F471513
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 638 | 359 | 595 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10065271|Ga0157380_100652713 |
| Length | 340 |
| Sequence | LRLTALLRNRRPAGLGKKEKRKTMPEKVLIYSRFPKAQMERFGERFELLNAAGKAPNEVFSADQLADIRAMITAGGTPLGGAAMDLMPKLAAIVCYGTGYDGVDLAAAAKRKIAVGHSPGANAASVADIAVTLMLATTRRLLVADDYVRGGSWAAAKPSPMMRPQAGMLGRKIGVYGMGEIGRKIAARVAAFETEVGYFSRSQHDVPYRYFPTLDALAEWCSVLMIAVRAGTDTEHAVDAGILRKLGKDGYVVNISRGSVIDQKALIAALTEQTIAGAGLDVYEKEPHAPDALTALPNVVLSPHIGGHTLESHVAMQDCVISNLEAYFAGKPLPYAVPLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 7 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 8 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 9 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 10 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 11 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 12 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 13 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 14 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 15 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 16 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 17 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 18 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 19 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 20 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 21 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 22 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 23 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 24 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 25 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 26 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 27 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 28 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 29 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 30 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 31 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 32 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 33 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 34 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 173 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 185 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 186 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 187 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 188 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 300 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 301 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 317 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 318 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 327 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 328 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 329 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 331 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 332 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 334 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 335 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 336 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 337 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 339 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 340 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 341 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 342 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 343 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 344 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 346 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 348 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 350 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 351 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 352 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 353 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 354 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 355 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 356 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 357 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 358 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 359 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.55 |
| Metatranscriptomes | 0 |
| Isolates | 6.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.66 |
| Nodule | 4.7 |
| Rhizoplane | 10.03 |
| Rhizosphere | 66.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000162 | 3300003203 | Bacteria | 29622 |
| 2 | JGI25406J46586_10015420 | 3300003203 | Bacteria | 3223 |
| 3 | JGI25406J46586_10021918 | 3300003203 | Bacteria | 2556 |
| 4 | JGI25404J52841_10014050 | 3300003659 | Bacteria | 1737 |
| 5 | JGI25404J52841_10020571 | 3300003659 | Bacteria | 1429 |
| 6 | Ga0070658_10065497 | 3300005327 | Bacteria | 2965 |
| 7 | Ga0070658_10091539 | 3300005327 | Bacteria | 2506 |
| 8 | Ga0070683_100126479 | 3300005329 | Bacteria | 2416 |
| 9 | Ga0070683_100309420 | 3300005329 | Bacteria | 1503 |
| 10 | Ga0070690_100067481 | 3300005330 | Bacteria | 2318 |
| 11 | Ga0068869_100075256 | 3300005334 | Bacteria | 2508 |
| 12 | Ga0070666_10194612 | 3300005335 | Bacteria | 1426 |
| 13 | Ga0070680_100156871 | 3300005336 | Bacteria | 1912 |
| 14 | Ga0070682_100097892 | 3300005337 | Bacteria | 1931 |
| 15 | Ga0068868_100107560 | 3300005338 | Bacteria | 2263 |
| 16 | Ga0070691_10101928 | 3300005341 | Bacteria | 1427 |
| 17 | Ga0070669_100048296 | 3300005353 | Bacteria | 3106 |
| 18 | Ga0070675_100292447 | 3300005354 | Bacteria | 1434 |
| 19 | Ga0070671_100065717 | 3300005355 | Bacteria | 3022 |
| 20 | Ga0070674_100157936 | 3300005356 | Bacteria | 1718 |
| 21 | Ga0070674_100159235 | 3300005356 | Bacteria | 1711 |
| 22 | Ga0070709_10007290 | 3300005434 | Bacteria | 6060 |
| 23 | Ga0070709_10029833 | 3300005434 | Bacteria | 3266 |
| 24 | Ga0070709_10179164 | 3300005434 | Bacteria | 1487 |
| 25 | Ga0070714_100012235 | 3300005435 | Bacteria | 6844 |
| 26 | Ga0070713_100019531 | 3300005436 | Bacteria | 5177 |
| 27 | Ga0070713_100198414 | 3300005436 | Bacteria | 1811 |
| 28 | Ga0070710_10009691 | 3300005437 | Bacteria | 4719 |
| 29 | Ga0070711_100112504 | 3300005439 | Bacteria | 2000 |
| 30 | Ga0070663_100027389 | 3300005455 | Bacteria | 3870 |
| 31 | Ga0070663_100143290 | 3300005455 | Bacteria | 1826 |
| 32 | Ga0070663_100234649 | 3300005455 | Bacteria | 1446 |
| 33 | Ga0070678_100025743 | 3300005456 | Bacteria | 3965 |
| 34 | Ga0070678_100226327 | 3300005456 | Bacteria | 1557 |
| 35 | Ga0070681_10089919 | 3300005458 | Bacteria | 3021 |
| 36 | Ga0070681_10200365 | 3300005458 | Bacteria | 1915 |
| 37 | Ga0070681_10230082 | 3300005458 | Bacteria | 1768 |
| 38 | Ga0070681_10285790 | 3300005458 | Bacteria | 1560 |
| 39 | Ga0070707_100545481 | 3300005468 | Bacteria | 1122 |
| 40 | Ga0070679_100092381 | 3300005530 | Bacteria | 3014 |
| 41 | Ga0070679_100118983 | 3300005530 | Bacteria | 2626 |
| 42 | Ga0070679_100152926 | 3300005530 | Bacteria | 2283 |
| 43 | Ga0070679_100200429 | 3300005530 | Bacteria | 1962 |
| 44 | Ga0070684_100034836 | 3300005535 | Bacteria | 4306 |
| 45 | Ga0070684_100368277 | 3300005535 | Bacteria | 1323 |
| 46 | Ga0070684_100376382 | 3300005535 | Bacteria | 1307 |
| 47 | Ga0068853_100077509 | 3300005539 | Bacteria | 2903 |
| 48 | Ga0068853_100107104 | 3300005539 | Bacteria | 2478 |
| 49 | Ga0068853_100118787 | 3300005539 | Bacteria | 2356 |
| 50 | Ga0070693_100089834 | 3300005547 | Bacteria | 1850 |
| 51 | Ga0070665_100042707 | 3300005548 | Bacteria | 4557 |
| 52 | Ga0070665_100074604 | 3300005548 | Bacteria | 3398 |
| 53 | Ga0070665_100262983 | 3300005548 | Bacteria | 1726 |
| 54 | Ga0070665_100361553 | 3300005548 | Bacteria | 1458 |
| 55 | Ga0068855_100021801 | 3300005563 | Bacteria | 7684 |
| 56 | Ga0068855_100154929 | 3300005563 | Bacteria | 2603 |
| 57 | Ga0068855_100158887 | 3300005563 | Bacteria | 2567 |
| 58 | Ga0068855_100197906 | 3300005563 | Bacteria | 2263 |
| 59 | Ga0070664_100025149 | 3300005564 | Bacteria | 4933 |
| 60 | Ga0068852_100106616 | 3300005616 | Bacteria | 2540 |
| 61 | Ga0068852_100273986 | 3300005616 | Bacteria | 1625 |
| 62 | Ga0068859_100172173 | 3300005617 | Bacteria | 2246 |
| 63 | Ga0068864_100030397 | 3300005618 | Bacteria | 4577 |
| 64 | Ga0068864_100053526 | 3300005618 | Bacteria | 3482 |
| 65 | Ga0068861_100049133 | 3300005719 | Bacteria | 3192 |
| 66 | Ga0068861_100231402 | 3300005719 | Bacteria | 1568 |
| 67 | Ga0068861_100456198 | 3300005719 | Bacteria | 1146 |
| 68 | Ga0068860_100043210 | 3300005843 | Bacteria | 4300 |
| 69 | Ga0068860_100341016 | 3300005843 | Bacteria | 1473 |
| 70 | Ga0068862_100164844 | 3300005844 | Bacteria | 1980 |
| 71 | Ga0068862_100415962 | 3300005844 | Bacteria | 1260 |
| 72 | Ga0081455_10006819 | 3300005937 | Bacteria | 12177 |
| 73 | Ga0081455_10147325 | 3300005937 | Bacteria | 1819 |
| 74 | Ga0081455_10160456 | 3300005937 | Bacteria | 1724 |
| 75 | Ga0081538_10129470 | 3300005981 | Bacteria | 1190 |
| 76 | Ga0081540_1003121 | 3300005983 | Bacteria | 13266 |
| 77 | Ga0081540_1005500 | 3300005983 | Bacteria | 9448 |
| 78 | Ga0081540_1009972 | 3300005983 | Bacteria | 6476 |
| 79 | Ga0081540_1010599 | 3300005983 | Bacteria | 6225 |
| 80 | Ga0081540_1015311 | 3300005983 | Bacteria | 4860 |
| 81 | Ga0081540_1016750 | 3300005983 | Bacteria | 4570 |
| 82 | Ga0081540_1020563 | 3300005983 | Bacteria | 3964 |
| 83 | Ga0081540_1023691 | 3300005983 | Bacteria | 3583 |
| 84 | Ga0081540_1033249 | 3300005983 | Bacteria | 2803 |
| 85 | Ga0081540_1046015 | 3300005983 | Bacteria | 2208 |
| 86 | Ga0081539_10000203 | 3300005985 | Bacteria | 138096 |
| 87 | Ga0081539_10001007 | 3300005985 | Bacteria | 52055 |
| 88 | Ga0081539_10046196 | 3300005985 | Bacteria | 2498 |
| 89 | Ga0081539_10053621 | 3300005985 | Bacteria | 2257 |
| 90 | Ga0070717_10008113 | 3300006028 | Bacteria | 7834 |
| 91 | Ga0070717_10012395 | 3300006028 | Bacteria | 6500 |
| 92 | Ga0070717_10012865 | 3300006028 | Bacteria | 6390 |
| 93 | Ga0075365_10055751 | 3300006038 | Bacteria | 2625 |
| 94 | Ga0075365_10121570 | 3300006038 | Bacteria | 1801 |
| 95 | Ga0075368_10014800 | 3300006042 | Bacteria | 2885 |
| 96 | Ga0075363_100021152 | 3300006048 | Bacteria | 3272 |
| 97 | Ga0075363_100044685 | 3300006048 | Bacteria | 2347 |
| 98 | Ga0075364_10133930 | 3300006051 | Bacteria | 1664 |
| 99 | Ga0070715_10006032 | 3300006163 | Bacteria | 4088 |
| 100 | Ga0070716_100021193 | 3300006173 | Bacteria | 3421 |
| 101 | Ga0075362_10021046 | 3300006177 | Bacteria | 2732 |
| 102 | Ga0075362_10054390 | 3300006177 | Bacteria | 1799 |
| 103 | Ga0075367_10018795 | 3300006178 | Bacteria | 3819 |
| 104 | Ga0075367_10050292 | 3300006178 | Bacteria | 2460 |
| 105 | Ga0075369_10029140 | 3300006186 | Bacteria | 2317 |
| 106 | Ga0075366_10109249 | 3300006195 | Bacteria | 1663 |
| 107 | Ga0097621_100096028 | 3300006237 | Bacteria | 2487 |
| 108 | Ga0075370_10049986 | 3300006353 | Bacteria | 2371 |
| 109 | Ga0068871_100164814 | 3300006358 | Bacteria | 1897 |
| 110 | Ga0075428_100185910 | 3300006844 | Bacteria | 2248 |
| 111 | Ga0075428_100221966 | 3300006844 | Bacteria | 2040 |
| 112 | Ga0068865_100057305 | 3300006881 | Bacteria | 2717 |
| 113 | Ga0097620_100172175 | 3300006931 | Bacteria | 2246 |
| 114 | Ga0075435_100243703 | 3300007076 | Bacteria | 1529 |
| 115 | Ga0099795_10040124 | 3300007788 | Bacteria | 1661 |
| 116 | Ga0105250_10054430 | 3300009092 | Bacteria | 1605 |
| 117 | Ga0105240_10052144 | 3300009093 | Bacteria | 5143 |
| 118 | Ga0105240_10099593 | 3300009093 | Bacteria | 3538 |
| 119 | Ga0105240_10278559 | 3300009093 | Bacteria | 1922 |
| 120 | Ga0111539_10061288 | 3300009094 | Bacteria | 4457 |
| 121 | Ga0105245_10060845 | 3300009098 | Bacteria | 3402 |
| 122 | Ga0105245_10197363 | 3300009098 | Bacteria | 1931 |
| 123 | Ga0105245_10280527 | 3300009098 | Bacteria | 1628 |
| 124 | Ga0114129_10037091 | 3300009147 | Bacteria | 6882 |
| 125 | Ga0105243_10172665 | 3300009148 | Bacteria | 1874 |
| 126 | Ga0105248_10106832 | 3300009177 | Bacteria | 3156 |
| 127 | Ga0105248_10176498 | 3300009177 | Bacteria | 2407 |
| 128 | Ga0105248_10515306 | 3300009177 | Bacteria | 1348 |
| 129 | Ga0105237_10437781 | 3300009545 | Bacteria | 1313 |
| 130 | Ga0105238_10375964 | 3300009551 | Bacteria | 1412 |
| 131 | Ga0105249_10052110 | 3300009553 | Bacteria | 3736 |
| 132 | Ga0099796_10025047 | 3300010159 | Bacteria | 1879 |
| 133 | Ga0099796_10068747 | 3300010159 | Bacteria | 1273 |
| 134 | Ga0105239_10050960 | 3300010375 | Bacteria | 4539 |
| 135 | Ga0105239_10059034 | 3300010375 | Bacteria | 4210 |
| 136 | Ga0105239_10222468 | 3300010375 | Bacteria | 2117 |
| 137 | Ga0105246_10189702 | 3300011119 | Bacteria | 1590 |
| 138 | Ga0105246_10247825 | 3300011119 | Bacteria | 1412 |
| 139 | Ga0105246_10270250 | 3300011119 | Bacteria | 1359 |
| 140 | Ga0157370_10137087 | 3300013104 | Bacteria | 2280 |
| 141 | Ga0157369_10057918 | 3300013105 | Bacteria | 4179 |
| 142 | Ga0157369_10094109 | 3300013105 | Bacteria | 3199 |
| 143 | Ga0157369_10264495 | 3300013105 | Bacteria | 1793 |
| 144 | Ga0157369_10274159 | 3300013105 | Bacteria | 1758 |
| 145 | Ga0157378_10099691 | 3300013297 | Bacteria | 2651 |
| 146 | Ga0157372_10104969 | 3300013307 | Bacteria | 3231 |
| 147 | Ga0157372_10373339 | 3300013307 | Bacteria | 1662 |
| 148 | Ga0157375_10132405 | 3300013308 | Bacteria | 2614 |
| 149 | Ga0157375_10264605 | 3300013308 | Bacteria | 1881 |
| 150 | Ga0163163_10009181 | 3300014325 | Bacteria | 8813 |
| 151 | Ga0163163_10058180 | 3300014325 | Bacteria | 3822 |
| 152 | Ga0163163_10073703 | 3300014325 | Bacteria | 3405 |
| 153 | Ga0157380_10065271 | 3300014326 | Bacteria | 2925 |
| 154 | Ga0157380_10266019 | 3300014326 | Bacteria | 1560 |
| 155 | Ga0157377_10089370 | 3300014745 | Bacteria | 1816 |
| 156 | Ga0157377_10110907 | 3300014745 | Bacteria | 1649 |
| 157 | Ga0157379_10236417 | 3300014968 | Bacteria | 1657 |
| 158 | Ga0157376_10046571 | 3300014969 | Bacteria | 3576 |
| 159 | Ga0157376_10198960 | 3300014969 | Bacteria | 1842 |
| 160 | Ga0163161_10095664 | 3300017792 | Bacteria | 2203 |
| 161 | Ga0209677_100683 | 3300025253 | Bacteria | 17403 |
| 162 | Ga0209455_1003978 | 3300025272 | Bacteria | 5011 |
| 163 | Ga0209758_1008841 | 3300025297 | Bacteria | 6410 |
| 164 | Ga0209758_1015355 | 3300025297 | Bacteria | 3974 |
| 165 | Ga0209758_1057789 | 3300025297 | Bacteria | 1301 |
| 166 | Ga0207697_10043972 | 3300025315 | Bacteria | 1837 |
| 167 | Ga0207692_10033228 | 3300025898 | Bacteria | 2486 |
| 168 | Ga0207642_10058186 | 3300025899 | Bacteria | 1782 |
| 169 | Ga0207688_10089576 | 3300025901 | Bacteria | 1765 |
| 170 | Ga0207685_10001288 | 3300025905 | Bacteria | 5140 |
| 171 | Ga0207699_10055499 | 3300025906 | Bacteria | 2357 |
| 172 | Ga0207699_10061001 | 3300025906 | Bacteria | 2267 |
| 173 | Ga0207699_10107971 | 3300025906 | Bacteria | 1779 |
| 174 | Ga0207707_10001527 | 3300025912 | Bacteria | 21365 |
| 175 | Ga0207707_10071173 | 3300025912 | Bacteria | 3030 |
| 176 | Ga0207707_10075388 | 3300025912 | Bacteria | 2943 |
| 177 | Ga0207707_10147320 | 3300025912 | Bacteria | 2058 |
| 178 | Ga0207707_10187513 | 3300025912 | Bacteria | 1805 |
| 179 | Ga0207695_10070439 | 3300025913 | Bacteria | 3575 |
| 180 | Ga0207695_10146792 | 3300025913 | Bacteria | 2302 |
| 181 | Ga0207695_10226295 | 3300025913 | Bacteria | 1776 |
| 182 | Ga0207695_10269330 | 3300025913 | Bacteria | 1599 |
| 183 | Ga0207671_10102562 | 3300025914 | Bacteria | 2168 |
| 184 | Ga0207693_10001370 | 3300025915 | Bacteria | 21582 |
| 185 | Ga0207663_10000401 | 3300025916 | Bacteria | 18748 |
| 186 | Ga0207660_10002267 | 3300025917 | Bacteria | 12676 |
| 187 | Ga0207660_10141596 | 3300025917 | Bacteria | 1839 |
| 188 | Ga0207662_10048762 | 3300025918 | Bacteria | 2510 |
| 189 | Ga0207657_10051473 | 3300025919 | Bacteria | 3580 |
| 190 | Ga0207649_10221806 | 3300025920 | Bacteria | 1347 |
| 191 | Ga0207652_10011331 | 3300025921 | Bacteria | 7184 |
| 192 | Ga0207652_10047386 | 3300025921 | Bacteria | 3671 |
| 193 | Ga0207652_10088570 | 3300025921 | Bacteria | 2716 |
| 194 | Ga0207652_10118505 | 3300025921 | Bacteria | 2353 |
| 195 | Ga0207687_10040402 | 3300025927 | Bacteria | 3197 |
| 196 | Ga0207687_10204075 | 3300025927 | Bacteria | 1547 |
| 197 | Ga0207700_10063688 | 3300025928 | Bacteria | 2806 |
| 198 | Ga0207664_10006050 | 3300025929 | Bacteria | 8287 |
| 199 | Ga0207706_10089367 | 3300025933 | Bacteria | 2708 |
| 200 | Ga0207669_10016122 | 3300025937 | Bacteria | 3788 |
| 201 | Ga0207669_10304740 | 3300025937 | Bacteria | 1212 |
| 202 | Ga0207704_10310009 | 3300025938 | Bacteria | 1213 |
| 203 | Ga0207665_10006374 | 3300025939 | Bacteria | 7828 |
| 204 | Ga0207665_10263242 | 3300025939 | Bacteria | 1278 |
| 205 | Ga0207691_10338864 | 3300025940 | Bacteria | 1287 |
| 206 | Ga0207711_10089662 | 3300025941 | Bacteria | 2702 |
| 207 | Ga0207711_10204848 | 3300025941 | Bacteria | 1801 |
| 208 | Ga0207689_10080649 | 3300025942 | Bacteria | 2675 |
| 209 | Ga0207661_10338476 | 3300025944 | Bacteria | 1355 |
| 210 | Ga0207661_10465695 | 3300025944 | Bacteria | 1152 |
| 211 | Ga0207679_10063875 | 3300025945 | Bacteria | 2750 |
| 212 | Ga0207667_10043345 | 3300025949 | Bacteria | 4775 |
| 213 | Ga0207667_10061169 | 3300025949 | Bacteria | 3940 |
| 214 | Ga0207712_10041957 | 3300025961 | Bacteria | 3148 |
| 215 | Ga0207668_10156423 | 3300025972 | Bacteria | 1771 |
| 216 | Ga0207668_10244199 | 3300025972 | Bacteria | 1454 |
| 217 | Ga0207640_10134410 | 3300025981 | Bacteria | 1793 |
| 218 | Ga0207677_10136070 | 3300026023 | Bacteria | 1873 |
| 219 | Ga0207677_10228838 | 3300026023 | Bacteria | 1496 |
| 220 | Ga0207703_10055174 | 3300026035 | Bacteria | 3232 |
| 221 | Ga0207703_10266439 | 3300026035 | Bacteria | 1550 |
| 222 | Ga0207639_10028993 | 3300026041 | Bacteria | 4047 |
| 223 | Ga0207639_10205704 | 3300026041 | Bacteria | 1691 |
| 224 | Ga0207678_10046004 | 3300026067 | Bacteria | 3774 |
| 225 | Ga0207678_10084410 | 3300026067 | Bacteria | 2716 |
| 226 | Ga0207678_10091509 | 3300026067 | Bacteria | 2600 |
| 227 | Ga0207678_10214023 | 3300026067 | Bacteria | 1649 |
| 228 | Ga0207678_10306295 | 3300026067 | Bacteria | 1366 |
| 229 | Ga0207708_10046583 | 3300026075 | Bacteria | 3301 |
| 230 | Ga0207702_10001820 | 3300026078 | Bacteria | 20976 |
| 231 | Ga0207702_10175701 | 3300026078 | Bacteria | 1968 |
| 232 | Ga0207648_10020807 | 3300026089 | Bacteria | 5906 |
| 233 | Ga0207648_10177246 | 3300026089 | Bacteria | 1885 |
| 234 | Ga0207674_10156719 | 3300026116 | Bacteria | 2232 |
| 235 | Ga0207674_10205094 | 3300026116 | Bacteria | 1921 |
| 236 | Ga0207675_100137707 | 3300026118 | Bacteria | 2317 |
| 237 | Ga0207675_100198773 | 3300026118 | Bacteria | 1925 |
| 238 | Ga0207675_100343844 | 3300026118 | Bacteria | 1461 |
| 239 | Ga0207683_10037998 | 3300026121 | Bacteria | 4193 |
| 240 | Ga0207683_10123146 | 3300026121 | Bacteria | 2329 |
| 241 | Ga0207683_10158095 | 3300026121 | Bacteria | 2048 |
| 242 | Ga0207683_10160111 | 3300026121 | Bacteria | 2034 |
| 243 | Ga0207698_10094108 | 3300026142 | Bacteria | 2462 |
| 244 | Ga0209179_1016377 | 3300027512 | Bacteria | 1390 |
| 245 | Ga0209588_1000803 | 3300027671 | Bacteria | 7984 |
| 246 | Ga0209813_10013671 | 3300027866 | Bacteria | 2171 |
| 247 | Ga0268266_10022495 | 3300028379 | Bacteria | 5371 |
| 248 | Ga0268266_10026512 | 3300028379 | Bacteria | 4931 |
| 249 | Ga0268266_10091925 | 3300028379 | Bacteria | 2661 |
| 250 | Ga0268266_10321445 | 3300028379 | Bacteria | 1448 |
| 251 | Ga0268265_10216042 | 3300028380 | Bacteria | 1674 |
| 252 | Ga0268265_10390300 | 3300028380 | Bacteria | 1283 |
| 253 | Ga0265334_10040001 | 3300028573 | Bacteria | 1838 |
| 254 | Ga0307517_10003022 | 3300028786 | Bacteria | 26583 |
| 255 | Ga0307515_10166131 | 3300028794 | Bacteria | 2223 |
| 256 | Ga0307515_10225939 | 3300028794 | Bacteria | 1677 |
| 257 | Ga0307511_10051446 | 3300030521 | Bacteria | 3303 |
| 258 | Ga0265330_10009881 | 3300031235 | Bacteria | 4517 |
| 259 | Ga0265330_10076819 | 3300031235 | Bacteria | 1441 |
| 260 | Ga0265332_10033579 | 3300031238 | Bacteria | 2233 |
| 261 | Ga0265339_10002960 | 3300031249 | Bacteria | 11993 |
| 262 | Ga0265339_10101012 | 3300031249 | Bacteria | 1501 |
| 263 | Ga0265316_10105608 | 3300031344 | Bacteria | 2137 |
| 264 | Ga0307508_10098531 | 3300031616 | Bacteria | 2516 |
| 265 | Ga0307508_10263179 | 3300031616 | Bacteria | 1319 |
| 266 | Ga0265314_10045096 | 3300031711 | Bacteria | 3119 |
| 267 | Ga0265342_10005223 | 3300031712 | Bacteria | 9966 |
| 268 | Ga0265342_10140817 | 3300031712 | Bacteria | 1345 |
| 269 | Ga0307516_10103001 | 3300031730 | Bacteria | 2668 |
| 270 | Ga0307516_10264224 | 3300031730 | Bacteria | 1410 |
| 271 | Ga0307413_10049870 | 3300031824 | Bacteria | 2511 |
| 272 | Ga0307413_10392337 | 3300031824 | Bacteria | 1085 |
| 273 | Ga0307412_10242028 | 3300031911 | Bacteria | 1396 |
| 274 | Ga0307416_100133505 | 3300032002 | Bacteria | 2240 |
| 275 | Ga0307507_10049223 | 3300033179 | Bacteria | 4088 |
| 276 | Ga0307510_10057427 | 3300033180 | Bacteria | 4039 |
| 277 | Ga0307510_10108238 | 3300033180 | Bacteria | 2534 |
| 278 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 279 | Ga0373938_0010029 | 3300034957 | Bacteria | 1730 |
| 280 | Ga0373934_0025016 | 3300035086 | Bacteria | 2310 |
| 281 | Ga0373923_0020712 | 3300035111 | Bacteria | 2558 |
| 282 | Ga0373923_0029918 | 3300035111 | Bacteria | 2187 |
| 283 | Ga0373936_0005185 | 3300035113 | Bacteria | 4902 |
| 284 | Ga0373936_0118676 | 3300035113 | Bacteria | 1128 |
| 285 | Ga0373941_0029263 | 3300035115 | Bacteria | 1624 |
| 286 | Ga0373945_0005479 | 3300035116 | Bacteria | 4063 |
| 287 | Ga0373953_0010430 | 3300035117 | Bacteria | 3233 |
| 288 | Ga0373953_0073519 | 3300035117 | Bacteria | 1413 |
| 289 | Ga0373954_0001806 | 3300035118 | Bacteria | 8816 |
| 290 | Ga0373954_0140410 | 3300035118 | Bacteria | 1178 |
| 291 | Ga0373956_0003991 | 3300035119 | Bacteria | 5927 |
| 292 | Ga0373956_0045318 | 3300035119 | Bacteria | 1962 |
| 293 | Ga0373957_0067147 | 3300035120 | Bacteria | 1397 |
| 294 | Ga0373943_0060393 | 3300035170 | Bacteria | 1892 |
| 295 | Ga0373946_0021271 | 3300035171 | Bacteria | 2514 |
| 296 | Ga0373946_0125125 | 3300035171 | Bacteria | 1177 |
| 297 | Ga0373955_0007659 | 3300035172 | Bacteria | 4973 |
| 298 | Ga0373955_0026294 | 3300035172 | Bacteria | 2997 |
| 299 | Ga0373955_0105902 | 3300035172 | Bacteria | 1620 |
| 300 | Ga0373924_0014546 | 3300035410 | Bacteria | 2976 |
| 301 | Ga0373924_0068467 | 3300035410 | Bacteria | 1494 |
| 302 | Ga0373924_0108849 | 3300035410 | Bacteria | 1196 |
| 303 | Ga0373931_0047397 | 3300035691 | Bacteria | 2274 |
| 304 | Ga0373935_0003476 | 3300035692 | Bacteria | 9155 |
| 305 | Ga0373935_0017063 | 3300035692 | Bacteria | 4399 |
| 306 | Ga0373935_0249424 | 3300035692 | Bacteria | 1242 |
| 307 | Ga0373935_0261432 | 3300035692 | Bacteria | 1214 |
| 308 | Ga0373927_0006488 | 3300035695 | Bacteria | 7970 |
| 309 | Ga0373927_0007145 | 3300035695 | Bacteria | 7578 |
| 310 | Ga0373927_0074030 | 3300035695 | Bacteria | 2205 |
| 311 | Ga0373927_0128742 | 3300035695 | Bacteria | 1653 |
| 312 | Ga0373933_0042788 | 3300035724 | Bacteria | 2677 |
| 313 | Ga0373933_0274242 | 3300035724 | Bacteria | 1089 |
| 314 | Ga0373947_0008928 | 3300035725 | Bacteria | 5761 |
| 315 | Ga0373947_0189845 | 3300035725 | Bacteria | 1340 |
| 316 | Ga0373937_0213177 | 3300036401 | Bacteria | 1817 |
| 317 | Ga0373925_0008986 | 3300037068 | Bacteria | 7280 |
| 318 | Ga0373925_0010512 | 3300037068 | Bacteria | 6713 |
| 319 | Ga0373925_0047030 | 3300037068 | Bacteria | 3210 |
| 320 | Ga0373925_0060012 | 3300037068 | Bacteria | 2855 |
| 321 | Ga0395900_0110000 | 3300037418 | Bacteria | 2831 |
| 322 | Ga0395898_0417438 | 3300037466 | Bacteria | 1279 |
| 323 | Ga0395901_0264613 | 3300038443 | Bacteria | 1789 |
| 324 | Ga0436365_1272752 | 3300039437 | Bacteria | 8793 |
| 325 | Ga0436361_1084832 | 3300039447 | Bacteria | 1557 |
| 326 | Ga0436363_1616347 | 3300039450 | Bacteria | 2205 |
| 327 | Ga0466965_0012547 | 3300044683 | Bacteria | 3987 |
| 328 | Ga0466963_0088940 | 3300044694 | Bacteria | 2101 |
| 329 | Ga0466960_0174356 | 3300044901 | Bacteria | 1162 |
| 330 | Ga0466967_0026543 | 3300045976 | Bacteria | 4800 |
| 331 | Ga0466967_0032174 | 3300045976 | Bacteria | 4426 |
| 332 | Ga0495592_0005851 | 3300046454 | Bacteria | 9125 |
| 333 | Ga0495592_0136885 | 3300046454 | Bacteria | 1707 |
| 334 | Ga0495603_0010687 | 3300046455 | Bacteria | 5565 |
| 335 | Ga0495603_0031247 | 3300046455 | Bacteria | 3205 |
| 336 | Ga0495603_0125433 | 3300046455 | Bacteria | 1496 |
| 337 | Ga0495603_0128705 | 3300046455 | Bacteria | 1475 |
| 338 | Ga0495629_0012454 | 3300046459 | Bacteria | 6160 |
| 339 | Ga0495629_0013580 | 3300046459 | Bacteria | 5876 |
| 340 | Ga0495629_0106255 | 3300046459 | Bacteria | 1958 |
| 341 | Ga0495638_0094796 | 3300046460 | Bacteria | 1793 |
| 342 | Ga0495638_0133683 | 3300046460 | Bacteria | 1455 |
| 343 | Ga0495641_0009295 | 3300046461 | Bacteria | 5853 |
| 344 | Ga0495651_0048795 | 3300046462 | Bacteria | 3269 |
| 345 | Ga0495653_0011476 | 3300046463 | Bacteria | 7240 |
| 346 | Ga0495653_0076013 | 3300046463 | Bacteria | 2498 |
| 347 | Ga0495650_0056849 | 3300046471 | Bacteria | 1586 |
| 348 | Ga0495580_0010932 | 3300046472 | Bacteria | 7043 |
| 349 | Ga0495582_0002795 | 3300046473 | Bacteria | 9752 |
| 350 | Ga0495605_0015828 | 3300046474 | Bacteria | 4095 |
| 351 | Ga0495639_0003127 | 3300046475 | Bacteria | 7191 |
| 352 | Ga0495639_0015064 | 3300046475 | Bacteria | 3352 |
| 353 | Ga0495662_0013605 | 3300046476 | Bacteria | 3960 |
| 354 | Ga0495664_0035286 | 3300046477 | Bacteria | 2944 |
| 355 | Ga0495664_0070424 | 3300046477 | Bacteria | 2088 |
| 356 | Ga0495584_0161645 | 3300046491 | Bacteria | 1138 |
| 357 | Ga0495594_0015807 | 3300046499 | Bacteria | 3969 |
| 358 | Ga0495594_0024096 | 3300046499 | Bacteria | 3266 |
| 359 | Ga0495607_0041541 | 3300046501 | Bacteria | 2731 |
| 360 | Ga0495618_0067269 | 3300046514 | Bacteria | 2278 |
| 361 | Ga0495618_0068094 | 3300046514 | Bacteria | 2264 |
| 362 | Ga0495618_0090693 | 3300046514 | Bacteria | 1954 |
| 363 | Ga0495628_0069068 | 3300046516 | Bacteria | 2756 |
| 364 | Ga0495628_0107201 | 3300046516 | Bacteria | 2151 |
| 365 | Ga0495628_0190745 | 3300046516 | Bacteria | 1547 |
| 366 | Ga0495628_0249760 | 3300046516 | Bacteria | 1325 |
| 367 | Ga0495630_0010940 | 3300046517 | Bacteria | 6555 |
| 368 | Ga0495630_0290472 | 3300046517 | Bacteria | 1249 |
| 369 | Ga0495631_0102790 | 3300046518 | Bacteria | 1229 |
| 370 | Ga0495631_0120927 | 3300046518 | Bacteria | 1126 |
| 371 | Ga0495632_0128279 | 3300046519 | Bacteria | 1181 |
| 372 | Ga0495644_0040062 | 3300046523 | Bacteria | 1766 |
| 373 | Ga0495648_0001345 | 3300046524 | Bacteria | 24267 |
| 374 | Ga0495666_0073992 | 3300046526 | Bacteria | 1616 |
| 375 | Ga0495652_0080949 | 3300046529 | Bacteria | 2680 |
| 376 | Ga0495652_0088365 | 3300046529 | Bacteria | 2540 |
| 377 | Ga0495665_0005849 | 3300046531 | Bacteria | 6634 |
| 378 | Ga0495640_0056506 | 3300046533 | Bacteria | 2681 |
| 379 | Ga0495587_0028352 | 3300046536 | Bacteria | 3404 |
| 380 | Ga0495598_0011004 | 3300046537 | Bacteria | 2182 |
| 381 | Ga0495598_0069884 | 3300046537 | Bacteria | 1103 |
| 382 | Ga0495621_0030482 | 3300046539 | Bacteria | 1844 |
| 383 | Ga0495645_0050179 | 3300046543 | Bacteria | 3038 |
| 384 | Ga0495622_0008327 | 3300046557 | Bacteria | 4804 |
| 385 | Ga0495633_0033297 | 3300046558 | Bacteria | 2485 |
| 386 | Ga0495667_0008834 | 3300046559 | Bacteria | 6851 |
| 387 | Ga0495667_0067119 | 3300046559 | Bacteria | 2344 |
| 388 | Ga0495656_0093408 | 3300046615 | Bacteria | 1379 |
| 389 | Ga0495668_0175286 | 3300046616 | Bacteria | 1175 |
| 390 | Ga0495634_0023772 | 3300046642 | Bacteria | 4305 |
| 391 | Ga0495634_0062859 | 3300046642 | Bacteria | 2464 |
| 392 | Ga0495634_0102617 | 3300046642 | Bacteria | 1847 |
| 393 | Ga0495611_0118588 | 3300046648 | Bacteria | 1233 |
| 394 | Ga0495635_0005869 | 3300046663 | Bacteria | 8559 |
| 395 | Ga0495635_0034211 | 3300046663 | Bacteria | 3524 |
| 396 | Ga0495635_0143387 | 3300046663 | Bacteria | 1627 |
| 397 | Ga0495635_0296474 | 3300046663 | Bacteria | 1084 |
| 398 | Ga0495635_0316838 | 3300046663 | Bacteria | 1044 |
| 399 | Ga0495659_0006196 | 3300046664 | Bacteria | 3782 |
| 400 | Ga0495661_0137871 | 3300046665 | Bacteria | 1330 |
| 401 | Ga0495588_0012755 | 3300046674 | Bacteria | 3983 |
| 402 | Ga0495657_0003795 | 3300046675 | Bacteria | 12221 |
| 403 | Ga0495599_0005622 | 3300046678 | Bacteria | 7520 |
| 404 | Ga0495599_0090190 | 3300046678 | Bacteria | 1913 |
| 405 | Ga0495599_0209899 | 3300046678 | Bacteria | 1194 |
| 406 | Ga0495623_0010492 | 3300046679 | Bacteria | 5996 |
| 407 | Ga0495646_0009632 | 3300046680 | Bacteria | 6133 |
| 408 | Ga0495647_0000756 | 3300046681 | Bacteria | 9607 |
| 409 | Ga0495658_0002311 | 3300046683 | Bacteria | 9623 |
| 410 | Ga0495669_0023135 | 3300046684 | Bacteria | 2703 |
| 411 | Ga0495613_0025231 | 3300046689 | Bacteria | 4430 |
| 412 | Ga0495613_0123960 | 3300046689 | Bacteria | 1854 |
| 413 | Ga0495624_0007368 | 3300046690 | Bacteria | 7727 |
| 414 | Ga0495624_0134605 | 3300046690 | Bacteria | 1515 |
| 415 | Ga0495624_0142868 | 3300046690 | Bacteria | 1465 |
| 416 | Ga0495600_0001231 | 3300046809 | Bacteria | 14033 |
| 417 | Ga0495600_0046855 | 3300046809 | Bacteria | 2820 |
| 418 | Ga0495581_0031589 | 3300047315 | Bacteria | 3067 |
| 419 | Ga0495581_0116427 | 3300047315 | Bacteria | 1554 |
| 420 | Ga0495604_0038886 | 3300047317 | Bacteria | 3742 |
| 421 | Ga0495636_0119382 | 3300047318 | Bacteria | 1165 |
| 422 | Ga0495674_0003417 | 3300047319 | Bacteria | 15421 |
| 423 | Ga0495674_0010957 | 3300047319 | Bacteria | 8565 |
| 424 | Ga0495674_0101947 | 3300047319 | Bacteria | 2441 |
| 425 | Ga0495674_0129131 | 3300047319 | Bacteria | 2130 |
| 426 | Ga0495672_0011803 | 3300047320 | Bacteria | 6137 |
| 427 | Ga0495672_0020534 | 3300047320 | Bacteria | 4324 |
| 428 | Ga0495676_0023928 | 3300047321 | Bacteria | 5293 |
| 429 | Ga0495676_0053471 | 3300047321 | Bacteria | 3218 |
| 430 | Ga0495676_0060540 | 3300047321 | Bacteria | 2966 |
| 431 | Ga0495676_0120858 | 3300047321 | Bacteria | 1906 |
| 432 | Ga0495680_0001397 | 3300047322 | Bacteria | 26039 |
| 433 | Ga0495680_0063266 | 3300047322 | Bacteria | 2842 |
| 434 | Ga0495675_0024187 | 3300047444 | Bacteria | 3872 |
| 435 | Ga0495673_0101294 | 3300047469 | Bacteria | 1163 |
| 436 | Ga0495684_0002444 | 3300047471 | Bacteria | 14825 |
| 437 | Ga0495684_0007684 | 3300047471 | Bacteria | 8342 |
| 438 | Ga0495684_0312286 | 3300047471 | Bacteria | 1126 |
| 439 | Ga0495686_0107252 | 3300047472 | Bacteria | 1678 |
| 440 | Ga0495593_0001090 | 3300047673 | Bacteria | 15866 |
| 441 | Ga0495593_0001188 | 3300047673 | Bacteria | 15221 |
| 442 | Ga0495593_0020272 | 3300047673 | Bacteria | 3724 |
| 443 | Ga0496100_0048809 | 3300048903 | Bacteria | 2734 |
| 444 | Ga0496100_0058290 | 3300048903 | Bacteria | 2534 |
| 445 | Ga0496100_0106310 | 3300048903 | Bacteria | 1942 |
| 446 | Ga0496100_0163814 | 3300048903 | Bacteria | 1596 |
| 447 | Ga0496101_0027115 | 3300048904 | Bacteria | 3986 |
| 448 | Ga0496101_0100053 | 3300048904 | Bacteria | 2168 |
| 449 | Ga0496102_0027842 | 3300048905 | Bacteria | 5048 |
| 450 | Ga0496102_0035969 | 3300048905 | Bacteria | 4459 |
| 451 | Ga0496102_0086418 | 3300048905 | Bacteria | 2896 |
| 452 | Ga0496102_0119733 | 3300048905 | Bacteria | 2458 |
| 453 | Ga0496103_0019153 | 3300048906 | Bacteria | 4110 |
| 454 | Ga0496103_0058793 | 3300048906 | Bacteria | 2388 |
| 455 | Ga0496103_0160063 | 3300048906 | Bacteria | 1444 |
| 456 | Ga0496104_0045388 | 3300048907 | Bacteria | 4132 |
| 457 | Ga0496104_0050441 | 3300048907 | Bacteria | 3926 |
| 458 | Ga0496104_0064124 | 3300048907 | Bacteria | 3486 |
| 459 | Ga0496105_0017121 | 3300048908 | Bacteria | 5803 |
| 460 | Ga0496105_0028187 | 3300048908 | Bacteria | 4593 |
| 461 | Ga0496105_0034952 | 3300048908 | Bacteria | 4135 |
| 462 | Ga0496105_0080592 | 3300048908 | Bacteria | 2689 |
| 463 | Ga0496105_0257260 | 3300048908 | Bacteria | 1413 |
| 464 | Ga0496105_0286876 | 3300048908 | Bacteria | 1326 |
| 465 | Ga0496106_0001842 | 3300048909 | Bacteria | 15879 |
| 466 | Ga0496106_0025125 | 3300048909 | Bacteria | 4431 |
| 467 | Ga0496106_0052267 | 3300048909 | Bacteria | 3082 |
| 468 | Ga0496106_0079966 | 3300048909 | Bacteria | 2510 |
| 469 | Ga0496106_0119444 | 3300048909 | Bacteria | 2059 |
| 470 | Ga0496106_0176230 | 3300048909 | Bacteria | 1696 |
| 471 | Ga0496106_0277667 | 3300048909 | Bacteria | 1342 |
| 472 | Ga0496107_0067888 | 3300048910 | Bacteria | 2587 |
| 473 | Ga0496107_0095456 | 3300048910 | Bacteria | 2175 |
| 474 | Ga0496107_0102046 | 3300048910 | Bacteria | 2103 |
| 475 | Ga0496107_0180146 | 3300048910 | Bacteria | 1569 |
| 476 | Ga0496108_0032348 | 3300048911 | Bacteria | 4345 |
| 477 | Ga0496108_0127535 | 3300048911 | Bacteria | 2185 |
| 478 | Ga0496108_0275684 | 3300048911 | Bacteria | 1464 |
| 479 | Ga0496108_0465769 | 3300048911 | Bacteria | 1104 |
| 480 | Ga0496109_0036727 | 3300048912 | Bacteria | 4423 |
| 481 | Ga0496109_0139905 | 3300048912 | Bacteria | 2263 |
| 482 | Ga0496109_0159672 | 3300048912 | Bacteria | 2112 |
| 483 | Ga0496110_0131480 | 3300048913 | Bacteria | 2260 |
| 484 | Ga0496111_0030324 | 3300048914 | Bacteria | 3846 |
| 485 | Ga0496111_0058811 | 3300048914 | Bacteria | 2783 |
| 486 | Ga0496111_0075701 | 3300048914 | Bacteria | 2453 |
| 487 | Ga0496112_0000047 | 3300048915 | Bacteria | 84877 |
| 488 | Ga0496112_0013065 | 3300048915 | Bacteria | 7660 |
| 489 | Ga0496112_0014885 | 3300048915 | Bacteria | 7238 |
| 490 | Ga0496112_0044055 | 3300048915 | Bacteria | 4370 |
| 491 | Ga0496112_0068053 | 3300048915 | Bacteria | 3516 |
| 492 | Ga0496112_0079670 | 3300048915 | Bacteria | 3240 |
| 493 | Ga0496112_0291738 | 3300048915 | Bacteria | 1577 |
| 494 | Ga0496112_0292657 | 3300048915 | Bacteria | 1574 |
| 495 | Ga0496113_0018677 | 3300048916 | Bacteria | 4832 |
| 496 | Ga0496113_0108831 | 3300048916 | Bacteria | 2154 |
| 497 | Ga0496113_0208208 | 3300048916 | Bacteria | 1556 |
| 498 | Ga0496114_0180581 | 3300048917 | Bacteria | 1843 |
| 499 | Ga0496114_0210506 | 3300048917 | Bacteria | 1705 |
| 500 | Ga0496114_0223916 | 3300048917 | Bacteria | 1651 |
| 501 | Ga0496114_0286466 | 3300048917 | Bacteria | 1453 |
| 502 | Ga0496115_0033405 | 3300048918 | Bacteria | 4062 |
| 503 | Ga0496115_0040832 | 3300048918 | Bacteria | 3690 |
| 504 | Ga0496115_0260389 | 3300048918 | Bacteria | 1426 |
| 505 | Ga0496115_0329044 | 3300048918 | Bacteria | 1249 |
| 506 | Ga0496117_0078872 | 3300048920 | Bacteria | 2172 |
| 507 | Ga0496117_0153717 | 3300048920 | Bacteria | 1358 |
| 508 | Ga0496118_0005620 | 3300048921 | Bacteria | 14161 |
| 509 | Ga0496118_0051579 | 3300048921 | Bacteria | 3146 |
| 510 | Ga0496119_0025754 | 3300048922 | Bacteria | 4100 |
| 511 | Ga0496121_0003623 | 3300048924 | Bacteria | 21781 |
| 512 | Ga0496121_0005449 | 3300048924 | Bacteria | 16302 |
| 513 | Ga0496121_0031652 | 3300048924 | Bacteria | 4828 |
| 514 | Ga0496121_0057251 | 3300048924 | Bacteria | 3232 |
| 515 | Ga0496121_0059059 | 3300048924 | Bacteria | 3165 |
| 516 | Ga0496121_0102926 | 3300048924 | Bacteria | 2198 |
| 517 | Ga0496121_0135760 | 3300048924 | Bacteria | 1833 |
| 518 | Ga0496121_0263902 | 3300048924 | Bacteria | 1187 |
| 519 | Ga0496122_0056740 | 3300048925 | Bacteria | 2917 |
| 520 | Ga0496124_0002607 | 3300048927 | Bacteria | 23290 |
| 521 | Ga0496125_0057339 | 3300048928 | Bacteria | 3155 |
| 522 | Ga0496125_0066138 | 3300048928 | Bacteria | 2859 |
| 523 | Ga0496126_0017110 | 3300048929 | Bacteria | 7229 |
| 524 | Ga0496126_0028939 | 3300048929 | Bacteria | 5269 |
| 525 | Ga0496126_0032878 | 3300048929 | Bacteria | 4881 |
| 526 | Ga0496126_0040542 | 3300048929 | Bacteria | 4316 |
| 527 | Ga0496126_0059411 | 3300048929 | Bacteria | 3443 |
| 528 | Ga0496126_0068555 | 3300048929 | Bacteria | 3167 |
| 529 | Ga0496126_0081188 | 3300048929 | Bacteria | 2867 |
| 530 | Ga0496126_0101814 | 3300048929 | Bacteria | 2512 |
| 531 | Ga0501067_0171627 | 3300049583 | Bacteria | 1208 |
| 532 | Ga0501070_0011623 | 3300049586 | Bacteria | 7432 |
| 533 | Ga0501074_0019024 | 3300049590 | Bacteria | 4988 |
| 534 | Ga0501080_0228437 | 3300049742 | Bacteria | 1701 |
| 535 | Ga0501035_0046144 | 3300049822 | Bacteria | 3919 |
| 536 | Ga0501035_0313297 | 3300049822 | Bacteria | 1320 |
| 537 | Ga0501035_0409614 | 3300049822 | Bacteria | 1127 |
| 538 | Ga0501044_0042664 | 3300049823 | Bacteria | 4717 |
| 539 | nmdc:mga03683_18241_c1 | 3300050489 | Bacteria | 2665 |
| 540 | nmdc:mga03n38_7516_c1 | 3300050490 | Bacteria | 3859 |
| 541 | nmdc:mga0yw44_204153_c1 | 3300050492 | Bacteria | 1306 |
| 542 | nmdc:mga0yw44_91516_c1 | 3300050492 | Bacteria | 1466 |
| 543 | nmdc:mga06z11_28368_c1 | 3300050494 | Bacteria | 2685 |
| 544 | nmdc:mga06z11_94423_c1 | 3300050494 | Bacteria | 1630 |
| 545 | nmdc:mga04h51_8678_c1 | 3300050495 | Bacteria | 2725 |
| 546 | nmdc:mga07m45_114939_c1 | 3300050496 | Bacteria | 1552 |
| 547 | nmdc:mga07m45_9011_c1 | 3300050496 | Bacteria | 5155 |
| 548 | nmdc:mga05p37_20372_c1 | 3300050507 | Bacteria | 8023 |
| 549 | nmdc:mga08y16_58363_c1 | 3300050511 | Bacteria | 4032 |
| 550 | Ga0495601_0033375 | 3300053077 | Bacteria | 3207 |
| 551 | Ga0500635_0017578 | 3300053080 | Bacteria | 2145 |
| 552 | Ga0495595_0007763 | 3300053084 | Bacteria | 4393 |
| 553 | Ga0495619_0002735 | 3300053085 | Bacteria | 11519 |
| 554 | Ga0495619_0054013 | 3300053085 | Bacteria | 2658 |
| 555 | Ga0495619_0080463 | 3300053085 | Bacteria | 2192 |
| 556 | Ga0495619_0192100 | 3300053085 | Bacteria | 1413 |
| 557 | Ga0500578_0167698 | 3300053086 | Bacteria | 1359 |
| 558 | Ga0500646_0035743 | 3300053090 | Bacteria | 1382 |
| 559 | Ga0500647_0028787 | 3300053091 | Bacteria | 2632 |
| 560 | Ga0500651_0030743 | 3300053093 | Bacteria | 3380 |
| 561 | Ga0500566_0008936 | 3300053094 | Bacteria | 5923 |
| 562 | Ga0500566_0035996 | 3300053094 | Bacteria | 2874 |
| 563 | Ga0500640_003126 | 3300053095 | Bacteria | 5683 |
| 564 | Ga0500554_000823 | 3300053102 | Bacteria | 6093 |
| 565 | Ga0500572_001020 | 3300053111 | Bacteria | 8436 |
| 566 | Ga0500572_001886 | 3300053111 | Bacteria | 5285 |
| 567 | Ga0500595_004790 | 3300053119 | Bacteria | 5994 |
| 568 | Ga0500595_007854 | 3300053119 | Bacteria | 4394 |
| 569 | Ga0500595_010801 | 3300053119 | Bacteria | 3608 |
| 570 | Ga0500595_019428 | 3300053119 | Bacteria | 2465 |
| 571 | Ga0500595_023978 | 3300053119 | Bacteria | 2136 |
| 572 | Ga0500608_050701 | 3300053122 | Bacteria | 1994 |
| 573 | Ga0500614_001759 | 3300053123 | Bacteria | 5030 |
| 574 | Ga0500655_007495 | 3300053133 | Bacteria | 1962 |
| 575 | Ga0500658_0003745 | 3300053134 | Bacteria | 5725 |
| 576 | Ga0500559_0001286 | 3300053136 | Bacteria | 14564 |
| 577 | Ga0500559_0009338 | 3300053136 | Bacteria | 4250 |
| 578 | Ga0500568_0004039 | 3300053139 | Bacteria | 7952 |
| 579 | Ga0500568_0014097 | 3300053139 | Bacteria | 3622 |
| 580 | Ga0500568_0014193 | 3300053139 | Bacteria | 3605 |
| 581 | Ga0500573_0016725 | 3300053140 | Bacteria | 4167 |
| 582 | Ga0500590_046862 | 3300053148 | Bacteria | 2208 |
| 583 | Ga0500603_001833 | 3300053150 | Bacteria | 4759 |
| 584 | Ga0500603_001990 | 3300053150 | Bacteria | 4535 |
| 585 | Ga0500630_007371 | 3300053159 | Bacteria | 5397 |
| 586 | Ga0500638_003913 | 3300053162 | Bacteria | 5622 |
| 587 | Ga0500639_000165 | 3300053163 | Bacteria | 32213 |
| 588 | Ga0500639_091609 | 3300053163 | Bacteria | 1513 |
| 589 | Ga0500636_0031372 | 3300053177 | Bacteria | 3145 |
| 590 | Ga0500636_0056309 | 3300053177 | Bacteria | 2303 |
| 591 | Ga0500576_024162 | 3300053725 | Bacteria | 2772 |
| 592 | Ga0500645_015347 | 3300053730 | Bacteria | 2428 |
| 593 | Ga0500552_004656 | 3300053733 | Bacteria | 1456 |
| 594 | Ga0500596_001068 | 3300053735 | Bacteria | 5520 |
| 595 | Ga0500661_000594 | 3300055283 | Bacteria | 6768 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028794 | Ga0307515_10225939 | Ga0307515_102259392 | 280 |
| 2 | 3300027671 | Ga0209588_1000803 | Ga0209588_10008036 | 288 |
| 3 | 3300035118 | Ga0373954_0140410 | Ga0373954_0140410_128_1075 | 288 |
| 4 | 3300035172 | Ga0373955_0026294 | Ga0373955_0026294_2034_2981 | 288 |
| 5 | 3300035724 | Ga0373933_0274242 | Ga0373933_0274242_132_1079 | 288 |
| 6 | 3300035725 | Ga0373947_0189845 | Ga0373947_0189845_17_895 | 290 |
| 7 | 3300048915 | Ga0496112_0044055 | Ga0496112_0044055_20_892 | 290 |
| 8 | 3300010159 | Ga0099796_10068747 | Ga0099796_100687471 | 291 |
| 9 | 3300047469 | Ga0495673_0101294 | Ga0495673_0101294_125_1078 | 298 |
| 10 | 3300046537 | Ga0495598_0069884 | Ga0495598_0069884_34_942 | 300 |
| 11 | 3300046539 | Ga0495621_0030482 | Ga0495621_0030482_906_1814 | 300 |
| 12 | 3300048911 | Ga0496108_0465769 | Ga0496108_0465769_156_1076 | 300 |
| 13 | 3300048915 | Ga0496112_0291738 | Ga0496112_0291738_111_1013 | 300 |
| 14 | 3300046678 | Ga0495599_0090190 | Ga0495599_0090190_762_1673 | 301 |
| 15 | 3300037068 | Ga0373925_0060012 | Ga0373925_0060012_757_1680 | 305 |
| 16 | 3300005981 | Ga0081538_10129470 | Ga0081538_101294701 | 306 |
| 17 | 3300005719 | Ga0068861_100049133 | Ga0068861_1000491334 | 308 |
| 18 | 3300035111 | Ga0373923_0029918 | Ga0373923_0029918_401_1348 | 308 |
| 19 | 3300035113 | Ga0373936_0005185 | Ga0373936_0005185_2733_3680 | 308 |
| 20 | 3300035119 | Ga0373956_0045318 | Ga0373956_0045318_973_1920 | 308 |
| 21 | 3300035171 | Ga0373946_0021271 | Ga0373946_0021271_1271_2218 | 308 |
| 22 | 3300035692 | Ga0373935_0003476 | Ga0373935_0003476_1328_2275 | 308 |
| 23 | 3300035695 | Ga0373927_0007145 | Ga0373927_0007145_865_1812 | 308 |
| 24 | 3300035725 | Ga0373947_0008928 | Ga0373947_0008928_3974_4921 | 308 |
| 25 | 3300036401 | Ga0373937_0213177 | Ga0373937_0213177_170_1117 | 308 |
| 26 | 3300037068 | Ga0373925_0008986 | Ga0373925_0008986_3787_4734 | 308 |
| 27 | 3300046454 | Ga0495592_0136885 | Ga0495592_0136885_571_1518 | 308 |
| 28 | 3300046455 | Ga0495603_0010687 | Ga0495603_0010687_3954_4901 | 308 |
| 29 | 3300046459 | Ga0495629_0013580 | Ga0495629_0013580_1288_2235 | 308 |
| 30 | 3300046461 | Ga0495641_0009295 | Ga0495641_0009295_3622_4569 | 308 |
| 31 | 3300046463 | Ga0495653_0076013 | Ga0495653_0076013_1279_2226 | 308 |
| 32 | 3300046472 | Ga0495580_0010932 | Ga0495580_0010932_5567_6514 | 308 |
| 33 | 3300046473 | Ga0495582_0002795 | Ga0495582_0002795_2310_3257 | 308 |
| 34 | 3300046475 | Ga0495639_0003127 | Ga0495639_0003127_1663_2610 | 308 |
| 35 | 3300046476 | Ga0495662_0013605 | Ga0495662_0013605_900_1847 | 308 |
| 36 | 3300046477 | Ga0495664_0070424 | Ga0495664_0070424_546_1493 | 308 |
| 37 | 3300046499 | Ga0495594_0024096 | Ga0495594_0024096_203_1150 | 308 |
| 38 | 3300046514 | Ga0495618_0068094 | Ga0495618_0068094_862_1809 | 308 |
| 39 | 3300046516 | Ga0495628_0107201 | Ga0495628_0107201_233_1180 | 308 |
| 40 | 3300046517 | Ga0495630_0010940 | Ga0495630_0010940_2316_3263 | 308 |
| 41 | 3300046526 | Ga0495666_0073992 | Ga0495666_0073992_649_1596 | 308 |
| 42 | 3300046529 | Ga0495652_0088365 | Ga0495652_0088365_327_1274 | 308 |
| 43 | 3300046531 | Ga0495665_0005849 | Ga0495665_0005849_5632_6579 | 308 |
| 44 | 3300046557 | Ga0495622_0008327 | Ga0495622_0008327_1938_2885 | 308 |
| 45 | 3300046559 | Ga0495667_0067119 | Ga0495667_0067119_576_1523 | 308 |
| 46 | 3300046642 | Ga0495634_0023772 | Ga0495634_0023772_2496_3443 | 308 |
| 47 | 3300046663 | Ga0495635_0005869 | Ga0495635_0005869_3163_4110 | 308 |
| 48 | 3300046674 | Ga0495588_0012755 | Ga0495588_0012755_972_1919 | 308 |
| 49 | 3300046681 | Ga0495647_0000756 | Ga0495647_0000756_4306_5253 | 308 |
| 50 | 3300046683 | Ga0495658_0002311 | Ga0495658_0002311_5682_6629 | 308 |
| 51 | 3300046689 | Ga0495613_0025231 | Ga0495613_0025231_2938_3885 | 308 |
| 52 | 3300046690 | Ga0495624_0007368 | Ga0495624_0007368_5689_6636 | 308 |
| 53 | 3300047315 | Ga0495581_0031589 | Ga0495581_0031589_1026_1973 | 308 |
| 54 | 3300047319 | Ga0495674_0003417 | Ga0495674_0003417_8512_9459 | 308 |
| 55 | 3300047321 | Ga0495676_0023928 | Ga0495676_0023928_2329_3276 | 308 |
| 56 | 3300047673 | Ga0495593_0001090 | Ga0495593_0001090_9372_10319 | 308 |
| 57 | 3300006177 | Ga0075362_10021046 | Ga0075362_100210461 | 310 |
| 58 | 3300039437 | Ga0436365_1272752 | Ga0436365_1272752_842_1810 | 310 |
| 59 | 3300053134 | Ga0500658_0003745 | Ga0500658_0003745_2609_3577 | 310 |
| 60 | 3300053139 | Ga0500568_0004039 | Ga0500568_0004039_3576_4544 | 310 |
| 61 | 3300053140 | Ga0500573_0016725 | Ga0500573_0016725_438_1370 | 310 |
| 62 | 3300053177 | Ga0500636_0031372 | Ga0500636_0031372_1745_2677 | 310 |
| 63 | iso_pu_bacteria | 2667528175 | 2671118140 | 310 |
| 64 | 3300048908 | Ga0496105_0257260 | Ga0496105_0257260_45_986 | 311 |
| 65 | 3300048909 | Ga0496106_0025125 | Ga0496106_0025125_839_1780 | 311 |
| 66 | 3300048910 | Ga0496107_0067888 | Ga0496107_0067888_1120_2061 | 311 |
| 67 | 3300048911 | Ga0496108_0032348 | Ga0496108_0032348_708_1649 | 311 |
| 68 | 3300048912 | Ga0496109_0036727 | Ga0496109_0036727_837_1778 | 311 |
| 69 | 3300048915 | Ga0496112_0013065 | Ga0496112_0013065_1596_2537 | 311 |
| 70 | iso_pu_bacteria | 2513237096 | 2513658372 | 311 |
| 71 | iso_pu_bacteria | 2513237101 | 2513695958 | 311 |
| 72 | iso_pu_bacteria | 2513237137 | 2513857552 | 311 |
| 73 | iso_pu_bacteria | 2513237145 | 2513920136 | 311 |
| 74 | iso_pu_bacteria | 2517572143 | 2517893504 | 311 |
| 75 | iso_pu_bacteria | 2524023210 | 2524469956 | 311 |
| 76 | iso_pu_bacteria | 2524023228 | 2524538010 | 311 |
| 77 | iso_pu_bacteria | 2643221651 | 2644287936 | 311 |
| 78 | iso_pu_bacteria | 2721755755 | 2723846187 | 311 |
| 79 | iso_pu_bacteria | 2728368998 | 2728747733 | 311 |
| 80 | iso_pu_bacteria | 2791355196 | 2793060232 | 311 |
| 81 | iso_pu_bacteria | 2791355199 | 2793076640 | 311 |
| 82 | iso_pu_bacteria | 2874604998 | 2874610898 | 311 |
| 83 | iso_pu_bacteria | 2874628541 | 2874632672 | 311 |
| 84 | iso_pu_bacteria | 2876808645 | 2876810410 | 311 |
| 85 | iso_pu_bacteria | 2879110137 | 2879110513 | 311 |
| 86 | iso_pu_bacteria | 2885374607 | 2885380963 | 311 |
| 87 | iso_pu_bacteria | 2885383462 | 2885384462 | 311 |
| 88 | iso_pu_bacteria | 2889033259 | 2889041139 | 311 |
| 89 | iso_pu_bacteria | 2903748898 | 2903758280 | 311 |
| 90 | iso_pu_bacteria | 2904690495 | 2904696877 | 311 |
| 91 | iso_pu_bacteria | 2906610324 | 2906610387 | 311 |
| 92 | iso_pu_bacteria | 2906635258 | 2906642805 | 311 |
| 93 | iso_pu_bacteria | 2906660503 | 2906665940 | 311 |
| 94 | iso_pu_bacteria | 2908739725 | 2908743908 | 311 |
| 95 | iso_pu_bacteria | 2908756301 | 2908761454 | 311 |
| 96 | iso_pu_bacteria | 2922361189 | 2922361986 | 311 |
| 97 | iso_pu_bacteria | 2922386360 | 2922392005 | 311 |
| 98 | iso_pu_bacteria | 2935630451 | 2935637763 | 311 |
| 99 | iso_pu_bacteria | 2941507105 | 2941514436 | 311 |
| 100 | iso_pu_bacteria | 2941515067 | 2941522332 | 311 |
| 101 | iso_pu_bacteria | 2941523033 | 2941530149 | 311 |
| 102 | iso_pu_bacteria | 3005474847 | 3005479119 | 311 |
| 103 | iso_pu_bacteria | 3005710791 | 3005713732 | 311 |
| 104 | iso_pu_bacteria | 8006933436 | 8006942232 | 311 |
| 105 | iso_pu_bacteria | 8006964411 | 8006964545 | 311 |
| 106 | iso_pu_bacteria | 8006973647 | 8006981966 | 311 |
| 107 | iso_pu_bacteria | 8006984368 | 8006986837 | 311 |
| 108 | iso_pu_bacteria | 8006994254 | 8006996055 | 311 |
| 109 | iso_pu_bacteria | 8019659431 | 8019663503 | 311 |
| 110 | iso_pu_bacteria | 8056673599 | 8056680445 | 311 |
| 111 | iso_pu_bacteria | 8056681323 | 8056684504 | 311 |
| 112 | 3300025297 | Ga0209758_1008841 | Ga0209758_10088415 | 314 |
| 113 | 3300049822 | Ga0501035_0046144 | Ga0501035_0046144_745_1728 | 314 |
| 114 | 3300003203 | JGI25406J46586_10000162 | JGI25406J46586_100001624 | 315 |
| 115 | 3300003203 | JGI25406J46586_10015420 | JGI25406J46586_100154204 | 315 |
| 116 | 3300003203 | JGI25406J46586_10021918 | JGI25406J46586_100219182 | 315 |
| 117 | 3300003659 | JGI25404J52841_10014050 | JGI25404J52841_100140502 | 315 |
| 118 | 3300003659 | JGI25404J52841_10020571 | JGI25404J52841_100205711 | 315 |
| 119 | 3300005327 | Ga0070658_10065497 | Ga0070658_100654972 | 315 |
| 120 | 3300005327 | Ga0070658_10091539 | Ga0070658_100915392 | 315 |
| 121 | 3300005329 | Ga0070683_100126479 | Ga0070683_1001264793 | 315 |
| 122 | 3300005329 | Ga0070683_100309420 | Ga0070683_1003094201 | 315 |
| 123 | 3300005330 | Ga0070690_100067481 | Ga0070690_1000674812 | 315 |
| 124 | 3300005334 | Ga0068869_100075256 | Ga0068869_1000752562 | 315 |
| 125 | 3300005335 | Ga0070666_10194612 | Ga0070666_101946122 | 315 |
| 126 | 3300005336 | Ga0070680_100156871 | Ga0070680_1001568712 | 315 |
| 127 | 3300005337 | Ga0070682_100097892 | Ga0070682_1000978921 | 315 |
| 128 | 3300005338 | Ga0068868_100107560 | Ga0068868_1001075602 | 315 |
| 129 | 3300005341 | Ga0070691_10101928 | Ga0070691_101019281 | 315 |
| 130 | 3300005353 | Ga0070669_100048296 | Ga0070669_1000482963 | 315 |
| 131 | 3300005354 | Ga0070675_100292447 | Ga0070675_1002924472 | 315 |
| 132 | 3300005355 | Ga0070671_100065717 | Ga0070671_1000657174 | 315 |
| 133 | 3300005356 | Ga0070674_100157936 | Ga0070674_1001579362 | 315 |
| 134 | 3300005356 | Ga0070674_100159235 | Ga0070674_1001592351 | 315 |
| 135 | 3300005434 | Ga0070709_10007290 | Ga0070709_100072902 | 315 |
| 136 | 3300005434 | Ga0070709_10029833 | Ga0070709_100298333 | 315 |
| 137 | 3300005434 | Ga0070709_10179164 | Ga0070709_101791641 | 315 |
| 138 | 3300005435 | Ga0070714_100012235 | Ga0070714_1000122352 | 315 |
| 139 | 3300005436 | Ga0070713_100019531 | Ga0070713_1000195312 | 315 |
| 140 | 3300005436 | Ga0070713_100198414 | Ga0070713_1001984142 | 315 |
| 141 | 3300005437 | Ga0070710_10009691 | Ga0070710_100096913 | 315 |
| 142 | 3300005439 | Ga0070711_100112504 | Ga0070711_1001125042 | 315 |
| 143 | 3300005455 | Ga0070663_100027389 | Ga0070663_1000273892 | 315 |
| 144 | 3300005455 | Ga0070663_100143290 | Ga0070663_1001432902 | 315 |
| 145 | 3300005455 | Ga0070663_100234649 | Ga0070663_1002346492 | 315 |
| 146 | 3300005456 | Ga0070678_100025743 | Ga0070678_1000257432 | 315 |
| 147 | 3300005456 | Ga0070678_100226327 | Ga0070678_1002263271 | 315 |
| 148 | 3300005458 | Ga0070681_10089919 | Ga0070681_100899193 | 315 |
| 149 | 3300005458 | Ga0070681_10200365 | Ga0070681_102003652 | 315 |
| 150 | 3300005458 | Ga0070681_10230082 | Ga0070681_102300821 | 315 |
| 151 | 3300005458 | Ga0070681_10285790 | Ga0070681_102857901 | 315 |
| 152 | 3300005468 | Ga0070707_100545481 | Ga0070707_1005454811 | 315 |
| 153 | 3300005530 | Ga0070679_100092381 | Ga0070679_1000923814 | 315 |
| 154 | 3300005530 | Ga0070679_100118983 | Ga0070679_1001189833 | 315 |
| 155 | 3300005530 | Ga0070679_100152926 | Ga0070679_1001529262 | 315 |
| 156 | 3300005530 | Ga0070679_100200429 | Ga0070679_1002004292 | 315 |
| 157 | 3300005535 | Ga0070684_100034836 | Ga0070684_1000348363 | 315 |
| 158 | 3300005535 | Ga0070684_100368277 | Ga0070684_1003682772 | 315 |
| 159 | 3300005535 | Ga0070684_100376382 | Ga0070684_1003763821 | 315 |
| 160 | 3300005539 | Ga0068853_100077509 | Ga0068853_1000775091 | 315 |
| 161 | 3300005539 | Ga0068853_100107104 | Ga0068853_1001071042 | 315 |
| 162 | 3300005539 | Ga0068853_100118787 | Ga0068853_1001187872 | 315 |
| 163 | 3300005547 | Ga0070693_100089834 | Ga0070693_1000898341 | 315 |
| 164 | 3300005548 | Ga0070665_100042707 | Ga0070665_1000427075 | 315 |
| 165 | 3300005548 | Ga0070665_100074604 | Ga0070665_1000746042 | 315 |
| 166 | 3300005548 | Ga0070665_100262983 | Ga0070665_1002629832 | 315 |
| 167 | 3300005548 | Ga0070665_100361553 | Ga0070665_1003615532 | 315 |
| 168 | 3300005563 | Ga0068855_100021801 | Ga0068855_1000218017 | 315 |
| 169 | 3300005563 | Ga0068855_100154929 | Ga0068855_1001549292 | 315 |
| 170 | 3300005563 | Ga0068855_100158887 | Ga0068855_1001588872 | 315 |
| 171 | 3300005563 | Ga0068855_100197906 | Ga0068855_1001979063 | 315 |
| 172 | 3300005564 | Ga0070664_100025149 | Ga0070664_1000251493 | 315 |
| 173 | 3300005616 | Ga0068852_100106616 | Ga0068852_1001066163 | 315 |
| 174 | 3300005616 | Ga0068852_100273986 | Ga0068852_1002739862 | 315 |
| 175 | 3300005617 | Ga0068859_100172173 | Ga0068859_1001721732 | 315 |
| 176 | 3300005618 | Ga0068864_100030397 | Ga0068864_1000303973 | 315 |
| 177 | 3300005618 | Ga0068864_100053526 | Ga0068864_1000535264 | 315 |
| 178 | 3300005719 | Ga0068861_100231402 | Ga0068861_1002314022 | 315 |
| 179 | 3300005719 | Ga0068861_100456198 | Ga0068861_1004561981 | 315 |
| 180 | 3300005843 | Ga0068860_100043210 | Ga0068860_1000432105 | 315 |
| 181 | 3300005843 | Ga0068860_100341016 | Ga0068860_1003410162 | 315 |
| 182 | 3300005844 | Ga0068862_100164844 | Ga0068862_1001648442 | 315 |
| 183 | 3300005844 | Ga0068862_100415962 | Ga0068862_1004159621 | 315 |
| 184 | 3300005937 | Ga0081455_10006819 | Ga0081455_100068199 | 315 |
| 185 | 3300005937 | Ga0081455_10147325 | Ga0081455_101473252 | 315 |
| 186 | 3300005937 | Ga0081455_10160456 | Ga0081455_101604561 | 315 |
| 187 | 3300005983 | Ga0081540_1003121 | Ga0081540_10031211 | 315 |
| 188 | 3300005983 | Ga0081540_1005500 | Ga0081540_10055003 | 315 |
| 189 | 3300005983 | Ga0081540_1009972 | Ga0081540_10099723 | 315 |
| 190 | 3300005983 | Ga0081540_1010599 | Ga0081540_10105997 | 315 |
| 191 | 3300005983 | Ga0081540_1015311 | Ga0081540_10153113 | 315 |
| 192 | 3300005983 | Ga0081540_1016750 | Ga0081540_10167505 | 315 |
| 193 | 3300005983 | Ga0081540_1020563 | Ga0081540_10205632 | 315 |
| 194 | 3300005983 | Ga0081540_1023691 | Ga0081540_10236914 | 315 |
| 195 | 3300005983 | Ga0081540_1033249 | Ga0081540_10332493 | 315 |
| 196 | 3300005983 | Ga0081540_1046015 | Ga0081540_10460152 | 315 |
| 197 | 3300005985 | Ga0081539_10000203 | Ga0081539_100002031 | 315 |
| 198 | 3300005985 | Ga0081539_10001007 | Ga0081539_1000100735 | 315 |
| 199 | 3300005985 | Ga0081539_10046196 | Ga0081539_100461962 | 315 |
| 200 | 3300005985 | Ga0081539_10053621 | Ga0081539_100536213 | 315 |
| 201 | 3300006028 | Ga0070717_10008113 | Ga0070717_100081132 | 315 |
| 202 | 3300006028 | Ga0070717_10012395 | Ga0070717_100123957 | 315 |
| 203 | 3300006028 | Ga0070717_10012865 | Ga0070717_100128658 | 315 |
| 204 | 3300006038 | Ga0075365_10055751 | Ga0075365_100557512 | 315 |
| 205 | 3300006038 | Ga0075365_10121570 | Ga0075365_101215702 | 315 |
| 206 | 3300006042 | Ga0075368_10014800 | Ga0075368_100148003 | 315 |
| 207 | 3300006048 | Ga0075363_100021152 | Ga0075363_1000211522 | 315 |
| 208 | 3300006048 | Ga0075363_100044685 | Ga0075363_1000446853 | 315 |
| 209 | 3300006051 | Ga0075364_10133930 | Ga0075364_101339302 | 315 |
| 210 | 3300006163 | Ga0070715_10006032 | Ga0070715_100060322 | 315 |
| 211 | 3300006173 | Ga0070716_100021193 | Ga0070716_1000211932 | 315 |
| 212 | 3300006177 | Ga0075362_10054390 | Ga0075362_100543902 | 315 |
| 213 | 3300006178 | Ga0075367_10018795 | Ga0075367_100187952 | 315 |
| 214 | 3300006178 | Ga0075367_10050292 | Ga0075367_100502923 | 315 |
| 215 | 3300006186 | Ga0075369_10029140 | Ga0075369_100291402 | 315 |
| 216 | 3300006195 | Ga0075366_10109249 | Ga0075366_101092492 | 315 |
| 217 | 3300006237 | Ga0097621_100096028 | Ga0097621_1000960282 | 315 |
| 218 | 3300006353 | Ga0075370_10049986 | Ga0075370_100499862 | 315 |
| 219 | 3300006358 | Ga0068871_100164814 | Ga0068871_1001648142 | 315 |
| 220 | 3300006844 | Ga0075428_100185910 | Ga0075428_1001859102 | 315 |
| 221 | 3300006844 | Ga0075428_100221966 | Ga0075428_1002219662 | 315 |
| 222 | 3300006881 | Ga0068865_100057305 | Ga0068865_1000573053 | 315 |
| 223 | 3300006931 | Ga0097620_100172175 | Ga0097620_1001721752 | 315 |
| 224 | 3300007076 | Ga0075435_100243703 | Ga0075435_1002437032 | 315 |
| 225 | 3300007788 | Ga0099795_10040124 | Ga0099795_100401242 | 315 |
| 226 | 3300009092 | Ga0105250_10054430 | Ga0105250_100544302 | 315 |
| 227 | 3300009093 | Ga0105240_10052144 | Ga0105240_100521442 | 315 |
| 228 | 3300009093 | Ga0105240_10099593 | Ga0105240_100995934 | 315 |
| 229 | 3300009093 | Ga0105240_10278559 | Ga0105240_102785592 | 315 |
| 230 | 3300009094 | Ga0111539_10061288 | Ga0111539_100612882 | 315 |
| 231 | 3300009098 | Ga0105245_10060845 | Ga0105245_100608454 | 315 |
| 232 | 3300009098 | Ga0105245_10197363 | Ga0105245_101973632 | 315 |
| 233 | 3300009098 | Ga0105245_10280527 | Ga0105245_102805272 | 315 |
| 234 | 3300009147 | Ga0114129_10037091 | Ga0114129_1003709110 | 315 |
| 235 | 3300009148 | Ga0105243_10172665 | Ga0105243_101726652 | 315 |
| 236 | 3300009177 | Ga0105248_10106832 | Ga0105248_101068322 | 315 |
| 237 | 3300009177 | Ga0105248_10176498 | Ga0105248_101764982 | 315 |
| 238 | 3300009177 | Ga0105248_10515306 | Ga0105248_105153062 | 315 |
| 239 | 3300009545 | Ga0105237_10437781 | Ga0105237_104377812 | 315 |
| 240 | 3300009551 | Ga0105238_10375964 | Ga0105238_103759641 | 315 |
| 241 | 3300009553 | Ga0105249_10052110 | Ga0105249_100521102 | 315 |
| 242 | 3300010159 | Ga0099796_10025047 | Ga0099796_100250472 | 315 |
| 243 | 3300010375 | Ga0105239_10050960 | Ga0105239_100509603 | 315 |
| 244 | 3300010375 | Ga0105239_10059034 | Ga0105239_100590345 | 315 |
| 245 | 3300010375 | Ga0105239_10222468 | Ga0105239_102224683 | 315 |
| 246 | 3300011119 | Ga0105246_10189702 | Ga0105246_101897021 | 315 |
| 247 | 3300011119 | Ga0105246_10247825 | Ga0105246_102478252 | 315 |
| 248 | 3300011119 | Ga0105246_10270250 | Ga0105246_102702501 | 315 |
| 249 | 3300013104 | Ga0157370_10137087 | Ga0157370_101370872 | 315 |
| 250 | 3300013105 | Ga0157369_10057918 | Ga0157369_100579185 | 315 |
| 251 | 3300013105 | Ga0157369_10094109 | Ga0157369_100941094 | 315 |
| 252 | 3300013105 | Ga0157369_10264495 | Ga0157369_102644951 | 315 |
| 253 | 3300013105 | Ga0157369_10274159 | Ga0157369_102741592 | 315 |
| 254 | 3300013297 | Ga0157378_10099691 | Ga0157378_100996913 | 315 |
| 255 | 3300013307 | Ga0157372_10104969 | Ga0157372_101049692 | 315 |
| 256 | 3300013307 | Ga0157372_10373339 | Ga0157372_103733391 | 315 |
| 257 | 3300013308 | Ga0157375_10132405 | Ga0157375_101324053 | 315 |
| 258 | 3300013308 | Ga0157375_10264605 | Ga0157375_102646053 | 315 |
| 259 | 3300014325 | Ga0163163_10009181 | Ga0163163_100091818 | 315 |
| 260 | 3300014325 | Ga0163163_10058180 | Ga0163163_100581802 | 315 |
| 261 | 3300014325 | Ga0163163_10073703 | Ga0163163_100737032 | 315 |
| 262 | 3300014326 | Ga0157380_10065271 | Ga0157380_100652713 | 315 |
| 263 | 3300014326 | Ga0157380_10266019 | Ga0157380_102660191 | 315 |
| 264 | 3300014745 | Ga0157377_10089370 | Ga0157377_100893702 | 315 |
| 265 | 3300014745 | Ga0157377_10110907 | Ga0157377_101109072 | 315 |
| 266 | 3300014968 | Ga0157379_10236417 | Ga0157379_102364172 | 315 |
| 267 | 3300014969 | Ga0157376_10046571 | Ga0157376_100465711 | 315 |
| 268 | 3300014969 | Ga0157376_10198960 | Ga0157376_101989602 | 315 |
| 269 | 3300017792 | Ga0163161_10095664 | Ga0163161_100956642 | 315 |
| 270 | 3300025253 | Ga0209677_100683 | Ga0209677_1006837 | 315 |
| 271 | 3300025272 | Ga0209455_1003978 | Ga0209455_10039782 | 315 |
| 272 | 3300025297 | Ga0209758_1015355 | Ga0209758_10153554 | 315 |
| 273 | 3300025297 | Ga0209758_1057789 | Ga0209758_10577891 | 315 |
| 274 | 3300025315 | Ga0207697_10043972 | Ga0207697_100439722 | 315 |
| 275 | 3300025898 | Ga0207692_10033228 | Ga0207692_100332283 | 315 |
| 276 | 3300025899 | Ga0207642_10058186 | Ga0207642_100581862 | 315 |
| 277 | 3300025901 | Ga0207688_10089576 | Ga0207688_100895762 | 315 |
| 278 | 3300025905 | Ga0207685_10001288 | Ga0207685_100012882 | 315 |
| 279 | 3300025906 | Ga0207699_10055499 | Ga0207699_100554993 | 315 |
| 280 | 3300025906 | Ga0207699_10061001 | Ga0207699_100610013 | 315 |
| 281 | 3300025906 | Ga0207699_10107971 | Ga0207699_101079712 | 315 |
| 282 | 3300025912 | Ga0207707_10001527 | Ga0207707_1000152710 | 315 |
| 283 | 3300025912 | Ga0207707_10071173 | Ga0207707_100711733 | 315 |
| 284 | 3300025912 | Ga0207707_10075388 | Ga0207707_100753883 | 315 |
| 285 | 3300025912 | Ga0207707_10147320 | Ga0207707_101473202 | 315 |
| 286 | 3300025912 | Ga0207707_10187513 | Ga0207707_101875132 | 315 |
| 287 | 3300025913 | Ga0207695_10070439 | Ga0207695_100704392 | 315 |
| 288 | 3300025913 | Ga0207695_10146792 | Ga0207695_101467922 | 315 |
| 289 | 3300025913 | Ga0207695_10226295 | Ga0207695_102262952 | 315 |
| 290 | 3300025913 | Ga0207695_10269330 | Ga0207695_102693302 | 315 |
| 291 | 3300025914 | Ga0207671_10102562 | Ga0207671_101025622 | 315 |
| 292 | 3300025915 | Ga0207693_10001370 | Ga0207693_100013705 | 315 |
| 293 | 3300025916 | Ga0207663_10000401 | Ga0207663_100004017 | 315 |
| 294 | 3300025917 | Ga0207660_10002267 | Ga0207660_100022675 | 315 |
| 295 | 3300025917 | Ga0207660_10141596 | Ga0207660_101415961 | 315 |
| 296 | 3300025918 | Ga0207662_10048762 | Ga0207662_100487621 | 315 |
| 297 | 3300025919 | Ga0207657_10051473 | Ga0207657_100514732 | 315 |
| 298 | 3300025920 | Ga0207649_10221806 | Ga0207649_102218062 | 315 |
| 299 | 3300025921 | Ga0207652_10011331 | Ga0207652_1001133110 | 315 |
| 300 | 3300025921 | Ga0207652_10047386 | Ga0207652_100473861 | 315 |
| 301 | 3300025921 | Ga0207652_10088570 | Ga0207652_100885703 | 315 |
| 302 | 3300025921 | Ga0207652_10118505 | Ga0207652_101185052 | 315 |
| 303 | 3300025927 | Ga0207687_10040402 | Ga0207687_100404024 | 315 |
| 304 | 3300025927 | Ga0207687_10204075 | Ga0207687_102040752 | 315 |
| 305 | 3300025928 | Ga0207700_10063688 | Ga0207700_100636881 | 315 |
| 306 | 3300025929 | Ga0207664_10006050 | Ga0207664_100060506 | 315 |
| 307 | 3300025933 | Ga0207706_10089367 | Ga0207706_100893674 | 315 |
| 308 | 3300025937 | Ga0207669_10016122 | Ga0207669_100161222 | 315 |
| 309 | 3300025937 | Ga0207669_10304740 | Ga0207669_103047402 | 315 |
| 310 | 3300025938 | Ga0207704_10310009 | Ga0207704_103100091 | 315 |
| 311 | 3300025939 | Ga0207665_10006374 | Ga0207665_100063742 | 315 |
| 312 | 3300025939 | Ga0207665_10263242 | Ga0207665_102632421 | 315 |
| 313 | 3300025940 | Ga0207691_10338864 | Ga0207691_103388642 | 315 |
| 314 | 3300025941 | Ga0207711_10089662 | Ga0207711_100896622 | 315 |
| 315 | 3300025941 | Ga0207711_10204848 | Ga0207711_102048481 | 315 |
| 316 | 3300025942 | Ga0207689_10080649 | Ga0207689_100806492 | 315 |
| 317 | 3300025944 | Ga0207661_10338476 | Ga0207661_103384762 | 315 |
| 318 | 3300025944 | Ga0207661_10465695 | Ga0207661_104656951 | 315 |
| 319 | 3300025945 | Ga0207679_10063875 | Ga0207679_100638753 | 315 |
| 320 | 3300025949 | Ga0207667_10043345 | Ga0207667_100433453 | 315 |
| 321 | 3300025949 | Ga0207667_10061169 | Ga0207667_100611691 | 315 |
| 322 | 3300025961 | Ga0207712_10041957 | Ga0207712_100419572 | 315 |
| 323 | 3300025972 | Ga0207668_10156423 | Ga0207668_101564232 | 315 |
| 324 | 3300025972 | Ga0207668_10244199 | Ga0207668_102441992 | 315 |
| 325 | 3300025981 | Ga0207640_10134410 | Ga0207640_101344102 | 315 |
| 326 | 3300026023 | Ga0207677_10136070 | Ga0207677_101360702 | 315 |
| 327 | 3300026023 | Ga0207677_10228838 | Ga0207677_102288382 | 315 |
| 328 | 3300026035 | Ga0207703_10055174 | Ga0207703_100551744 | 315 |
| 329 | 3300026035 | Ga0207703_10266439 | Ga0207703_102664392 | 315 |
| 330 | 3300026041 | Ga0207639_10028993 | Ga0207639_100289935 | 315 |
| 331 | 3300026041 | Ga0207639_10205704 | Ga0207639_102057041 | 315 |
| 332 | 3300026067 | Ga0207678_10046004 | Ga0207678_100460042 | 315 |
| 333 | 3300026067 | Ga0207678_10084410 | Ga0207678_100844102 | 315 |
| 334 | 3300026067 | Ga0207678_10091509 | Ga0207678_100915091 | 315 |
| 335 | 3300026067 | Ga0207678_10214023 | Ga0207678_102140231 | 315 |
| 336 | 3300026067 | Ga0207678_10306295 | Ga0207678_103062952 | 315 |
| 337 | 3300026075 | Ga0207708_10046583 | Ga0207708_100465832 | 315 |
| 338 | 3300026078 | Ga0207702_10001820 | Ga0207702_100018204 | 315 |
| 339 | 3300026078 | Ga0207702_10175701 | Ga0207702_101757012 | 315 |
| 340 | 3300026089 | Ga0207648_10020807 | Ga0207648_100208076 | 315 |
| 341 | 3300026089 | Ga0207648_10177246 | Ga0207648_101772462 | 315 |
| 342 | 3300026116 | Ga0207674_10156719 | Ga0207674_101567193 | 315 |
| 343 | 3300026116 | Ga0207674_10205094 | Ga0207674_102050942 | 315 |
| 344 | 3300026118 | Ga0207675_100137707 | Ga0207675_1001377071 | 315 |
| 345 | 3300026118 | Ga0207675_100198773 | Ga0207675_1001987732 | 315 |
| 346 | 3300026118 | Ga0207675_100343844 | Ga0207675_1003438442 | 315 |
| 347 | 3300026121 | Ga0207683_10037998 | Ga0207683_100379985 | 315 |
| 348 | 3300026121 | Ga0207683_10123146 | Ga0207683_101231461 | 315 |
| 349 | 3300026121 | Ga0207683_10158095 | Ga0207683_101580952 | 315 |
| 350 | 3300026121 | Ga0207683_10160111 | Ga0207683_101601112 | 315 |
| 351 | 3300026142 | Ga0207698_10094108 | Ga0207698_100941082 | 315 |
| 352 | 3300027512 | Ga0209179_1016377 | Ga0209179_10163771 | 315 |
| 353 | 3300027866 | Ga0209813_10013671 | Ga0209813_100136712 | 315 |
| 354 | 3300028379 | Ga0268266_10022495 | Ga0268266_100224956 | 315 |
| 355 | 3300028379 | Ga0268266_10026512 | Ga0268266_100265124 | 315 |
| 356 | 3300028379 | Ga0268266_10091925 | Ga0268266_100919253 | 315 |
| 357 | 3300028379 | Ga0268266_10321445 | Ga0268266_103214451 | 315 |
| 358 | 3300028380 | Ga0268265_10216042 | Ga0268265_102160422 | 315 |
| 359 | 3300028380 | Ga0268265_10390300 | Ga0268265_103903001 | 315 |
| 360 | 3300028573 | Ga0265334_10040001 | Ga0265334_100400011 | 315 |
| 361 | 3300028786 | Ga0307517_10003022 | Ga0307517_1000302225 | 315 |
| 362 | 3300028794 | Ga0307515_10166131 | Ga0307515_101661311 | 315 |
| 363 | 3300030521 | Ga0307511_10051446 | Ga0307511_100514463 | 315 |
| 364 | 3300031235 | Ga0265330_10009881 | Ga0265330_100098817 | 315 |
| 365 | 3300031235 | Ga0265330_10076819 | Ga0265330_100768192 | 315 |
| 366 | 3300031238 | Ga0265332_10033579 | Ga0265332_100335791 | 315 |
| 367 | 3300031249 | Ga0265339_10002960 | Ga0265339_100029601 | 315 |
| 368 | 3300031249 | Ga0265339_10101012 | Ga0265339_101010121 | 315 |
| 369 | 3300031344 | Ga0265316_10105608 | Ga0265316_101056082 | 315 |
| 370 | 3300031616 | Ga0307508_10098531 | Ga0307508_100985312 | 315 |
| 371 | 3300031616 | Ga0307508_10263179 | Ga0307508_102631792 | 315 |
| 372 | 3300031711 | Ga0265314_10045096 | Ga0265314_100450961 | 315 |
| 373 | 3300031712 | Ga0265342_10005223 | Ga0265342_100052237 | 315 |
| 374 | 3300031712 | Ga0265342_10140817 | Ga0265342_101408171 | 315 |
| 375 | 3300031730 | Ga0307516_10103001 | Ga0307516_101030011 | 315 |
| 376 | 3300031730 | Ga0307516_10264224 | Ga0307516_102642242 | 315 |
| 377 | 3300031824 | Ga0307413_10049870 | Ga0307413_100498702 | 315 |
| 378 | 3300031824 | Ga0307413_10392337 | Ga0307413_103923371 | 315 |
| 379 | 3300031911 | Ga0307412_10242028 | Ga0307412_102420282 | 315 |
| 380 | 3300032002 | Ga0307416_100133505 | Ga0307416_1001335053 | 315 |
| 381 | 3300033179 | Ga0307507_10049223 | Ga0307507_100492233 | 315 |
| 382 | 3300033180 | Ga0307510_10057427 | Ga0307510_100574275 | 315 |
| 383 | 3300033180 | Ga0307510_10108238 | Ga0307510_101082383 | 315 |
| 384 | 3300033442 | Ga0315911_1000009 | Ga0315911_1000009118 | 315 |
| 385 | 3300034957 | Ga0373938_0010029 | Ga0373938_0010029_634_1581 | 315 |
| 386 | 3300035086 | Ga0373934_0025016 | Ga0373934_0025016_151_1104 | 315 |
| 387 | 3300035111 | Ga0373923_0020712 | Ga0373923_0020712_741_1694 | 315 |
| 388 | 3300035113 | Ga0373936_0118676 | Ga0373936_0118676_53_1000 | 315 |
| 389 | 3300035115 | Ga0373941_0029263 | Ga0373941_0029263_185_1132 | 315 |
| 390 | 3300035116 | Ga0373945_0005479 | Ga0373945_0005479_1658_2608 | 315 |
| 391 | 3300035117 | Ga0373953_0010430 | Ga0373953_0010430_620_1573 | 315 |
| 392 | 3300035117 | Ga0373953_0073519 | Ga0373953_0073519_366_1313 | 315 |
| 393 | 3300035118 | Ga0373954_0001806 | Ga0373954_0001806_6903_7856 | 315 |
| 394 | 3300035119 | Ga0373956_0003991 | Ga0373956_0003991_2506_3459 | 315 |
| 395 | 3300035120 | Ga0373957_0067147 | Ga0373957_0067147_289_1242 | 315 |
| 396 | 3300035170 | Ga0373943_0060393 | Ga0373943_0060393_855_1805 | 315 |
| 397 | 3300035171 | Ga0373946_0125125 | Ga0373946_0125125_161_1114 | 315 |
| 398 | 3300035172 | Ga0373955_0007659 | Ga0373955_0007659_1899_2852 | 315 |
| 399 | 3300035172 | Ga0373955_0105902 | Ga0373955_0105902_116_1093 | 315 |
| 400 | 3300035410 | Ga0373924_0014546 | Ga0373924_0014546_13_963 | 315 |
| 401 | 3300035410 | Ga0373924_0068467 | Ga0373924_0068467_439_1392 | 315 |
| 402 | 3300035410 | Ga0373924_0108849 | Ga0373924_0108849_161_1108 | 315 |
| 403 | 3300035691 | Ga0373931_0047397 | Ga0373931_0047397_352_1299 | 315 |
| 404 | 3300035692 | Ga0373935_0017063 | Ga0373935_0017063_3150_4100 | 315 |
| 405 | 3300035692 | Ga0373935_0249424 | Ga0373935_0249424_211_1164 | 315 |
| 406 | 3300035692 | Ga0373935_0261432 | Ga0373935_0261432_156_1103 | 315 |
| 407 | 3300035695 | Ga0373927_0006488 | Ga0373927_0006488_1020_1973 | 315 |
| 408 | 3300035695 | Ga0373927_0074030 | Ga0373927_0074030_440_1393 | 315 |
| 409 | 3300035695 | Ga0373927_0128742 | Ga0373927_0128742_305_1255 | 315 |
| 410 | 3300035724 | Ga0373933_0042788 | Ga0373933_0042788_149_1102 | 315 |
| 411 | 3300037068 | Ga0373925_0010512 | Ga0373925_0010512_4429_5379 | 315 |
| 412 | 3300037068 | Ga0373925_0047030 | Ga0373925_0047030_822_1769 | 315 |
| 413 | 3300037418 | Ga0395900_0110000 | Ga0395900_0110000_139_1092 | 315 |
| 414 | 3300037466 | Ga0395898_0417438 | Ga0395898_0417438_24_974 | 315 |
| 415 | 3300038443 | Ga0395901_0264613 | Ga0395901_0264613_691_1638 | 315 |
| 416 | 3300039447 | Ga0436361_1084832 | Ga0436361_1084832_24_971 | 315 |
| 417 | 3300039450 | Ga0436363_1616347 | Ga0436363_1616347_402_1355 | 315 |
| 418 | 3300044683 | Ga0466965_0012547 | Ga0466965_0012547_1875_2828 | 315 |
| 419 | 3300044694 | Ga0466963_0088940 | Ga0466963_0088940_291_1244 | 315 |
| 420 | 3300044901 | Ga0466960_0174356 | Ga0466960_0174356_100_1053 | 315 |
| 421 | 3300045976 | Ga0466967_0026543 | Ga0466967_0026543_3836_4789 | 315 |
| 422 | 3300045976 | Ga0466967_0032174 | Ga0466967_0032174_3024_3974 | 315 |
| 423 | 3300046454 | Ga0495592_0005851 | Ga0495592_0005851_6897_7850 | 315 |
| 424 | 3300046455 | Ga0495603_0031247 | Ga0495603_0031247_222_1175 | 315 |
| 425 | 3300046455 | Ga0495603_0125433 | Ga0495603_0125433_472_1425 | 315 |
| 426 | 3300046455 | Ga0495603_0128705 | Ga0495603_0128705_289_1239 | 315 |
| 427 | 3300046459 | Ga0495629_0012454 | Ga0495629_0012454_1110_2063 | 315 |
| 428 | 3300046459 | Ga0495629_0106255 | Ga0495629_0106255_786_1739 | 315 |
| 429 | 3300046460 | Ga0495638_0094796 | Ga0495638_0094796_702_1655 | 315 |
| 430 | 3300046460 | Ga0495638_0133683 | Ga0495638_0133683_459_1412 | 315 |
| 431 | 3300046462 | Ga0495651_0048795 | Ga0495651_0048795_1242_2249 | 315 |
| 432 | 3300046463 | Ga0495653_0011476 | Ga0495653_0011476_1448_2401 | 315 |
| 433 | 3300046471 | Ga0495650_0056849 | Ga0495650_0056849_25_978 | 315 |
| 434 | 3300046474 | Ga0495605_0015828 | Ga0495605_0015828_456_1409 | 315 |
| 435 | 3300046475 | Ga0495639_0015064 | Ga0495639_0015064_2114_3091 | 315 |
| 436 | 3300046477 | Ga0495664_0035286 | Ga0495664_0035286_1867_2814 | 315 |
| 437 | 3300046491 | Ga0495584_0161645 | Ga0495584_0161645_41_994 | 315 |
| 438 | 3300046499 | Ga0495594_0015807 | Ga0495594_0015807_491_1444 | 315 |
| 439 | 3300046501 | Ga0495607_0041541 | Ga0495607_0041541_594_1547 | 315 |
| 440 | 3300046514 | Ga0495618_0067269 | Ga0495618_0067269_525_1478 | 315 |
| 441 | 3300046514 | Ga0495618_0090693 | Ga0495618_0090693_227_1177 | 315 |
| 442 | 3300046516 | Ga0495628_0069068 | Ga0495628_0069068_585_1538 | 315 |
| 443 | 3300046516 | Ga0495628_0190745 | Ga0495628_0190745_246_1199 | 315 |
| 444 | 3300046516 | Ga0495628_0249760 | Ga0495628_0249760_26_979 | 315 |
| 445 | 3300046517 | Ga0495630_0290472 | Ga0495630_0290472_165_1118 | 315 |
| 446 | 3300046518 | Ga0495631_0102790 | Ga0495631_0102790_120_1073 | 315 |
| 447 | 3300046518 | Ga0495631_0120927 | Ga0495631_0120927_76_1023 | 315 |
| 448 | 3300046519 | Ga0495632_0128279 | Ga0495632_0128279_102_1055 | 315 |
| 449 | 3300046523 | Ga0495644_0040062 | Ga0495644_0040062_360_1307 | 315 |
| 450 | 3300046524 | Ga0495648_0001345 | Ga0495648_0001345_1434_2387 | 315 |
| 451 | 3300046529 | Ga0495652_0080949 | Ga0495652_0080949_1627_2580 | 315 |
| 452 | 3300046533 | Ga0495640_0056506 | Ga0495640_0056506_68_1018 | 315 |
| 453 | 3300046536 | Ga0495587_0028352 | Ga0495587_0028352_604_1557 | 315 |
| 454 | 3300046537 | Ga0495598_0011004 | Ga0495598_0011004_1063_2010 | 315 |
| 455 | 3300046543 | Ga0495645_0050179 | Ga0495645_0050179_1041_1994 | 315 |
| 456 | 3300046558 | Ga0495633_0033297 | Ga0495633_0033297_89_1042 | 315 |
| 457 | 3300046559 | Ga0495667_0008834 | Ga0495667_0008834_2069_3016 | 315 |
| 458 | 3300046615 | Ga0495656_0093408 | Ga0495656_0093408_332_1279 | 315 |
| 459 | 3300046616 | Ga0495668_0175286 | Ga0495668_0175286_35_988 | 315 |
| 460 | 3300046642 | Ga0495634_0062859 | Ga0495634_0062859_1073_2026 | 315 |
| 461 | 3300046642 | Ga0495634_0102617 | Ga0495634_0102617_476_1426 | 315 |
| 462 | 3300046648 | Ga0495611_0118588 | Ga0495611_0118588_213_1166 | 315 |
| 463 | 3300046663 | Ga0495635_0034211 | Ga0495635_0034211_1146_2099 | 315 |
| 464 | 3300046663 | Ga0495635_0143387 | Ga0495635_0143387_660_1613 | 315 |
| 465 | 3300046663 | Ga0495635_0296474 | Ga0495635_0296474_14_961 | 315 |
| 466 | 3300046663 | Ga0495635_0316838 | Ga0495635_0316838_72_1022 | 315 |
| 467 | 3300046664 | Ga0495659_0006196 | Ga0495659_0006196_2800_3747 | 315 |
| 468 | 3300046665 | Ga0495661_0137871 | Ga0495661_0137871_288_1235 | 315 |
| 469 | 3300046675 | Ga0495657_0003795 | Ga0495657_0003795_10237_11190 | 315 |
| 470 | 3300046678 | Ga0495599_0005622 | Ga0495599_0005622_4513_5466 | 315 |
| 471 | 3300046678 | Ga0495599_0209899 | Ga0495599_0209899_16_963 | 315 |
| 472 | 3300046679 | Ga0495623_0010492 | Ga0495623_0010492_725_1678 | 315 |
| 473 | 3300046680 | Ga0495646_0009632 | Ga0495646_0009632_3124_4077 | 315 |
| 474 | 3300046684 | Ga0495669_0023135 | Ga0495669_0023135_509_1462 | 315 |
| 475 | 3300046689 | Ga0495613_0123960 | Ga0495613_0123960_172_1125 | 315 |
| 476 | 3300046690 | Ga0495624_0134605 | Ga0495624_0134605_386_1339 | 315 |
| 477 | 3300046690 | Ga0495624_0142868 | Ga0495624_0142868_425_1375 | 315 |
| 478 | 3300046809 | Ga0495600_0001231 | Ga0495600_0001231_2649_3602 | 315 |
| 479 | 3300046809 | Ga0495600_0046855 | Ga0495600_0046855_429_1391 | 315 |
| 480 | 3300047315 | Ga0495581_0116427 | Ga0495581_0116427_341_1294 | 315 |
| 481 | 3300047317 | Ga0495604_0038886 | Ga0495604_0038886_1214_2167 | 315 |
| 482 | 3300047318 | Ga0495636_0119382 | Ga0495636_0119382_172_1119 | 315 |
| 483 | 3300047319 | Ga0495674_0010957 | Ga0495674_0010957_3195_4172 | 315 |
| 484 | 3300047319 | Ga0495674_0101947 | Ga0495674_0101947_241_1188 | 315 |
| 485 | 3300047319 | Ga0495674_0129131 | Ga0495674_0129131_789_1742 | 315 |
| 486 | 3300047320 | Ga0495672_0011803 | Ga0495672_0011803_3112_4065 | 315 |
| 487 | 3300047320 | Ga0495672_0020534 | Ga0495672_0020534_2632_3585 | 315 |
| 488 | 3300047321 | Ga0495676_0053471 | Ga0495676_0053471_730_1683 | 315 |
| 489 | 3300047321 | Ga0495676_0060540 | Ga0495676_0060540_1843_2796 | 315 |
| 490 | 3300047321 | Ga0495676_0120858 | Ga0495676_0120858_903_1856 | 315 |
| 491 | 3300047322 | Ga0495680_0001397 | Ga0495680_0001397_18431_19384 | 315 |
| 492 | 3300047322 | Ga0495680_0063266 | Ga0495680_0063266_248_1195 | 315 |
| 493 | 3300047444 | Ga0495675_0024187 | Ga0495675_0024187_1146_2099 | 315 |
| 494 | 3300047471 | Ga0495684_0002444 | Ga0495684_0002444_12593_13546 | 315 |
| 495 | 3300047471 | Ga0495684_0007684 | Ga0495684_0007684_526_1503 | 315 |
| 496 | 3300047471 | Ga0495684_0312286 | Ga0495684_0312286_128_1090 | 315 |
| 497 | 3300047472 | Ga0495686_0107252 | Ga0495686_0107252_560_1513 | 315 |
| 498 | 3300047673 | Ga0495593_0001188 | Ga0495593_0001188_10141_11094 | 315 |
| 499 | 3300047673 | Ga0495593_0020272 | Ga0495593_0020272_271_1221 | 315 |
| 500 | 3300048903 | Ga0496100_0048809 | Ga0496100_0048809_1655_2608 | 315 |
| 501 | 3300048903 | Ga0496100_0058290 | Ga0496100_0058290_762_1727 | 315 |
| 502 | 3300048903 | Ga0496100_0106310 | Ga0496100_0106310_496_1443 | 315 |
| 503 | 3300048903 | Ga0496100_0163814 | Ga0496100_0163814_458_1411 | 315 |
| 504 | 3300048904 | Ga0496101_0027115 | Ga0496101_0027115_1114_2067 | 315 |
| 505 | 3300048904 | Ga0496101_0100053 | Ga0496101_0100053_925_1872 | 315 |
| 506 | 3300048905 | Ga0496102_0027842 | Ga0496102_0027842_3625_4590 | 315 |
| 507 | 3300048905 | Ga0496102_0035969 | Ga0496102_0035969_3052_3999 | 315 |
| 508 | 3300048905 | Ga0496102_0086418 | Ga0496102_0086418_715_1668 | 315 |
| 509 | 3300048905 | Ga0496102_0119733 | Ga0496102_0119733_89_1042 | 315 |
| 510 | 3300048906 | Ga0496103_0019153 | Ga0496103_0019153_2165_3118 | 315 |
| 511 | 3300048906 | Ga0496103_0058793 | Ga0496103_0058793_1131_2078 | 315 |
| 512 | 3300048906 | Ga0496103_0160063 | Ga0496103_0160063_263_1216 | 315 |
| 513 | 3300048907 | Ga0496104_0045388 | Ga0496104_0045388_2425_3372 | 315 |
| 514 | 3300048907 | Ga0496104_0050441 | Ga0496104_0050441_2292_3257 | 315 |
| 515 | 3300048907 | Ga0496104_0064124 | Ga0496104_0064124_2467_3420 | 315 |
| 516 | 3300048908 | Ga0496105_0017121 | Ga0496105_0017121_3308_4261 | 315 |
| 517 | 3300048908 | Ga0496105_0028187 | Ga0496105_0028187_2926_3891 | 315 |
| 518 | 3300048908 | Ga0496105_0034952 | Ga0496105_0034952_436_1383 | 315 |
| 519 | 3300048908 | Ga0496105_0080592 | Ga0496105_0080592_258_1211 | 315 |
| 520 | 3300048908 | Ga0496105_0286876 | Ga0496105_0286876_112_1065 | 315 |
| 521 | 3300048909 | Ga0496106_0001842 | Ga0496106_0001842_14454_15401 | 315 |
| 522 | 3300048909 | Ga0496106_0052267 | Ga0496106_0052267_381_1334 | 315 |
| 523 | 3300048909 | Ga0496106_0079966 | Ga0496106_0079966_799_1752 | 315 |
| 524 | 3300048909 | Ga0496106_0119444 | Ga0496106_0119444_709_1662 | 315 |
| 525 | 3300048909 | Ga0496106_0176230 | Ga0496106_0176230_350_1303 | 315 |
| 526 | 3300048909 | Ga0496106_0277667 | Ga0496106_0277667_243_1190 | 315 |
| 527 | 3300048910 | Ga0496107_0095456 | Ga0496107_0095456_754_1701 | 315 |
| 528 | 3300048910 | Ga0496107_0102046 | Ga0496107_0102046_1047_2000 | 315 |
| 529 | 3300048910 | Ga0496107_0180146 | Ga0496107_0180146_188_1141 | 315 |
| 530 | 3300048911 | Ga0496108_0127535 | Ga0496108_0127535_1073_2026 | 315 |
| 531 | 3300048911 | Ga0496108_0275684 | Ga0496108_0275684_126_1073 | 315 |
| 532 | 3300048912 | Ga0496109_0139905 | Ga0496109_0139905_445_1398 | 315 |
| 533 | 3300048912 | Ga0496109_0159672 | Ga0496109_0159672_635_1588 | 315 |
| 534 | 3300048913 | Ga0496110_0131480 | Ga0496110_0131480_631_1578 | 315 |
| 535 | 3300048914 | Ga0496111_0030324 | Ga0496111_0030324_479_1426 | 315 |
| 536 | 3300048914 | Ga0496111_0058811 | Ga0496111_0058811_1073_2020 | 315 |
| 537 | 3300048914 | Ga0496111_0075701 | Ga0496111_0075701_151_1104 | 315 |
| 538 | 3300048915 | Ga0496112_0000047 | Ga0496112_0000047_69727_70674 | 315 |
| 539 | 3300048915 | Ga0496112_0014885 | Ga0496112_0014885_2179_3126 | 315 |
| 540 | 3300048915 | Ga0496112_0068053 | Ga0496112_0068053_2319_3284 | 315 |
| 541 | 3300048915 | Ga0496112_0079670 | Ga0496112_0079670_129_1082 | 315 |
| 542 | 3300048915 | Ga0496112_0292657 | Ga0496112_0292657_225_1178 | 315 |
| 543 | 3300048916 | Ga0496113_0018677 | Ga0496113_0018677_504_1451 | 315 |
| 544 | 3300048916 | Ga0496113_0108831 | Ga0496113_0108831_732_1685 | 315 |
| 545 | 3300048916 | Ga0496113_0208208 | Ga0496113_0208208_596_1543 | 315 |
| 546 | 3300048917 | Ga0496114_0180581 | Ga0496114_0180581_37_990 | 315 |
| 547 | 3300048917 | Ga0496114_0210506 | Ga0496114_0210506_212_1165 | 315 |
| 548 | 3300048917 | Ga0496114_0223916 | Ga0496114_0223916_461_1408 | 315 |
| 549 | 3300048917 | Ga0496114_0286466 | Ga0496114_0286466_56_1021 | 315 |
| 550 | 3300048918 | Ga0496115_0033405 | Ga0496115_0033405_610_1557 | 315 |
| 551 | 3300048918 | Ga0496115_0040832 | Ga0496115_0040832_2130_3083 | 315 |
| 552 | 3300048918 | Ga0496115_0260389 | Ga0496115_0260389_98_1051 | 315 |
| 553 | 3300048918 | Ga0496115_0329044 | Ga0496115_0329044_160_1113 | 315 |
| 554 | 3300048920 | Ga0496117_0078872 | Ga0496117_0078872_201_1148 | 315 |
| 555 | 3300048920 | Ga0496117_0153717 | Ga0496117_0153717_12_959 | 315 |
| 556 | 3300048921 | Ga0496118_0005620 | Ga0496118_0005620_9628_10575 | 315 |
| 557 | 3300048921 | Ga0496118_0051579 | Ga0496118_0051579_901_1851 | 315 |
| 558 | 3300048922 | Ga0496119_0025754 | Ga0496119_0025754_563_1516 | 315 |
| 559 | 3300048924 | Ga0496121_0003623 | Ga0496121_0003623_7955_8902 | 315 |
| 560 | 3300048924 | Ga0496121_0005449 | Ga0496121_0005449_11108_12061 | 315 |
| 561 | 3300048924 | Ga0496121_0031652 | Ga0496121_0031652_3846_4799 | 315 |
| 562 | 3300048924 | Ga0496121_0057251 | Ga0496121_0057251_508_1467 | 315 |
| 563 | 3300048924 | Ga0496121_0059059 | Ga0496121_0059059_619_1593 | 315 |
| 564 | 3300048924 | Ga0496121_0102926 | Ga0496121_0102926_1119_2078 | 315 |
| 565 | 3300048924 | Ga0496121_0135760 | Ga0496121_0135760_290_1243 | 315 |
| 566 | 3300048924 | Ga0496121_0263902 | Ga0496121_0263902_45_998 | 315 |
| 567 | 3300048925 | Ga0496122_0056740 | Ga0496122_0056740_1216_2199 | 315 |
| 568 | 3300048927 | Ga0496124_0002607 | Ga0496124_0002607_9619_10566 | 315 |
| 569 | 3300048928 | Ga0496125_0057339 | Ga0496125_0057339_1956_2903 | 315 |
| 570 | 3300048928 | Ga0496125_0066138 | Ga0496125_0066138_450_1400 | 315 |
| 571 | 3300048929 | Ga0496126_0017110 | Ga0496126_0017110_798_1754 | 315 |
| 572 | 3300048929 | Ga0496126_0028939 | Ga0496126_0028939_718_1707 | 315 |
| 573 | 3300048929 | Ga0496126_0032878 | Ga0496126_0032878_1707_2690 | 315 |
| 574 | 3300048929 | Ga0496126_0040542 | Ga0496126_0040542_2926_3879 | 315 |
| 575 | 3300048929 | Ga0496126_0059411 | Ga0496126_0059411_1552_2499 | 315 |
| 576 | 3300048929 | Ga0496126_0068555 | Ga0496126_0068555_1162_2136 | 315 |
| 577 | 3300048929 | Ga0496126_0081188 | Ga0496126_0081188_638_1585 | 315 |
| 578 | 3300048929 | Ga0496126_0101814 | Ga0496126_0101814_409_1356 | 315 |
| 579 | 3300049583 | Ga0501067_0171627 | Ga0501067_0171627_55_1014 | 315 |
| 580 | 3300049586 | Ga0501070_0011623 | Ga0501070_0011623_5565_6518 | 315 |
| 581 | 3300049590 | Ga0501074_0019024 | Ga0501074_0019024_740_1693 | 315 |
| 582 | 3300049742 | Ga0501080_0228437 | Ga0501080_0228437_207_1160 | 315 |
| 583 | 3300049822 | Ga0501035_0313297 | Ga0501035_0313297_24_977 | 315 |
| 584 | 3300049822 | Ga0501035_0409614 | Ga0501035_0409614_109_1062 | 315 |
| 585 | 3300049823 | Ga0501044_0042664 | Ga0501044_0042664_3099_4052 | 315 |
| 586 | 3300050489 | nmdc:mga03683_18241_c1 | nmdc:mga03683_18241_c1_894_1853 | 315 |
| 587 | 3300050490 | nmdc:mga03n38_7516_c1 | nmdc:mga03n38_7516_c1_460_1413 | 315 |
| 588 | 3300050492 | nmdc:mga0yw44_204153_c1 | nmdc:mga0yw44_204153_c1_314_1267 | 315 |
| 589 | 3300050492 | nmdc:mga0yw44_91516_c1 | nmdc:mga0yw44_91516_c1_472_1425 | 315 |
| 590 | 3300050494 | nmdc:mga06z11_28368_c1 | nmdc:mga06z11_28368_c1_399_1352 | 315 |
| 591 | 3300050494 | nmdc:mga06z11_94423_c1 | nmdc:mga06z11_94423_c1_201_1154 | 315 |
| 592 | 3300050495 | nmdc:mga04h51_8678_c1 | nmdc:mga04h51_8678_c1_1405_2358 | 315 |
| 593 | 3300050496 | nmdc:mga07m45_114939_c1 | nmdc:mga07m45_114939_c1_373_1326 | 315 |
| 594 | 3300050496 | nmdc:mga07m45_9011_c1 | nmdc:mga07m45_9011_c1_3865_4818 | 315 |
| 595 | 3300050507 | nmdc:mga05p37_20372_c1 | nmdc:mga05p37_20372_c1_5418_6377 | 315 |
| 596 | 3300050511 | nmdc:mga08y16_58363_c1 | nmdc:mga08y16_58363_c1_1141_2094 | 315 |
| 597 | 3300053077 | Ga0495601_0033375 | Ga0495601_0033375_1223_2176 | 315 |
| 598 | 3300053080 | Ga0500635_0017578 | Ga0500635_0017578_595_1542 | 315 |
| 599 | 3300053084 | Ga0495595_0007763 | Ga0495595_0007763_1326_2279 | 315 |
| 600 | 3300053085 | Ga0495619_0002735 | Ga0495619_0002735_6741_7694 | 315 |
| 601 | 3300053085 | Ga0495619_0054013 | Ga0495619_0054013_911_1864 | 315 |
| 602 | 3300053085 | Ga0495619_0080463 | Ga0495619_0080463_269_1216 | 315 |
| 603 | 3300053085 | Ga0495619_0192100 | Ga0495619_0192100_252_1205 | 315 |
| 604 | 3300053086 | Ga0500578_0167698 | Ga0500578_0167698_303_1256 | 315 |
| 605 | 3300053090 | Ga0500646_0035743 | Ga0500646_0035743_353_1306 | 315 |
| 606 | 3300053091 | Ga0500647_0028787 | Ga0500647_0028787_1204_2151 | 315 |
| 607 | 3300053093 | Ga0500651_0030743 | Ga0500651_0030743_107_1060 | 315 |
| 608 | 3300053094 | Ga0500566_0008936 | Ga0500566_0008936_3756_4703 | 315 |
| 609 | 3300053094 | Ga0500566_0035996 | Ga0500566_0035996_1135_2088 | 315 |
| 610 | 3300053095 | Ga0500640_003126 | Ga0500640_003126_336_1283 | 315 |
| 611 | 3300053102 | Ga0500554_000823 | Ga0500554_000823_864_1817 | 315 |
| 612 | 3300053111 | Ga0500572_001020 | Ga0500572_001020_257_1216 | 315 |
| 613 | 3300053111 | Ga0500572_001886 | Ga0500572_001886_3313_4260 | 315 |
| 614 | 3300053119 | Ga0500595_004790 | Ga0500595_004790_1286_2239 | 315 |
| 615 | 3300053119 | Ga0500595_007854 | Ga0500595_007854_667_1620 | 315 |
| 616 | 3300053119 | Ga0500595_010801 | Ga0500595_010801_1032_1985 | 315 |
| 617 | 3300053119 | Ga0500595_019428 | Ga0500595_019428_1164_2111 | 315 |
| 618 | 3300053119 | Ga0500595_023978 | Ga0500595_023978_790_1743 | 315 |
| 619 | 3300053122 | Ga0500608_050701 | Ga0500608_050701_974_1921 | 315 |
| 620 | 3300053123 | Ga0500614_001759 | Ga0500614_001759_3061_4008 | 315 |
| 621 | 3300053133 | Ga0500655_007495 | Ga0500655_007495_46_999 | 315 |
| 622 | 3300053136 | Ga0500559_0001286 | Ga0500559_0001286_7491_8450 | 315 |
| 623 | 3300053136 | Ga0500559_0009338 | Ga0500559_0009338_391_1338 | 315 |
| 624 | 3300053139 | Ga0500568_0014097 | Ga0500568_0014097_179_1132 | 315 |
| 625 | 3300053139 | Ga0500568_0014193 | Ga0500568_0014193_690_1643 | 315 |
| 626 | 3300053148 | Ga0500590_046862 | Ga0500590_046862_885_1877 | 315 |
| 627 | 3300053150 | Ga0500603_001833 | Ga0500603_001833_1165_2112 | 315 |
| 628 | 3300053150 | Ga0500603_001990 | Ga0500603_001990_3332_4285 | 315 |
| 629 | 3300053159 | Ga0500630_007371 | Ga0500630_007371_1221_2168 | 315 |
| 630 | 3300053162 | Ga0500638_003913 | Ga0500638_003913_596_1549 | 315 |
| 631 | 3300053163 | Ga0500639_000165 | Ga0500639_000165_1221_2168 | 315 |
| 632 | 3300053163 | Ga0500639_091609 | Ga0500639_091609_242_1189 | 315 |
| 633 | 3300053177 | Ga0500636_0056309 | Ga0500636_0056309_261_1241 | 315 |
| 634 | 3300053725 | Ga0500576_024162 | Ga0500576_024162_1636_2595 | 315 |
| 635 | 3300053730 | Ga0500645_015347 | Ga0500645_015347_1280_2233 | 315 |
| 636 | 3300053733 | Ga0500552_004656 | Ga0500552_004656_406_1353 | 315 |
| 637 | 3300053735 | Ga0500596_001068 | Ga0500596_001068_3539_4486 | 315 |
| 638 | 3300055283 | Ga0500661_000594 | Ga0500661_000594_4222_5175 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ruz-assembly1.cif.gz_B | nadh-dependent coenzyme a disulfide reductase | 0.9667 | 148 | 176 |
| 1nhs-assembly1.cif.gz_A | an l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide | 0.9617 | 148 | 177 |
| 1nhr-assembly1.cif.gz_A | an l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide | 0.9612 | 148 | 177 |
| 1nhq-assembly1.cif.gz_A | crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303 | 0.9605 | 148 | 177 |
| 1nhp-assembly1.cif.gz_A | crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303 | 0.9594 | 148 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7XRA3_150_294_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9653 | 143 | 286 | 3.40.50.720 |
| af_A0A0R0KIU5_101_193_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9616 | 195 | 286 | 3.40.50.720 |
| af_Q2FVW4_141_284_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9604 | 143 | 282 | 3.40.50.720 |
| af_Q7SZY8_153_293_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9604 | 147 | 282 | 3.40.50.720 |
| 2bc1B02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9601 | 148 | 177 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A418V4G4-F1-model_v4 | 2-hydroxyacid dehydrogenase | 0.981 | 1 | 315 |
GO:0005829
GO:0016618 GO:0030267 GO:0051287 |
| AF-A0A4Q3GWW0-F1-model_v4 | deleted | 0.9724 | 76 | 315 |
|
| AF-A0A810A6F7-F1-model_v4 | D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein | 0.9712 | 109 | 315 |
GO:0005829
GO:0016618 GO:0030267 GO:0051287 |
| AF-A0A1H4RLV0-F1-model_v4 | Lactate dehydrogenase | 0.9699 | 1 | 295 |
GO:0005829
GO:0016618 GO:0030267 GO:0051287 |
| AF-A0A256G667-F1-model_v4 | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain protein | 0.9674 | 44 | 315 |
GO:0005829
GO:0016618 GO:0030267 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar