 | 3300005564 | Ga0070664_100459666 | Ga0070664_1004596662 | 210 |
| 281 | 3300005577 | Ga0068857_100016760 | Ga0068857_1000167608 | 210 |
| 282 | 3300005577 | Ga0068857_100104155 | Ga0068857_1001041554 | 210 |
| 283 | 3300005578 | Ga0068854_100054864 | Ga0068854_1000548643 | 210 |
| 284 | 3300005578 | Ga0068854_100073006 | Ga0068854_1000730063 | 210 |
| 285 | 3300005578 | Ga0068854_100088971 | Ga0068854_1000889712 | 210 |
| 286 | 3300005614 | Ga0068856_100000628 | Ga0068856_10000062828 | 210 |
| 287 | 3300005614 | Ga0068856_100060163 | Ga0068856_1000601635 | 210 |
| 288 | 3300005615 | Ga0070702_100386252 | Ga0070702_1003862521 | 210 |
| 289 | 3300005616 | Ga0068852_100069152 | Ga0068852_1000691521 | 210 |
| 290 | 3300005616 | Ga0068852_100104438 | Ga0068852_1001044384 | 210 |
| 291 | 3300005616 | Ga0068852_100191862 | Ga0068852_1001918623 | 210 |
| 292 | 3300005616 | Ga0068852_100980769 | Ga0068852_1009807692 | 210 |
| 293 | 3300005617 | Ga0068859_100010266 | Ga0068859_1000102663 | 210 |
| 294 | 3300005617 | Ga0068859_100139046 | Ga0068859_1001390463 | 210 |
| 295 | 3300005618 | Ga0068864_100020762 | Ga0068864_1000207623 | 210 |
| 296 | 3300005618 | Ga0068864_100045926 | Ga0068864_1000459265 | 210 |
| 297 | 3300005718 | Ga0068866_10050559 | Ga0068866_100505593 | 210 |
| 298 | 3300005834 | Ga0068851_10016573 | Ga0068851_100165732 | 210 |
| 299 | 3300005834 | Ga0068851_10084511 | Ga0068851_100845113 | 210 |
| 300 | 3300005834 | Ga0068851_10164347 | Ga0068851_101643473 | 210 |
| 301 | 3300005841 | Ga0068863_100009975 | Ga0068863_10000997513 | 210 |
| 302 | 3300005841 | Ga0068863_100267292 | Ga0068863_1002672923 | 210 |
| 303 | 3300005842 | Ga0068858_100004213 | Ga0068858_10000421317 | 210 |
| 304 | 3300005842 | Ga0068858_100008278 | Ga0068858_1000082789 | 210 |
| 305 | 3300006175 | Ga0070712_100026912 | Ga0070712_1000269126 | 210 |
| 306 | 3300006175 | Ga0070712_100035420 | Ga0070712_1000354204 | 210 |
| 307 | 3300006237 | Ga0097621_100016835 | Ga0097621_1000168351 | 210 |
| 308 | 3300006237 | Ga0097621_100034264 | Ga0097621_1000342641 | 210 |
| 309 | 3300006237 | Ga0097621_100605896 | Ga0097621_1006058962 | 210 |
| 310 | 3300006358 | Ga0068871_100181331 | Ga0068871_1001813314 | 210 |
| 311 | 3300006881 | Ga0068865_100002068 | Ga0068865_10000206814 | 210 |
| 312 | 3300006931 | Ga0097620_100003214 | Ga0097620_1000032142 | 210 |
| 313 | 3300006931 | Ga0097620_100010266 | Ga0097620_1000102663 | 210 |
| 314 | 3300006931 | Ga0097620_100139031 | Ga0097620_1001390313 | 210 |
| 315 | 3300006946 | Ga0079104_1015083 | Ga0079104_10150832 | 210 |
| 316 | 3300009093 | Ga0105240_10086142 | Ga0105240_100861425 | 210 |
| 317 | 3300009093 | Ga0105240_10671053 | Ga0105240_106710532 | 210 |
| 318 | 3300009098 | Ga0105245_10001091 | Ga0105245_1000109122 | 210 |
| 319 | 3300009098 | Ga0105245_10042780 | Ga0105245_100427808 | 210 |
| 320 | 3300009098 | Ga0105245_10527559 | Ga0105245_105275593 | 210 |
| 321 | 3300009148 | Ga0105243_10075398 | Ga0105243_100753982 | 210 |
| 322 | 3300009174 | Ga0105241_10015776 | Ga0105241_100157768 | 210 |
| 323 | 3300009176 | Ga0105242_10008858 | Ga0105242_100088583 | 210 |
| 324 | 3300009177 | Ga0105248_10000297 | Ga0105248_1000029736 | 210 |
| 325 | 3300009177 | Ga0105248_10000414 | Ga0105248_1000041411 | 210 |
| 326 | 3300009177 | Ga0105248_10006323 | Ga0105248_1000632311 | 210 |
| 327 | 3300009177 | Ga0105248_10096794 | Ga0105248_100967943 | 210 |
| 328 | 3300009177 | Ga0105248_10180354 | Ga0105248_101803542 | 210 |
| 329 | 3300009177 | Ga0105248_10182740 | Ga0105248_101827403 | 210 |
| 330 | 3300009177 | Ga0105248_10714779 | Ga0105248_107147792 | 210 |
| 331 | 3300009545 | Ga0105237_10082574 | Ga0105237_100825742 | 210 |
| 332 | 3300009551 | Ga0105238_10041328 | Ga0105238_100413287 | 210 |
| 333 | 3300009551 | Ga0105238_10063110 | Ga0105238_100631104 | 210 |
| 334 | 3300009551 | Ga0105238_10098701 | Ga0105238_100987013 | 210 |
| 335 | 3300009551 | Ga0105238_10449095 | Ga0105238_104490952 | 210 |
| 336 | 3300009551 | Ga0105238_10831750 | Ga0105238_108317502 | 210 |
| 337 | 3300010375 | Ga0105239_10050138 | Ga0105239_100501385 | 210 |
| 338 | 3300010375 | Ga0105239_11032517 | Ga0105239_110325172 | 210 |
| 339 | 3300013100 | Ga0157373_10025005 | Ga0157373_100250055 | 210 |
| 340 | 3300013100 | Ga0157373_10059921 | Ga0157373_100599213 | 210 |
| 341 | 3300013100 | Ga0157373_10178265 | Ga0157373_101782653 | 210 |
| 342 | 3300013100 | Ga0157373_10361044 | Ga0157373_103610442 | 210 |
| 343 | 3300013102 | Ga0157371_10169001 | Ga0157371_101690013 | 210 |
| 344 | 3300013102 | Ga0157371_10452361 | Ga0157371_104523612 | 210 |
| 345 | 3300013104 | Ga0157370_10035973 | Ga0157370_100359733 | 210 |
| 346 | 3300013104 | Ga0157370_10183019 | Ga0157370_101830192 | 210 |
| 347 | 3300013105 | Ga0157369_10428190 | Ga0157369_104281902 | 210 |
| 348 | 3300013105 | Ga0157369_10741563 | Ga0157369_107415632 | 210 |
| 349 | 3300013296 | Ga0157374_10202842 | Ga0157374_102028423 | 210 |
| 350 | 3300013297 | Ga0157378_10002757 | Ga0157378_100027576 | 210 |
| 351 | 3300013307 | Ga0157372_10315474 | Ga0157372_103154742 | 210 |
| 352 | 3300013307 | Ga0157372_10764136 | Ga0157372_107641363 | 210 |
| 353 | 3300013308 | Ga0157375_10834632 | Ga0157375_108346322 | 210 |
| 354 | 3300014325 | Ga0163163_10447252 | Ga0163163_104472522 | 210 |
| 355 | 3300014968 | Ga0157379_10066941 | Ga0157379_100669414 | 210 |
| 356 | 3300025298 | Ga0209050_1000196 | Ga0209050_100019637 | 210 |
| 357 | 3300025304 | Ga0209257_1000228 | Ga0209257_100022837 | 210 |
| 358 | 3300025315 | Ga0207697_10000395 | Ga0207697_1000039532 | 210 |
| 359 | 3300025321 | Ga0207656_10036350 | Ga0207656_100363503 | 210 |
| 360 | 3300025321 | Ga0207656_10278728 | Ga0207656_102787281 | 210 |
| 361 | 3300025893 | Ga0207682_10148014 | Ga0207682_101480142 | 210 |
| 362 | 3300025899 | Ga0207642_10012228 | Ga0207642_100122283 | 210 |
| 363 | 3300025901 | Ga0207688_10003889 | Ga0207688_100038892 | 210 |
| 364 | 3300025901 | Ga0207688_10144834 | Ga0207688_101448342 | 210 |
| 365 | 3300025903 | Ga0207680_10004995 | Ga0207680_100049955 | 210 |
| 366 | 3300025903 | Ga0207680_10081029 | Ga0207680_100810291 | 210 |
| 367 | 3300025903 | Ga0207680_10091511 | Ga0207680_100915114 | 210 |
| 368 | 3300025904 | Ga0207647_10001213 | Ga0207647_1000121318 | 210 |
| 369 | 3300025904 | Ga0207647_10006843 | Ga0207647_100068433 | 210 |
| 370 | 3300025904 | Ga0207647_10007549 | Ga0207647_100075497 | 210 |
| 371 | 3300025904 | Ga0207647_10035313 | Ga0207647_100353135 | 210 |
| 372 | 3300025904 | Ga0207647_10040748 | Ga0207647_100407482 | 210 |
| 373 | 3300025906 | Ga0207699_10159640 | Ga0207699_101596403 | 210 |
| 374 | 3300025907 | Ga0207645_10102997 | Ga0207645_101029972 | 210 |
| 375 | 3300025909 | Ga0207705_10000687 | Ga0207705_1000068720 | 210 |
| 376 | 3300025909 | Ga0207705_10010806 | Ga0207705_100108062 | 210 |
| 377 | 3300025909 | Ga0207705_10017971 | Ga0207705_100179712 | 210 |
| 378 | 3300025909 | Ga0207705_10156274 | Ga0207705_101562742 | 210 |
| 379 | 3300025909 | Ga0207705_10351883 | Ga0207705_103518832 | 210 |
| 380 | 3300025909 | Ga0207705_10407975 | Ga0207705_104079752 | 210 |
| 381 | 3300025912 | Ga0207707_10124744 | Ga0207707_101247444 | 210 |
| 382 | 3300025912 | Ga0207707_10303004 | Ga0207707_103030041 | 210 |
| 383 | 3300025913 | Ga0207695_10021882 | Ga0207695_1002188210 | 210 |
| 384 | 3300025913 | Ga0207695_10106503 | Ga0207695_101065032 | 210 |
| 385 | 3300025914 | Ga0207671_10018200 | Ga0207671_100182006 | 210 |
| 386 | 3300025915 | Ga0207693_10025117 | Ga0207693_100251174 | 210 |
| 387 | 3300025915 | Ga0207693_10051844 | Ga0207693_100518442 | 210 |
| 388 | 3300025918 | Ga0207662_10138557 | Ga0207662_101385572 | 210 |
| 389 | 3300025919 | Ga0207657_10000328 | Ga0207657_1000032828 | 210 |
| 390 | 3300025919 | Ga0207657_10004948 | Ga0207657_100049483 | 210 |
| 391 | 3300025919 | Ga0207657_10021872 | Ga0207657_100218723 | 210 |
| 392 | 3300025919 | Ga0207657_10053502 | Ga0207657_100535023 | 210 |
| 393 | 3300025919 | Ga0207657_10186556 | Ga0207657_101865562 | 210 |
| 394 | 3300025919 | Ga0207657_10197227 | Ga0207657_101972273 | 210 |
| 395 | 3300025920 | Ga0207649_10000266 | Ga0207649_1000026644 | 210 |
| 396 | 3300025920 | Ga0207649_10012449 | Ga0207649_100124494 | 210 |
| 397 | 3300025920 | Ga0207649_10124375 | Ga0207649_101243752 | 210 |
| 398 | 3300025921 | Ga0207652_10343137 | Ga0207652_103431372 | 210 |
| 399 | 3300025924 | Ga0207694_10012943 | Ga0207694_1001294310 | 210 |
| 400 | 3300025925 | Ga0207650_10192962 | Ga0207650_101929622 | 210 |
| 401 | 3300025925 | Ga0207650_10213544 | Ga0207650_102135443 | 210 |
| 402 | 3300025926 | Ga0207659_10045060 | Ga0207659_100450602 | 210 |
| 403 | 3300025927 | Ga0207687_10013213 | Ga0207687_100132135 | 210 |
| 404 | 3300025928 | Ga0207700_10360673 | Ga0207700_103606732 | 210 |
| 405 | 3300025929 | Ga0207664_10150196 | Ga0207664_101501963 | 210 |
| 406 | 3300025929 | Ga0207664_10278136 | Ga0207664_102781362 | 210 |
| 407 | 3300025931 | Ga0207644_10020579 | Ga0207644_100205793 | 210 |
| 408 | 3300025931 | Ga0207644_10033102 | Ga0207644_100331022 | 210 |
| 409 | 3300025931 | Ga0207644_10045298 | Ga0207644_100452985 | 210 |
| 410 | 3300025931 | Ga0207644_10108920 | Ga0207644_101089203 | 210 |
| 411 | 3300025931 | Ga0207644_10179244 | Ga0207644_101792443 | 210 |
| 412 | 3300025931 | Ga0207644_10226016 | Ga0207644_102260163 | 210 |
| 413 | 3300025932 | Ga0207690_10000036 | Ga0207690_1000003682 | 210 |
| 414 | 3300025932 | Ga0207690_10001858 | Ga0207690_1000185811 | 210 |
| 415 | 3300025932 | Ga0207690_10015838 | Ga0207690_100158388 | 210 |
| 416 | 3300025932 | Ga0207690_10022443 | Ga0207690_100224432 | 210 |
| 417 | 3300025932 | Ga0207690_10032424 | Ga0207690_100324245 | 210 |
| 418 | 3300025932 | Ga0207690_10087864 | Ga0207690_100878644 | 210 |
| 419 | 3300025932 | Ga0207690_10243415 | Ga0207690_102434153 | 210 |
| 420 | 3300025932 | Ga0207690_10360111 | Ga0207690_103601111 | 210 |
| 421 | 3300025933 | Ga0207706_10000343 | Ga0207706_1000034328 | 210 |
| 422 | 3300025933 | Ga0207706_10003563 | Ga0207706_1000356318 | 210 |
| 423 | 3300025933 | Ga0207706_10007986 | Ga0207706_1000798612 | 210 |
| 424 | 3300025933 | Ga0207706_10018619 | Ga0207706_100186193 | 210 |
| 425 | 3300025933 | Ga0207706_10056327 | Ga0207706_100563273 | 210 |
| 426 | 3300025933 | Ga0207706_10162443 | Ga0207706_101624432 | 210 |
| 427 | 3300025933 | Ga0207706_10355816 | Ga0207706_103558162 | 210 |
| 428 | 3300025933 | Ga0207706_10647945 | Ga0207706_106479451 | 210 |
| 429 | 3300025934 | Ga0207686_10022649 | Ga0207686_100226492 | 210 |
| 430 | 3300025936 | Ga0207670_10071690 | Ga0207670_100716904 | 210 |
| 431 | 3300025937 | Ga0207669_10026267 | Ga0207669_100262675 | 210 |
| 432 | 3300025937 | Ga0207669_10071518 | Ga0207669_100715184 | 210 |
| 433 | 3300025938 | Ga0207704_10007716 | Ga0207704_100077167 | 210 |
| 434 | 3300025940 | Ga0207691_10003655 | Ga0207691_1000365518 | 210 |
| 435 | 3300025940 | Ga0207691_10220553 | Ga0207691_102205533 | 210 |
| 436 | 3300025941 | Ga0207711_10001320 | Ga0207711_100013207 | 210 |
| 437 | 3300025941 | Ga0207711_10001646 | Ga0207711_1000164622 | 210 |
| 438 | 3300025941 | Ga0207711_10015976 | Ga0207711_100159764 | 210 |
| 439 | 3300025941 | Ga0207711_10285631 | Ga0207711_102856312 | 210 |
| 440 | 3300025941 | Ga0207711_10452490 | Ga0207711_104524902 | 210 |
| 441 | 3300025942 | Ga0207689_10000064 | Ga0207689_1000006496 | 210 |
| 442 | 3300025942 | Ga0207689_10057515 | Ga0207689_100575155 | 210 |
| 443 | 3300025944 | Ga0207661_10005937 | Ga0207661_100059377 | 210 |
| 444 | 3300025944 | Ga0207661_10156444 | Ga0207661_101564442 | 210 |
| 445 | 3300025944 | Ga0207661_10463149 | Ga0207661_104631492 | 210 |
| 446 | 3300025945 | Ga0207679_10000093 | Ga0207679_1000009383 | 210 |
| 447 | 3300025945 | Ga0207679_10041973 | Ga0207679_100419735 | 210 |
| 448 | 3300025945 | Ga0207679_10081648 | Ga0207679_100816483 | 210 |
| 449 | 3300025945 | Ga0207679_10448970 | Ga0207679_104489702 | 210 |
| 450 | 3300025949 | Ga0207667_10002660 | Ga0207667_1000266022 | 210 |
| 451 | 3300025949 | Ga0207667_10052389 | Ga0207667_100523893 | 210 |
| 452 | 3300025949 | Ga0207667_10112196 | Ga0207667_101121963 | 210 |
| 453 | 3300025949 | Ga0207667_10382992 | Ga0207667_103829923 | 210 |
| 454 | 3300025960 | Ga0207651_10005110 | Ga0207651_100051103 | 210 |
| 455 | 3300025960 | Ga0207651_10017646 | Ga0207651_100176467 | 210 |
| 456 | 3300025981 | Ga0207640_10003887 | Ga0207640_100038873 | 210 |
| 457 | 3300025981 | Ga0207640_10039525 | Ga0207640_100395255 | 210 |
| 458 | 3300025981 | Ga0207640_10084736 | Ga0207640_100847363 | 210 |
| 459 | 3300025981 | Ga0207640_10387550 | Ga0207640_103875502 | 210 |
| 460 | 3300025986 | Ga0207658_10008692 | Ga0207658_100086923 | 210 |
| 461 | 3300025986 | Ga0207658_10014467 | Ga0207658_100144676 | 210 |
| 462 | 3300026023 | Ga0207677_10004612 | Ga0207677_1000461211 | 210 |
| 463 | 3300026023 | Ga0207677_10010570 | Ga0207677_100105705 | 210 |
| 464 | 3300026023 | Ga0207677_10021327 | Ga0207677_100213272 | 210 |
| 465 | 3300026035 | Ga0207703_10009696 | Ga0207703_100096969 | 210 |
| 466 | 3300026041 | Ga0207639_10000181 | Ga0207639_1000018150 | 210 |
| 467 | 3300026041 | Ga0207639_10001001 | Ga0207639_1000100111 | 210 |
| 468 | 3300026041 | Ga0207639_10012668 | Ga0207639_100126685 | 210 |
| 469 | 3300026041 | Ga0207639_10104115 | Ga0207639_101041153 | 210 |
| 470 | 3300026041 | Ga0207639_10207876 | Ga0207639_102078762 | 210 |
| 471 | 3300026041 | Ga0207639_10812081 | Ga0207639_108120812 | 210 |
| 472 | 3300026067 | Ga0207678_10016076 | Ga0207678_100160768 | 210 |
| 473 | 3300026067 | Ga0207678_10439851 | Ga0207678_104398512 | 210 |
| 474 | 3300026078 | Ga0207702_10000619 | Ga0207702_1000061918 | 210 |
| 475 | 3300026078 | Ga0207702_10227219 | Ga0207702_102272193 | 210 |
| 476 | 3300026088 | Ga0207641_10009194 | Ga0207641_100091941 | 210 |
| 477 | 3300026088 | Ga0207641_10128150 | Ga0207641_101281504 | 210 |
| 478 | 3300026089 | Ga0207648_10001433 | Ga0207648_100014334 | 210 |
| 479 | 3300026089 | Ga0207648_10012796 | Ga0207648_100127963 | 210 |
| 480 | 3300026095 | Ga0207676_10008272 | Ga0207676_100082724 | 210 |
| 481 | 3300026095 | Ga0207676_10022808 | Ga0207676_100228085 | 210 |
| 482 | 3300026095 | Ga0207676_10737792 | Ga0207676_107377922 | 210 |
| 483 | 3300026116 | Ga0207674_10000362 | Ga0207674_100003623 | 210 |
| 484 | 3300026142 | Ga0207698_10032294 | Ga0207698_100322947 | 210 |
| 485 | 3300026142 | Ga0207698_10130214 | Ga0207698_101302143 | 210 |
| 486 | 3300026142 | Ga0207698_10407881 | Ga0207698_104078812 | 210 |
| 487 | 3300028379 | Ga0268266_10043975 | Ga0268266_100439755 | 210 |
| 488 | 3300030745 | Ga0316182_1275706 | Ga0316182_12757062 | 210 |
| 489 | 3300031548 | Ga0307408_100015823 | Ga0307408_1000158235 | 210 |
| 490 | 3300031731 | Ga0307405_10007792 | Ga0307405_100077923 | 210 |
| 491 | 3300031731 | Ga0307405_10501509 | Ga0307405_105015091 | 210 |
| 492 | 3300031824 | Ga0307413_10010199 | Ga0307413_100101993 | 210 |
| 493 | 3300031824 | Ga0307413_10029365 | Ga0307413_100293652 | 210 |
| 494 | 3300031824 | Ga0307413_10052076 | Ga0307413_100520763 | 210 |
| 495 | 3300031852 | Ga0307410_10022349 | Ga0307410_100223494 | 210 |
| 496 | 3300031852 | Ga0307410_10023263 | Ga0307410_100232632 | 210 |
| 497 | 3300031852 | Ga0307410_10148658 | Ga0307410_101486582 | 210 |
| 498 | 3300031852 | Ga0307410_10231187 | Ga0307410_102311873 | 210 |
| 499 | 3300031901 | Ga0307406_10473810 | Ga0307406_104738101 | 210 |
| 500 | 3300031911 | Ga0307412_10018297 | Ga0307412_100182973 | 210 |
| 501 | 3300031911 | Ga0307412_10154327 | Ga0307412_101543272 | 210 |
| 502 | 3300031995 | Ga0307409_100016356 | Ga0307409_1000163562 | 210 |
| 503 | 3300031995 | Ga0307409_100017678 | Ga0307409_1000176784 | 210 |
| 504 | 3300031995 | Ga0307409_100233720 | Ga0307409_1002337202 | 210 |
| 505 | 3300031995 | Ga0307409_100334247 | Ga0307409_1003342472 | 210 |
| 506 | 3300031995 | Ga0307409_100452026 | Ga0307409_1004520262 | 210 |
| 507 | 3300032002 | Ga0307416_100031238 | Ga0307416_1000312384 | 210 |
| 508 | 3300032002 | Ga0307416_100132859 | Ga0307416_1001328593 | 210 |
| 509 | 3300032002 | Ga0307416_100189337 | Ga0307416_1001893372 | 210 |
| 510 | 3300032004 | Ga0307414_10003907 | Ga0307414_100039075 | 210 |
| 511 | 3300032004 | Ga0307414_10008735 | Ga0307414_100087356 | 210 |
| 512 | 3300032004 | Ga0307414_10691994 | Ga0307414_106919941 | 210 |
| 513 | 3300032004 | Ga0307414_10854181 | Ga0307414_108541811 | 210 |
| 514 | 3300032005 | Ga0307411_10062642 | Ga0307411_100626422 | 210 |
| 515 | 3300032005 | Ga0307411_10145241 | Ga0307411_101452412 | 210 |
| 516 | 3300032005 | Ga0307411_10169322 | Ga0307411_101693222 | 210 |
| 517 | 3300032005 | Ga0307411_10224898 | Ga0307411_102248983 | 210 |
| 518 | 3300032126 | Ga0307415_100001022 | Ga0307415_10000102211 | 210 |
| 519 | 3300032126 | Ga0307415_100059281 | Ga0307415_1000592815 | 210 |
| 520 | 3300032126 | Ga0307415_100547343 | Ga0307415_1005473432 | 210 |
| 521 | 3300032126 | Ga0307415_100810204 | Ga0307415_1008102042 | 210 |
| 522 | 3300032126 | Ga0307415_100955601 | Ga0307415_1009556012 | 210 |
| 523 | 3300035115 | Ga0373941_0062330 | Ga0373941_0062330_59_691 | 210 |
| 524 | 3300035118 | Ga0373954_0014179 | Ga0373954_0014179_2513_3145 | 210 |
| 525 | 3300035119 | Ga0373956_0129933 | Ga0373956_0129933_175_807 | 210 |
| 526 | 3300035120 | Ga0373957_0093949 | Ga0373957_0093949_263_895 | 210 |
| 527 | 3300035172 | Ga0373955_0171458 | Ga0373955_0171458_238_870 | 210 |
| 528 | 3300035692 | Ga0373935_0013673 | Ga0373935_0013673_1047_1691 | 210 |
| 529 | 3300035724 | Ga0373933_0032271 | Ga0373933_0032271_2265_2897 | 210 |
| 530 | 3300036401 | Ga0373937_0735746 | Ga0373937_0735746_266_898 | 210 |
| 531 | 3300037312 | Ga0395899_0005641 | Ga0395899_0005641_4911_5543 | 210 |
| 532 | 3300037312 | Ga0395899_0102371 | Ga0395899_0102371_435_1067 | 210 |
| 533 | 3300037312 | Ga0395899_0110605 | Ga0395899_0110605_726_1358 | 210 |
| 534 | 3300037312 | Ga0395899_0214659 | Ga0395899_0214659_388_1020 | 210 |
| 535 | 3300037418 | Ga0395900_0008585 | Ga0395900_0008585_5459_6091 | 210 |
| 536 | 3300037418 | Ga0395900_0078348 | Ga0395900_0078348_844_1476 | 210 |
| 537 | 3300037418 | Ga0395900_0244413 | Ga0395900_0244413_360_992 | 210 |
| 538 | 3300037418 | Ga0395900_0308688 | Ga0395900_0308688_757_1389 | 210 |
| 539 | 3300037418 | Ga0395900_0337410 | Ga0395900_0337410_274_906 | 210 |
| 540 | 3300037418 | Ga0395900_0602316 | Ga0395900_0602316_131_763 | 210 |
| 541 | 3300037418 | Ga0395900_0861606 | Ga0395900_0861606_78_710 | 210 |
| 542 | 3300037418 | Ga0395900_1021730 | Ga0395900_1021730_23_655 | 210 |
| 543 | 3300037466 | Ga0395898_0018636 | Ga0395898_0018636_2402_3034 | 210 |
| 544 | 3300037466 | Ga0395898_0189075 | Ga0395898_0189075_925_1557 | 210 |
| 545 | 3300037466 | Ga0395898_0411747 | Ga0395898_0411747_330_962 | 210 |
| 546 | 3300037466 | Ga0395898_0423447 | Ga0395898_0423447_365_997 | 210 |
| 547 | 3300037471 | Ga0395905_0001643 | Ga0395905_0001643_504_1136 | 210 |
| 548 | 3300037471 | Ga0395905_0017198 | Ga0395905_0017198_5201_5833 | 210 |
| 549 | 3300037471 | Ga0395905_0021280 | Ga0395905_0021280_4235_4867 | 210 |
| 550 | 3300037471 | Ga0395905_0028612 | Ga0395905_0028612_1902_2534 | 210 |
| 551 | 3300037471 | Ga0395905_0029023 | Ga0395905_0029023_3925_4557 | 210 |
| 552 | 3300037471 | Ga0395905_0051871 | Ga0395905_0051871_745_1377 | 210 |
| 553 | 3300037471 | Ga0395905_0092678 | Ga0395905_0092678_165_797 | 210 |
| 554 | 3300037471 | Ga0395905_0266508 | Ga0395905_0266508_778_1410 | 210 |
| 555 | 3300037471 | Ga0395905_0277926 | Ga0395905_0277926_748_1380 | 210 |
| 556 | 3300037471 | Ga0395905_0308970 | Ga0395905_0308970_213_845 | 210 |
| 557 | 3300037471 | Ga0395905_0403210 | Ga0395905_0403210_81_713 | 210 |
| 558 | 3300037471 | Ga0395905_0579052 | Ga0395905_0579052_11_643 | 210 |
| 559 | 3300037471 | Ga0395905_0740337 | Ga0395905_0740337_30_662 | 210 |
| 560 | 3300038443 | Ga0395901_0011073 | Ga0395901_0011073_5723_6355 | 210 |
| 561 | 3300038443 | Ga0395901_0080177 | Ga0395901_0080177_2727_3359 | 210 |
| 562 | 3300038443 | Ga0395901_0210708 | Ga0395901_0210708_562_1194 | 210 |
| 563 | 3300038443 | Ga0395901_0211297 | Ga0395901_0211297_724_1356 | 210 |
| 564 | 3300038443 | Ga0395901_0219707 | Ga0395901_0219707_1102_1734 | 210 |
| 565 | 3300038443 | Ga0395901_0247874 | Ga0395901_0247874_503_1135 | 210 |
| 566 | 3300038443 | Ga0395901_0510036 | Ga0395901_0510036_550_1182 | 210 |
| 567 | 3300038443 | Ga0395901_0679560 | Ga0395901_0679560_311_1009 | 210 |
| 568 | 3300038443 | Ga0395901_0958842 | Ga0395901_0958842_53_685 | 210 |
| 569 | 3300041406 | Ga0439439_0057648 | Ga0439439_0057648_374_1009 | 210 |
| 570 | 3300041410 | Ga0439461_0000953 | Ga0439461_0000953_2149_2781 | 210 |
| 571 | 3300041411 | Ga0439466_0087119 | Ga0439466_0087119_43_675 | 210 |
| 572 | 3300041413 | Ga0439465_0021114 | Ga0439465_0021114_1293_1925 | 210 |
| 573 | 3300041997 | Ga0439431_0000563 | Ga0439431_0000563_6203_6835 | 210 |
| 574 | 3300041997 | Ga0439431_0026902 | Ga0439431_0026902_393_1025 | 210 |
| 575 | 3300041999 | Ga0439433_0025223 | Ga0439433_0025223_342_977 | 210 |
| 576 | 3300042002 | Ga0439442_001886 | Ga0439442_001886_1795_2427 | 210 |
| 577 | 3300042006 | Ga0439432_004764 | Ga0439432_004764_4276_4908 | 210 |
| 578 | 3300042006 | Ga0439432_007739 | Ga0439432_007739_1640_2272 | 210 |
| 579 | 3300042007 | Ga0439449_0007785 | Ga0439449_0007785_1859_2494 | 210 |
| 580 | 3300042010 | Ga0439452_010735 | Ga0439452_010735_690_1322 | 210 |
| 581 | 3300042010 | Ga0439452_013439 | Ga0439452_013439_1620_2252 | 210 |
| 582 | 3300042014 | Ga0439457_019302 | Ga0439457_019302_142_777 | 210 |
| 583 | 3300042015 | Ga0439462_0002116 | Ga0439462_0002116_3812_4444 | 210 |
| 584 | 3300042015 | Ga0439462_0002981 | Ga0439462_0002981_2588_3220 | 210 |
| 585 | 3300042015 | Ga0439462_0003345 | Ga0439462_0003345_2214_2849 | 210 |
| 586 | 3300042122 | Ga0450920_019086 | Ga0450920_019086_212_844 | 210 |
| 587 | 3300042147 | Ga0450910_020656 | Ga0450910_020656_96_728 | 210 |
| 588 | 3300042156 | Ga0439446_0004477 | Ga0439446_0004477_1531_2163 | 210 |
| 589 | 3300042435 | Ga0439434_0003047 | Ga0439434_0003047_3975_4607 | 210 |
| 590 | 3300042436 | Ga0439435_0007674 | Ga0439435_0007674_1642_2277 | 210 |
| 591 | 3300042438 | Ga0439459_0045532 | Ga0439459_0045532_53_685 | 210 |
| 592 | 3300042439 | Ga0439464_0000505 | Ga0439464_0000505_3272_3904 | 210 |
| 593 | 3300044684 | Ga0466966_0334809 | Ga0466966_0334809_89_721 | 210 |
| 594 | 3300044684 | Ga0466966_0399262 | Ga0466966_0399262_15_647 | 210 |
| 595 | 3300044694 | Ga0466963_0213257 | Ga0466963_0213257_491_1123 | 210 |
| 596 | 3300044842 | Ga0466957_0009572 | Ga0466957_0009572_4580_5212 | 210 |
| 597 | 3300045836 | Ga0466958_0139002 | Ga0466958_0139002_352_984 | 210 |
| 598 | 3300045976 | Ga0466967_0000133 | Ga0466967_0000133_27027_27659 | 210 |
| 599 | 3300045976 | Ga0466967_0046579 | Ga0466967_0046579_3051_3683 | 210 |
| 600 | 3300045976 | Ga0466967_0214774 | Ga0466967_0214774_122_754 | 210 |
| 601 | 3300045976 | Ga0466967_0290441 | Ga0466967_0290441_664_1296 | 210 |
| 602 | 3300045976 | Ga0466967_1051046 | Ga0466967_1051046_29_661 | 210 |
| 603 | 3300046474 | Ga0495605_0021457 | Ga0495605_0021457_1516_2151 | 210 |
| 604 | 3300046477 | Ga0495664_0132475 | Ga0495664_0132475_149_784 | 210 |
| 605 | 3300046500 | Ga0495596_0001537 | Ga0495596_0001537_10298_10933 | 210 |
| 606 | 3300046524 | Ga0495648_0042974 | Ga0495648_0042974_194_829 | 210 |
| 607 | 3300046679 | Ga0495623_0093081 | Ga0495623_0093081_122_754 | 210 |
| 608 | 3300046794 | Ga0495589_0002666 | Ga0495589_0002666_1194_1829 | 210 |
| 609 | 3300047320 | Ga0495672_0002926 | Ga0495672_0002926_10776_11411 | 210 |
| 610 | 3300047321 | Ga0495676_0217383 | Ga0495676_0217383_108_743 | 210 |
| 611 | 3300047321 | Ga0495676_0342410 | Ga0495676_0342410_25_660 | 210 |
| 612 | 3300047323 | Ga0495683_0005799 | Ga0495683_0005799_3315_3950 | 210 |
| 613 | 3300047472 | Ga0495686_0086693 | Ga0495686_0086693_1205_1837 | 210 |
| 614 | 3300048904 | Ga0496101_0073073 | Ga0496101_0073073_526_1158 | 210 |
| 615 | 3300048904 | Ga0496101_0085324 | Ga0496101_0085324_388_1020 | 210 |
| 616 | 3300048905 | Ga0496102_0274902 | Ga0496102_0274902_769_1401 | 210 |
| 617 | 3300048907 | Ga0496104_0502613 | Ga0496104_0502613_415_1047 | 210 |
| 618 | 3300048908 | Ga0496105_0294417 | Ga0496105_0294417_49_681 | 210 |
| 619 | 3300048909 | Ga0496106_0120790 | Ga0496106_0120790_33_665 | 210 |
| 620 | 3300048910 | Ga0496107_0201335 | Ga0496107_0201335_349_981 | 210 |
| 621 | 3300048911 | Ga0496108_0284916 | Ga0496108_0284916_97_729 | 210 |
| 622 | 3300048912 | Ga0496109_0038485 | Ga0496109_0038485_1528_2160 | 210 |
| 623 | 3300048912 | Ga0496109_0097557 | Ga0496109_0097557_137_769 | 210 |
| 624 | 3300048913 | Ga0496110_0010972 | Ga0496110_0010972_6046_6678 | 210 |
| 625 | 3300048915 | Ga0496112_0007779 | Ga0496112_0007779_417_1049 | 210 |
| 626 | 3300048915 | Ga0496112_0018391 | Ga0496112_0018391_746_1378 | 210 |
| 627 | 3300048917 | Ga0496114_0000023 | Ga0496114_0000023_100693_101382 | 210 |
| 628 | 3300048926 | Ga0496123_0073772 | Ga0496123_0073772_613_1245 | 210 |
| 629 | 3300048927 | Ga0496124_0014216 | Ga0496124_0014216_5546_6178 | 210 |
| 630 | 3300048928 | Ga0496125_0242838 | Ga0496125_0242838_286_918 | 210 |
| 631 | 3300048928 | Ga0496125_0367203 | Ga0496125_0367203_156_788 | 210 |
| 632 | 3300049590 | Ga0501074_0063590 | Ga0501074_0063590_639_1271 | 210 |
| 633 | 3300049758 | Ga0501241_001096 | Ga0501241_001096_3684_4316 | 210 |
| 634 | 3300050507 | nmdc:mga05p37_364249_c1 | nmdc:mga05p37_364249_c1_687_1322 | 210 |
| 635 | 3300053087 | Ga0500643_000113 | Ga0500643_000113_78028_78660 | 210 |
| 636 | 3300053119 | Ga0500595_000845 | Ga0500595_000845_209_841 | 210 |
| 637 | 3300053136 | Ga0500559_0022982 | Ga0500559_0022982_140_772 | 210 |
| 638 | 3300053730 | Ga0500645_003965 | Ga0500645_003965_4389_5021 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4njh-assembly1.cif.gz_B | crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin | 0.9406 | 3 | 210 |
| 4njh-assembly1.cif.gz_B | crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxy-5,6,7,8-tetrahydropterin | 0.9319 | 3 | 210 |
| 6nhl-assembly1.cif.gz_A | crystal structure of quee from escherichia coli | 0.7118 | 1 | 200 |
| 6nhl-assembly1.cif.gz_B-2 | crystal structure of quee from escherichia coli | 0.6828 | 1 | 200 |
| 6nhl-assembly1.cif.gz_A | crystal structure of quee from escherichia coli | 0.6776 | 1 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4njjA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9416 | 3 | 210 | 3.20.20.70 |
| 4njjA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9328 | 3 | 210 | 3.20.20.70 |
| af_P64554_2_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7126 | 3 | 210 | 3.20.20.70 |
| af_P64554_2_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7035 | 3 | 210 | 3.20.20.70 |
| af_Q2G1X7_4_231_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.6977 | 4 | 207 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1AMR5-F1-model_v4 | Radical SAM domain-containing protein | 0.9839 | 40 | 170 |
GO:0003824
GO:0046872 GO:0051539 |
| AF-A0A2M6ZU27-F1-model_v4 | 7-carboxy-7-deazaguanine synthase | 0.9813 | 1 | 168 |
GO:0008616
GO:0016829 GO:0046872 GO:0051539 |
| AF-A0A2N2HHH9-F1-model_v4 | 7-carboxy-7-deazaguanine synthase | 0.9806 | 1 | 177 |
GO:0008616
GO:0046872 GO:0051539 |
| AF-A0A383C6W6-F1-model_v4 | Radical SAM core domain-containing protein | 0.9805 | 3 | 138 |
GO:0003824
GO:0046872 GO:0051539 |
| AF-A0A3N5GZG2-F1-model_v4 | 7-carboxy-7-deazaguanine synthase (EC 4.3.99.3) | 0.9776 | 1 | 170 |
GO:0008616
GO:0016829 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar