F471513

General Info

Members Datasets Scaffolds Average Seq Length
638 359 595 316

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10065271|Ga0157380_100652713
Length 340
Sequence LRLTALLRNRRPAGLGKKEKRKTMPEKVLIYSRFPKAQMERFGERFELLNAAGKAPNEVFSADQLADIRAMITAGGTPLGGAAMDLMPKLAAIVCYGTGYDGVDLAAAAKRKIAVGHSPGANAASVADIAVTLMLATTRRLLVADDYVRGGSWAAAKPSPMMRPQAGMLGRKIGVYGMGEIGRKIAARVAAFETEVGYFSRSQHDVPYRYFPTLDALAEWCSVLMIAVRAGTDTEHAVDAGILRKLGKDGYVVNISRGSVIDQKALIAALTEQTIAGAGLDVYEKEPHAPDALTALPNVVLSPHIGGHTLESHVAMQDCVISNLEAYFAGKPLPYAVPLG

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2643221651 Afipia sp. Root123D2 Isolate Unclassified
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
11 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
12 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
13 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
14 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
15 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
16 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
17 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
18 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
19 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
20 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
21 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
22 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
23 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
24 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
25 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
26 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
27 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
28 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
29 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
30 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
31 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
32 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
33 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
34 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
187 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
317 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
323 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
326 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
327 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
328 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
329 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
330 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
331 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
332 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
333 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
334 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
335 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
336 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
337 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
338 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
339 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
340 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
341 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
342 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
343 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
344 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
345 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
346 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
347 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
350 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
351 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
352 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
353 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
354 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
355 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
356 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
357 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
358 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
359 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.55
Metatranscriptomes 0
Isolates 6.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.66
Nodule 4.7
Rhizoplane 10.03
Rhizosphere 66.61
Stem 0
Stem Tuber 0
Unclassified 7.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000162 3300003203 Bacteria 29622
2 JGI25406J46586_10015420 3300003203 Bacteria 3223
3 JGI25406J46586_10021918 3300003203 Bacteria 2556
4 JGI25404J52841_10014050 3300003659 Bacteria 1737
5 JGI25404J52841_10020571 3300003659 Bacteria 1429
6 Ga0070658_10065497 3300005327 Bacteria 2965
7 Ga0070658_10091539 3300005327 Bacteria 2506
8 Ga0070683_100126479 3300005329 Bacteria 2416
9 Ga0070683_100309420 3300005329 Bacteria 1503
10 Ga0070690_100067481 3300005330 Bacteria 2318
11 Ga0068869_100075256 3300005334 Bacteria 2508
12 Ga0070666_10194612 3300005335 Bacteria 1426
13 Ga0070680_100156871 3300005336 Bacteria 1912
14 Ga0070682_100097892 3300005337 Bacteria 1931
15 Ga0068868_100107560 3300005338 Bacteria 2263
16 Ga0070691_10101928 3300005341 Bacteria 1427
17 Ga0070669_100048296 3300005353 Bacteria 3106
18 Ga0070675_100292447 3300005354 Bacteria 1434
19 Ga0070671_100065717 3300005355 Bacteria 3022
20 Ga0070674_100157936 3300005356 Bacteria 1718
21 Ga0070674_100159235 3300005356 Bacteria 1711
22 Ga0070709_10007290 3300005434 Bacteria 6060
23 Ga0070709_10029833 3300005434 Bacteria 3266
24 Ga0070709_10179164 3300005434 Bacteria 1487
25 Ga0070714_100012235 3300005435 Bacteria 6844
26 Ga0070713_100019531 3300005436 Bacteria 5177
27 Ga0070713_100198414 3300005436 Bacteria 1811
28 Ga0070710_10009691 3300005437 Bacteria 4719
29 Ga0070711_100112504 3300005439 Bacteria 2000
30 Ga0070663_100027389 3300005455 Bacteria 3870
31 Ga0070663_100143290 3300005455 Bacteria 1826
32 Ga0070663_100234649 3300005455 Bacteria 1446
33 Ga0070678_100025743 3300005456 Bacteria 3965
34 Ga0070678_100226327 3300005456 Bacteria 1557
35 Ga0070681_10089919 3300005458 Bacteria 3021
36 Ga0070681_10200365 3300005458 Bacteria 1915
37 Ga0070681_10230082 3300005458 Bacteria 1768
38 Ga0070681_10285790 3300005458 Bacteria 1560
39 Ga0070707_100545481 3300005468 Bacteria 1122
40 Ga0070679_100092381 3300005530 Bacteria 3014
41 Ga0070679_100118983 3300005530 Bacteria 2626
42 Ga0070679_100152926 3300005530 Bacteria 2283
43 Ga0070679_100200429 3300005530 Bacteria 1962
44 Ga0070684_100034836 3300005535 Bacteria 4306
45 Ga0070684_100368277 3300005535 Bacteria 1323
46 Ga0070684_100376382 3300005535 Bacteria 1307
47 Ga0068853_100077509 3300005539 Bacteria 2903
48 Ga0068853_100107104 3300005539 Bacteria 2478
49 Ga0068853_100118787 3300005539 Bacteria 2356
50 Ga0070693_100089834 3300005547 Bacteria 1850
51 Ga0070665_100042707 3300005548 Bacteria 4557
52 Ga0070665_100074604 3300005548 Bacteria 3398
53 Ga0070665_100262983 3300005548 Bacteria 1726
54 Ga0070665_100361553 3300005548 Bacteria 1458
55 Ga0068855_100021801 3300005563 Bacteria 7684
56 Ga0068855_100154929 3300005563 Bacteria 2603
57 Ga0068855_100158887 3300005563 Bacteria 2567
58 Ga0068855_100197906 3300005563 Bacteria 2263
59 Ga0070664_100025149 3300005564 Bacteria 4933
60 Ga0068852_100106616 3300005616 Bacteria 2540
61 Ga0068852_100273986 3300005616 Bacteria 1625
62 Ga0068859_100172173 3300005617 Bacteria 2246
63 Ga0068864_100030397 3300005618 Bacteria 4577
64 Ga0068864_100053526 3300005618 Bacteria 3482
65 Ga0068861_100049133 3300005719 Bacteria 3192
66 Ga0068861_100231402 3300005719 Bacteria 1568
67 Ga0068861_100456198 3300005719 Bacteria 1146
68 Ga0068860_100043210 3300005843 Bacteria 4300
69 Ga0068860_100341016 3300005843 Bacteria 1473
70 Ga0068862_100164844 3300005844 Bacteria 1980
71 Ga0068862_100415962 3300005844 Bacteria 1260
72 Ga0081455_10006819 3300005937 Bacteria 12177
73 Ga0081455_10147325 3300005937 Bacteria 1819
74 Ga0081455_10160456 3300005937 Bacteria 1724
75 Ga0081538_10129470 3300005981 Bacteria 1190
76 Ga0081540_1003121 3300005983 Bacteria 13266
77 Ga0081540_1005500 3300005983 Bacteria 9448
78 Ga0081540_1009972 3300005983 Bacteria 6476
79 Ga0081540_1010599 3300005983 Bacteria 6225
80 Ga0081540_1015311 3300005983 Bacteria 4860
81 Ga0081540_1016750 3300005983 Bacteria 4570
82 Ga0081540_1020563 3300005983 Bacteria 3964
83 Ga0081540_1023691 3300005983 Bacteria 3583
84 Ga0081540_1033249 3300005983 Bacteria 2803
85 Ga0081540_1046015 3300005983 Bacteria 2208
86 Ga0081539_10000203 3300005985 Bacteria 138096
87 Ga0081539_10001007 3300005985 Bacteria 52055
88 Ga0081539_10046196 3300005985 Bacteria 2498
89 Ga0081539_10053621 3300005985 Bacteria 2257
90 Ga0070717_10008113 3300006028 Bacteria 7834
91 Ga0070717_10012395 3300006028 Bacteria 6500
92 Ga0070717_10012865 3300006028 Bacteria 6390
93 Ga0075365_10055751 3300006038 Bacteria 2625
94 Ga0075365_10121570 3300006038 Bacteria 1801
95 Ga0075368_10014800 3300006042 Bacteria 2885
96 Ga0075363_100021152 3300006048 Bacteria 3272
97 Ga0075363_100044685 3300006048 Bacteria 2347
98 Ga0075364_10133930 3300006051 Bacteria 1664
99 Ga0070715_10006032 3300006163 Bacteria 4088
100 Ga0070716_100021193 3300006173 Bacteria 3421
101 Ga0075362_10021046 3300006177 Bacteria 2732
102 Ga0075362_10054390 3300006177 Bacteria 1799
103 Ga0075367_10018795 3300006178 Bacteria 3819
104 Ga0075367_10050292 3300006178 Bacteria 2460
105 Ga0075369_10029140 3300006186 Bacteria 2317
106 Ga0075366_10109249 3300006195 Bacteria 1663
107 Ga0097621_100096028 3300006237 Bacteria 2487
108 Ga0075370_10049986 3300006353 Bacteria 2371
109 Ga0068871_100164814 3300006358 Bacteria 1897
110 Ga0075428_100185910 3300006844 Bacteria 2248
111 Ga0075428_100221966 3300006844 Bacteria 2040
112 Ga0068865_100057305 3300006881 Bacteria 2717
113 Ga0097620_100172175 3300006931 Bacteria 2246
114 Ga0075435_100243703 3300007076 Bacteria 1529
115 Ga0099795_10040124 3300007788 Bacteria 1661
116 Ga0105250_10054430 3300009092 Bacteria 1605
117 Ga0105240_10052144 3300009093 Bacteria 5143
118 Ga0105240_10099593 3300009093 Bacteria 3538
119 Ga0105240_10278559 3300009093 Bacteria 1922
120 Ga0111539_10061288 3300009094 Bacteria 4457
121 Ga0105245_10060845 3300009098 Bacteria 3402
122 Ga0105245_10197363 3300009098 Bacteria 1931
123 Ga0105245_10280527 3300009098 Bacteria 1628
124 Ga0114129_10037091 3300009147 Bacteria 6882
125 Ga0105243_10172665 3300009148 Bacteria 1874
126 Ga0105248_10106832 3300009177 Bacteria 3156
127 Ga0105248_10176498 3300009177 Bacteria 2407
128 Ga0105248_10515306 3300009177 Bacteria 1348
129 Ga0105237_10437781 3300009545 Bacteria 1313
130 Ga0105238_10375964 3300009551 Bacteria 1412
131 Ga0105249_10052110 3300009553 Bacteria 3736
132 Ga0099796_10025047 3300010159 Bacteria 1879
133 Ga0099796_10068747 3300010159 Bacteria 1273
134 Ga0105239_10050960 3300010375 Bacteria 4539
135 Ga0105239_10059034 3300010375 Bacteria 4210
136 Ga0105239_10222468 3300010375 Bacteria 2117
137 Ga0105246_10189702 3300011119 Bacteria 1590
138 Ga0105246_10247825 3300011119 Bacteria 1412
139 Ga0105246_10270250 3300011119 Bacteria 1359
140 Ga0157370_10137087 3300013104 Bacteria 2280
141 Ga0157369_10057918 3300013105 Bacteria 4179
142 Ga0157369_10094109 3300013105 Bacteria 3199
143 Ga0157369_10264495 3300013105 Bacteria 1793
144 Ga0157369_10274159 3300013105 Bacteria 1758
145 Ga0157378_10099691 3300013297 Bacteria 2651
146 Ga0157372_10104969 3300013307 Bacteria 3231
147 Ga0157372_10373339 3300013307 Bacteria 1662
148 Ga0157375_10132405 3300013308 Bacteria 2614
149 Ga0157375_10264605 3300013308 Bacteria 1881
150 Ga0163163_10009181 3300014325 Bacteria 8813
151 Ga0163163_10058180 3300014325 Bacteria 3822
152 Ga0163163_10073703 3300014325 Bacteria 3405
153 Ga0157380_10065271 3300014326 Bacteria 2925
154 Ga0157380_10266019 3300014326 Bacteria 1560
155 Ga0157377_10089370 3300014745 Bacteria 1816
156 Ga0157377_10110907 3300014745 Bacteria 1649
157 Ga0157379_10236417 3300014968 Bacteria 1657
158 Ga0157376_10046571 3300014969 Bacteria 3576
159 Ga0157376_10198960 3300014969 Bacteria 1842
160 Ga0163161_10095664 3300017792 Bacteria 2203
161 Ga0209677_100683 3300025253 Bacteria 17403
162 Ga0209455_1003978 3300025272 Bacteria 5011
163 Ga0209758_1008841 3300025297 Bacteria 6410
164 Ga0209758_1015355 3300025297 Bacteria 3974
165 Ga0209758_1057789 3300025297 Bacteria 1301
166 Ga0207697_10043972 3300025315 Bacteria 1837
167 Ga0207692_10033228 3300025898 Bacteria 2486
168 Ga0207642_10058186 3300025899 Bacteria 1782
169 Ga0207688_10089576 3300025901 Bacteria 1765
170 Ga0207685_10001288 3300025905 Bacteria 5140
171 Ga0207699_10055499 3300025906 Bacteria 2357
172 Ga0207699_10061001 3300025906 Bacteria 2267
173 Ga0207699_10107971 3300025906 Bacteria 1779
174 Ga0207707_10001527 3300025912 Bacteria 21365
175 Ga0207707_10071173 3300025912 Bacteria 3030
176 Ga0207707_10075388 3300025912 Bacteria 2943
177 Ga0207707_10147320 3300025912 Bacteria 2058
178 Ga0207707_10187513 3300025912 Bacteria 1805
179 Ga0207695_10070439 3300025913 Bacteria 3575
180 Ga0207695_10146792 3300025913 Bacteria 2302
181 Ga0207695_10226295 3300025913 Bacteria 1776
182 Ga0207695_10269330 3300025913 Bacteria 1599
183 Ga0207671_10102562 3300025914 Bacteria 2168
184 Ga0207693_10001370 3300025915 Bacteria 21582
185 Ga0207663_10000401 3300025916 Bacteria 18748
186 Ga0207660_10002267 3300025917 Bacteria 12676
187 Ga0207660_10141596 3300025917 Bacteria 1839
188 Ga0207662_10048762 3300025918 Bacteria 2510
189 Ga0207657_10051473 3300025919 Bacteria 3580
190 Ga0207649_10221806 3300025920 Bacteria 1347
191 Ga0207652_10011331 3300025921 Bacteria 7184
192 Ga0207652_10047386 3300025921 Bacteria 3671
193 Ga0207652_10088570 3300025921 Bacteria 2716
194 Ga0207652_10118505 3300025921 Bacteria 2353
195 Ga0207687_10040402 3300025927 Bacteria 3197
196 Ga0207687_10204075 3300025927 Bacteria 1547
197 Ga0207700_10063688 3300025928 Bacteria 2806
198 Ga0207664_10006050 3300025929 Bacteria 8287
199 Ga0207706_10089367 3300025933 Bacteria 2708
200 Ga0207669_10016122 3300025937 Bacteria 3788
201 Ga0207669_10304740 3300025937 Bacteria 1212
202 Ga0207704_10310009 3300025938 Bacteria 1213
203 Ga0207665_10006374 3300025939 Bacteria 7828
204 Ga0207665_10263242 3300025939 Bacteria 1278
205 Ga0207691_10338864 3300025940 Bacteria 1287
206 Ga0207711_10089662 3300025941 Bacteria 2702
207 Ga0207711_10204848 3300025941 Bacteria 1801
208 Ga0207689_10080649 3300025942 Bacteria 2675
209 Ga0207661_10338476 3300025944 Bacteria 1355
210 Ga0207661_10465695 3300025944 Bacteria 1152
211 Ga0207679_10063875 3300025945 Bacteria 2750
212 Ga0207667_10043345 3300025949 Bacteria 4775
213 Ga0207667_10061169 3300025949 Bacteria 3940
214 Ga0207712_10041957 3300025961 Bacteria 3148
215 Ga0207668_10156423 3300025972 Bacteria 1771
216 Ga0207668_10244199 3300025972 Bacteria 1454
217 Ga0207640_10134410 3300025981 Bacteria 1793
218 Ga0207677_10136070 3300026023 Bacteria 1873
219 Ga0207677_10228838 3300026023 Bacteria 1496
220 Ga0207703_10055174 3300026035 Bacteria 3232
221 Ga0207703_10266439 3300026035 Bacteria 1550
222 Ga0207639_10028993 3300026041 Bacteria 4047
223 Ga0207639_10205704 3300026041 Bacteria 1691
224 Ga0207678_10046004 3300026067 Bacteria 3774
225 Ga0207678_10084410 3300026067 Bacteria 2716
226 Ga0207678_10091509 3300026067 Bacteria 2600
227 Ga0207678_10214023 3300026067 Bacteria 1649
228 Ga0207678_10306295 3300026067 Bacteria 1366
229 Ga0207708_10046583 3300026075 Bacteria 3301
230 Ga0207702_10001820 3300026078 Bacteria 20976
231 Ga0207702_10175701 3300026078 Bacteria 1968
232 Ga0207648_10020807 3300026089 Bacteria 5906
233 Ga0207648_10177246 3300026089 Bacteria 1885
234 Ga0207674_10156719 3300026116 Bacteria 2232
235 Ga0207674_10205094 3300026116 Bacteria 1921
236 Ga0207675_100137707 3300026118 Bacteria 2317
237 Ga0207675_100198773 3300026118 Bacteria 1925
238 Ga0207675_100343844 3300026118 Bacteria 1461
239 Ga0207683_10037998 3300026121 Bacteria 4193
240 Ga0207683_10123146 3300026121 Bacteria 2329
241 Ga0207683_10158095 3300026121 Bacteria 2048
242 Ga0207683_10160111 3300026121 Bacteria 2034
243 Ga0207698_10094108 3300026142 Bacteria 2462
244 Ga0209179_1016377 3300027512 Bacteria 1390
245 Ga0209588_1000803 3300027671 Bacteria 7984
246 Ga0209813_10013671 3300027866 Bacteria 2171
247 Ga0268266_10022495 3300028379 Bacteria 5371
248 Ga0268266_10026512 3300028379 Bacteria 4931
249 Ga0268266_10091925 3300028379 Bacteria 2661
250 Ga0268266_10321445 3300028379 Bacteria 1448
251 Ga0268265_10216042 3300028380 Bacteria 1674
252 Ga0268265_10390300 3300028380 Bacteria 1283
253 Ga0265334_10040001 3300028573 Bacteria 1838
254 Ga0307517_10003022 3300028786 Bacteria 26583
255 Ga0307515_10166131 3300028794 Bacteria 2223
256 Ga0307515_10225939 3300028794 Bacteria 1677
257 Ga0307511_10051446 3300030521 Bacteria 3303
258 Ga0265330_10009881 3300031235 Bacteria 4517
259 Ga0265330_10076819 3300031235 Bacteria 1441
260 Ga0265332_10033579 3300031238 Bacteria 2233
261 Ga0265339_10002960 3300031249 Bacteria 11993
262 Ga0265339_10101012 3300031249 Bacteria 1501
263 Ga0265316_10105608 3300031344 Bacteria 2137
264 Ga0307508_10098531 3300031616 Bacteria 2516
265 Ga0307508_10263179 3300031616 Bacteria 1319
266 Ga0265314_10045096 3300031711 Bacteria 3119
267 Ga0265342_10005223 3300031712 Bacteria 9966
268 Ga0265342_10140817 3300031712 Bacteria 1345
269 Ga0307516_10103001 3300031730 Bacteria 2668
270 Ga0307516_10264224 3300031730 Bacteria 1410
271 Ga0307413_10049870 3300031824 Bacteria 2511
272 Ga0307413_10392337 3300031824 Bacteria 1085
273 Ga0307412_10242028 3300031911 Bacteria 1396
274 Ga0307416_100133505 3300032002 Bacteria 2240
275 Ga0307507_10049223 3300033179 Bacteria 4088
276 Ga0307510_10057427 3300033180 Bacteria 4039
277 Ga0307510_10108238 3300033180 Bacteria 2534
278 Ga0315911_1000009 3300033442 Bacteria 379354
279 Ga0373938_0010029 3300034957 Bacteria 1730
280 Ga0373934_0025016 3300035086 Bacteria 2310
281 Ga0373923_0020712 3300035111 Bacteria 2558
282 Ga0373923_0029918 3300035111 Bacteria 2187
283 Ga0373936_0005185 3300035113 Bacteria 4902
284 Ga0373936_0118676 3300035113 Bacteria 1128
285 Ga0373941_0029263 3300035115 Bacteria 1624
286 Ga0373945_0005479 3300035116 Bacteria 4063
287 Ga0373953_0010430 3300035117 Bacteria 3233
288 Ga0373953_0073519 3300035117 Bacteria 1413
289 Ga0373954_0001806 3300035118 Bacteria 8816
290 Ga0373954_0140410 3300035118 Bacteria 1178
291 Ga0373956_0003991 3300035119 Bacteria 5927
292 Ga0373956_0045318 3300035119 Bacteria 1962
293 Ga0373957_0067147 3300035120 Bacteria 1397
294 Ga0373943_0060393 3300035170 Bacteria 1892
295 Ga0373946_0021271 3300035171 Bacteria 2514
296 Ga0373946_0125125 3300035171 Bacteria 1177
297 Ga0373955_0007659 3300035172 Bacteria 4973
298 Ga0373955_0026294 3300035172 Bacteria 2997
299 Ga0373955_0105902 3300035172 Bacteria 1620
300 Ga0373924_0014546 3300035410 Bacteria 2976
301 Ga0373924_0068467 3300035410 Bacteria 1494
302 Ga0373924_0108849 3300035410 Bacteria 1196
303 Ga0373931_0047397 3300035691 Bacteria 2274
304 Ga0373935_0003476 3300035692 Bacteria 9155
305 Ga0373935_0017063 3300035692 Bacteria 4399
306 Ga0373935_0249424 3300035692 Bacteria 1242
307 Ga0373935_0261432 3300035692 Bacteria 1214
308 Ga0373927_0006488 3300035695 Bacteria 7970
309 Ga0373927_0007145 3300035695 Bacteria 7578
310 Ga0373927_0074030 3300035695 Bacteria 2205
311 Ga0373927_0128742 3300035695 Bacteria 1653
312 Ga0373933_0042788 3300035724 Bacteria 2677
313 Ga0373933_0274242 3300035724 Bacteria 1089
314 Ga0373947_0008928 3300035725 Bacteria 5761
315 Ga0373947_0189845 3300035725 Bacteria 1340
316 Ga0373937_0213177 3300036401 Bacteria 1817
317 Ga0373925_0008986 3300037068 Bacteria 7280
318 Ga0373925_0010512 3300037068 Bacteria 6713
319 Ga0373925_0047030 3300037068 Bacteria 3210
320 Ga0373925_0060012 3300037068 Bacteria 2855
321 Ga0395900_0110000 3300037418 Bacteria 2831
322 Ga0395898_0417438 3300037466 Bacteria 1279
323 Ga0395901_0264613 3300038443 Bacteria 1789
324 Ga0436365_1272752 3300039437 Bacteria 8793
325 Ga0436361_1084832 3300039447 Bacteria 1557
326 Ga0436363_1616347 3300039450 Bacteria 2205
327 Ga0466965_0012547 3300044683 Bacteria 3987
328 Ga0466963_0088940 3300044694 Bacteria 2101
329 Ga0466960_0174356 3300044901 Bacteria 1162
330 Ga0466967_0026543 3300045976 Bacteria 4800
331 Ga0466967_0032174 3300045976 Bacteria 4426
332 Ga0495592_0005851 3300046454 Bacteria 9125
333 Ga0495592_0136885 3300046454 Bacteria 1707
334 Ga0495603_0010687 3300046455 Bacteria 5565
335 Ga0495603_0031247 3300046455 Bacteria 3205
336 Ga0495603_0125433 3300046455 Bacteria 1496
337 Ga0495603_0128705 3300046455 Bacteria 1475
338 Ga0495629_0012454 3300046459 Bacteria 6160
339 Ga0495629_0013580 3300046459 Bacteria 5876
340 Ga0495629_0106255 3300046459 Bacteria 1958
341 Ga0495638_0094796 3300046460 Bacteria 1793
342 Ga0495638_0133683 3300046460 Bacteria 1455
343 Ga0495641_0009295 3300046461 Bacteria 5853
344 Ga0495651_0048795 3300046462 Bacteria 3269
345 Ga0495653_0011476 3300046463 Bacteria 7240
346 Ga0495653_0076013 3300046463 Bacteria 2498
347 Ga0495650_0056849 3300046471 Bacteria 1586
348 Ga0495580_0010932 3300046472 Bacteria 7043
349 Ga0495582_0002795 3300046473 Bacteria 9752
350 Ga0495605_0015828 3300046474 Bacteria 4095
351 Ga0495639_0003127 3300046475 Bacteria 7191
352 Ga0495639_0015064 3300046475 Bacteria 3352
353 Ga0495662_0013605 3300046476 Bacteria 3960
354 Ga0495664_0035286 3300046477 Bacteria 2944
355 Ga0495664_0070424 3300046477 Bacteria 2088
356 Ga0495584_0161645 3300046491 Bacteria 1138
357 Ga0495594_0015807 3300046499 Bacteria 3969
358 Ga0495594_0024096 3300046499 Bacteria 3266
359 Ga0495607_0041541 3300046501 Bacteria 2731
360 Ga0495618_0067269 3300046514 Bacteria 2278
361 Ga0495618_0068094 3300046514 Bacteria 2264
362 Ga0495618_0090693 3300046514 Bacteria 1954
363 Ga0495628_0069068 3300046516 Bacteria 2756
364 Ga0495628_0107201 3300046516 Bacteria 2151
365 Ga0495628_0190745 3300046516 Bacteria 1547
366 Ga0495628_0249760 3300046516 Bacteria 1325
367 Ga0495630_0010940 3300046517 Bacteria 6555
368 Ga0495630_0290472 3300046517 Bacteria 1249
369 Ga0495631_0102790 3300046518 Bacteria 1229
370 Ga0495631_0120927 3300046518 Bacteria 1126
371 Ga0495632_0128279 3300046519 Bacteria 1181
372 Ga0495644_0040062 3300046523 Bacteria 1766
373 Ga0495648_0001345 3300046524 Bacteria 24267
374 Ga0495666_0073992 3300046526 Bacteria 1616
375 Ga0495652_0080949 3300046529 Bacteria 2680
376 Ga0495652_0088365 3300046529 Bacteria 2540
377 Ga0495665_0005849 3300046531 Bacteria 6634
378 Ga0495640_0056506 3300046533 Bacteria 2681
379 Ga0495587_0028352 3300046536 Bacteria 3404
380 Ga0495598_0011004 3300046537 Bacteria 2182
381 Ga0495598_0069884 3300046537 Bacteria 1103
382 Ga0495621_0030482 3300046539 Bacteria 1844
383 Ga0495645_0050179 3300046543 Bacteria 3038
384 Ga0495622_0008327 3300046557 Bacteria 4804
385 Ga0495633_0033297 3300046558 Bacteria 2485
386 Ga0495667_0008834 3300046559 Bacteria 6851
387 Ga0495667_0067119 3300046559 Bacteria 2344
388 Ga0495656_0093408 3300046615 Bacteria 1379
389 Ga0495668_0175286 3300046616 Bacteria 1175
390 Ga0495634_0023772 3300046642 Bacteria 4305
391 Ga0495634_0062859 3300046642 Bacteria 2464
392 Ga0495634_0102617 3300046642 Bacteria 1847
393 Ga0495611_0118588 3300046648 Bacteria 1233
394 Ga0495635_0005869 3300046663 Bacteria 8559
395 Ga0495635_0034211 3300046663 Bacteria 3524
396 Ga0495635_0143387 3300046663 Bacteria 1627
397 Ga0495635_0296474 3300046663 Bacteria 1084
398 Ga0495635_0316838 3300046663 Bacteria 1044
399 Ga0495659_0006196 3300046664 Bacteria 3782
400 Ga0495661_0137871 3300046665 Bacteria 1330
401 Ga0495588_0012755 3300046674 Bacteria 3983
402 Ga0495657_0003795 3300046675 Bacteria 12221
403 Ga0495599_0005622 3300046678 Bacteria 7520
404 Ga0495599_0090190 3300046678 Bacteria 1913
405 Ga0495599_0209899 3300046678 Bacteria 1194
406 Ga0495623_0010492 3300046679 Bacteria 5996
407 Ga0495646_0009632 3300046680 Bacteria 6133
408 Ga0495647_0000756 3300046681 Bacteria 9607
409 Ga0495658_0002311 3300046683 Bacteria 9623
410 Ga0495669_0023135 3300046684 Bacteria 2703
411 Ga0495613_0025231 3300046689 Bacteria 4430
412 Ga0495613_0123960 3300046689 Bacteria 1854
413 Ga0495624_0007368 3300046690 Bacteria 7727
414 Ga0495624_0134605 3300046690 Bacteria 1515
415 Ga0495624_0142868 3300046690 Bacteria 1465
416 Ga0495600_0001231 3300046809 Bacteria 14033
417 Ga0495600_0046855 3300046809 Bacteria 2820
418 Ga0495581_0031589 3300047315 Bacteria 3067
419 Ga0495581_0116427 3300047315 Bacteria 1554
420 Ga0495604_0038886 3300047317 Bacteria 3742
421 Ga0495636_0119382 3300047318 Bacteria 1165
422 Ga0495674_0003417 3300047319 Bacteria 15421
423 Ga0495674_0010957 3300047319 Bacteria 8565
424 Ga0495674_0101947 3300047319 Bacteria 2441
425 Ga0495674_0129131 3300047319 Bacteria 2130
426 Ga0495672_0011803 3300047320 Bacteria 6137
427 Ga0495672_0020534 3300047320 Bacteria 4324
428 Ga0495676_0023928 3300047321 Bacteria 5293
429 Ga0495676_0053471 3300047321 Bacteria 3218
430 Ga0495676_0060540 3300047321 Bacteria 2966
431 Ga0495676_0120858 3300047321 Bacteria 1906
432 Ga0495680_0001397 3300047322 Bacteria 26039
433 Ga0495680_0063266 3300047322 Bacteria 2842
434 Ga0495675_0024187 3300047444 Bacteria 3872
435 Ga0495673_0101294 3300047469 Bacteria 1163
436 Ga0495684_0002444 3300047471 Bacteria 14825
437 Ga0495684_0007684 3300047471 Bacteria 8342
438 Ga0495684_0312286 3300047471 Bacteria 1126
439 Ga0495686_0107252 3300047472 Bacteria 1678
440 Ga0495593_0001090 3300047673 Bacteria 15866
441 Ga0495593_0001188 3300047673 Bacteria 15221
442 Ga0495593_0020272 3300047673 Bacteria 3724
443 Ga0496100_0048809 3300048903 Bacteria 2734
444 Ga0496100_0058290 3300048903 Bacteria 2534
445 Ga0496100_0106310 3300048903 Bacteria 1942
446 Ga0496100_0163814 3300048903 Bacteria 1596
447 Ga0496101_0027115 3300048904 Bacteria 3986
448 Ga0496101_0100053 3300048904 Bacteria 2168
449 Ga0496102_0027842 3300048905 Bacteria 5048
450 Ga0496102_0035969 3300048905 Bacteria 4459
451 Ga0496102_0086418 3300048905 Bacteria 2896
452 Ga0496102_0119733 3300048905 Bacteria 2458
453 Ga0496103_0019153 3300048906 Bacteria 4110
454 Ga0496103_0058793 3300048906 Bacteria 2388
455 Ga0496103_0160063 3300048906 Bacteria 1444
456 Ga0496104_0045388 3300048907 Bacteria 4132
457 Ga0496104_0050441 3300048907 Bacteria 3926
458 Ga0496104_0064124 3300048907 Bacteria 3486
459 Ga0496105_0017121 3300048908 Bacteria 5803
460 Ga0496105_0028187 3300048908 Bacteria 4593
461 Ga0496105_0034952 3300048908 Bacteria 4135
462 Ga0496105_0080592 3300048908 Bacteria 2689
463 Ga0496105_0257260 3300048908 Bacteria 1413
464 Ga0496105_0286876 3300048908 Bacteria 1326
465 Ga0496106_0001842 3300048909 Bacteria 15879
466 Ga0496106_0025125 3300048909 Bacteria 4431
467 Ga0496106_0052267 3300048909 Bacteria 3082
468 Ga0496106_0079966 3300048909 Bacteria 2510
469 Ga0496106_0119444 3300048909 Bacteria 2059
470 Ga0496106_0176230 3300048909 Bacteria 1696
471 Ga0496106_0277667 3300048909 Bacteria 1342
472 Ga0496107_0067888 3300048910 Bacteria 2587
473 Ga0496107_0095456 3300048910 Bacteria 2175
474 Ga0496107_0102046 3300048910 Bacteria 2103
475 Ga0496107_0180146 3300048910 Bacteria 1569
476 Ga0496108_0032348 3300048911 Bacteria 4345
477 Ga0496108_0127535 3300048911 Bacteria 2185
478 Ga0496108_0275684 3300048911 Bacteria 1464
479 Ga0496108_0465769 3300048911 Bacteria 1104
480 Ga0496109_0036727 3300048912 Bacteria 4423
481 Ga0496109_0139905 3300048912 Bacteria 2263
482 Ga0496109_0159672 3300048912 Bacteria 2112
483 Ga0496110_0131480 3300048913 Bacteria 2260
484 Ga0496111_0030324 3300048914 Bacteria 3846
485 Ga0496111_0058811 3300048914 Bacteria 2783
486 Ga0496111_0075701 3300048914 Bacteria 2453
487 Ga0496112_0000047 3300048915 Bacteria 84877
488 Ga0496112_0013065 3300048915 Bacteria 7660
489 Ga0496112_0014885 3300048915 Bacteria 7238
490 Ga0496112_0044055 3300048915 Bacteria 4370
491 Ga0496112_0068053 3300048915 Bacteria 3516
492 Ga0496112_0079670 3300048915 Bacteria 3240
493 Ga0496112_0291738 3300048915 Bacteria 1577
494 Ga0496112_0292657 3300048915 Bacteria 1574
495 Ga0496113_0018677 3300048916 Bacteria 4832
496 Ga0496113_0108831 3300048916 Bacteria 2154
497 Ga0496113_0208208 3300048916 Bacteria 1556
498 Ga0496114_0180581 3300048917 Bacteria 1843
499 Ga0496114_0210506 3300048917 Bacteria 1705
500 Ga0496114_0223916 3300048917 Bacteria 1651
501 Ga0496114_0286466 3300048917 Bacteria 1453
502 Ga0496115_0033405 3300048918 Bacteria 4062
503 Ga0496115_0040832 3300048918 Bacteria 3690
504 Ga0496115_0260389 3300048918 Bacteria 1426
505 Ga0496115_0329044 3300048918 Bacteria 1249
506 Ga0496117_0078872 3300048920 Bacteria 2172
507 Ga0496117_0153717 3300048920 Bacteria 1358
508 Ga0496118_0005620 3300048921 Bacteria 14161
509 Ga0496118_0051579 3300048921 Bacteria 3146
510 Ga0496119_0025754 3300048922 Bacteria 4100
511 Ga0496121_0003623 3300048924 Bacteria 21781
512 Ga0496121_0005449 3300048924 Bacteria 16302
513 Ga0496121_0031652 3300048924 Bacteria 4828
514 Ga0496121_0057251 3300048924 Bacteria 3232
515 Ga0496121_0059059 3300048924 Bacteria 3165
516 Ga0496121_0102926 3300048924 Bacteria 2198
517 Ga0496121_0135760 3300048924 Bacteria 1833
518 Ga0496121_0263902 3300048924 Bacteria 1187
519 Ga0496122_0056740 3300048925 Bacteria 2917
520 Ga0496124_0002607 3300048927 Bacteria 23290
521 Ga0496125_0057339 3300048928 Bacteria 3155
522 Ga0496125_0066138 3300048928 Bacteria 2859
523 Ga0496126_0017110 3300048929 Bacteria 7229
524 Ga0496126_0028939 3300048929 Bacteria 5269
525 Ga0496126_0032878 3300048929 Bacteria 4881
526 Ga0496126_0040542 3300048929 Bacteria 4316
527 Ga0496126_0059411 3300048929 Bacteria 3443
528 Ga0496126_0068555 3300048929 Bacteria 3167
529 Ga0496126_0081188 3300048929 Bacteria 2867
530 Ga0496126_0101814 3300048929 Bacteria 2512
531 Ga0501067_0171627 3300049583 Bacteria 1208
532 Ga0501070_0011623 3300049586 Bacteria 7432
533 Ga0501074_0019024 3300049590 Bacteria 4988
534 Ga0501080_0228437 3300049742 Bacteria 1701
535 Ga0501035_0046144 3300049822 Bacteria 3919
536 Ga0501035_0313297 3300049822 Bacteria 1320
537 Ga0501035_0409614 3300049822 Bacteria 1127
538 Ga0501044_0042664 3300049823 Bacteria 4717
539 nmdc:mga03683_18241_c1 3300050489 Bacteria 2665
540 nmdc:mga03n38_7516_c1 3300050490 Bacteria 3859
541 nmdc:mga0yw44_204153_c1 3300050492 Bacteria 1306
542 nmdc:mga0yw44_91516_c1 3300050492 Bacteria 1466
543 nmdc:mga06z11_28368_c1 3300050494 Bacteria 2685
544 nmdc:mga06z11_94423_c1 3300050494 Bacteria 1630
545 nmdc:mga04h51_8678_c1 3300050495 Bacteria 2725
546 nmdc:mga07m45_114939_c1 3300050496 Bacteria 1552
547 nmdc:mga07m45_9011_c1 3300050496 Bacteria 5155
548 nmdc:mga05p37_20372_c1 3300050507 Bacteria 8023
549 nmdc:mga08y16_58363_c1 3300050511 Bacteria 4032
550 Ga0495601_0033375 3300053077 Bacteria 3207
551 Ga0500635_0017578 3300053080 Bacteria 2145
552 Ga0495595_0007763 3300053084 Bacteria 4393
553 Ga0495619_0002735 3300053085 Bacteria 11519
554 Ga0495619_0054013 3300053085 Bacteria 2658
555 Ga0495619_0080463 3300053085 Bacteria 2192
556 Ga0495619_0192100 3300053085 Bacteria 1413
557 Ga0500578_0167698 3300053086 Bacteria 1359
558 Ga0500646_0035743 3300053090 Bacteria 1382
559 Ga0500647_0028787 3300053091 Bacteria 2632
560 Ga0500651_0030743 3300053093 Bacteria 3380
561 Ga0500566_0008936 3300053094 Bacteria 5923
562 Ga0500566_0035996 3300053094 Bacteria 2874
563 Ga0500640_003126 3300053095 Bacteria 5683
564 Ga0500554_000823 3300053102 Bacteria 6093
565 Ga0500572_001020 3300053111 Bacteria 8436
566 Ga0500572_001886 3300053111 Bacteria 5285
567 Ga0500595_004790 3300053119 Bacteria 5994
568 Ga0500595_007854 3300053119 Bacteria 4394
569 Ga0500595_010801 3300053119 Bacteria 3608
570 Ga0500595_019428 3300053119 Bacteria 2465
571 Ga0500595_023978 3300053119 Bacteria 2136
572 Ga0500608_050701 3300053122 Bacteria 1994
573 Ga0500614_001759 3300053123 Bacteria 5030
574 Ga0500655_007495 3300053133 Bacteria 1962
575 Ga0500658_0003745 3300053134 Bacteria 5725
576 Ga0500559_0001286 3300053136 Bacteria 14564
577 Ga0500559_0009338 3300053136 Bacteria 4250
578 Ga0500568_0004039 3300053139 Bacteria 7952
579 Ga0500568_0014097 3300053139 Bacteria 3622
580 Ga0500568_0014193 3300053139 Bacteria 3605
581 Ga0500573_0016725 3300053140 Bacteria 4167
582 Ga0500590_046862 3300053148 Bacteria 2208
583 Ga0500603_001833 3300053150 Bacteria 4759
584 Ga0500603_001990 3300053150 Bacteria 4535
585 Ga0500630_007371 3300053159 Bacteria 5397
586 Ga0500638_003913 3300053162 Bacteria 5622
587 Ga0500639_000165 3300053163 Bacteria 32213
588 Ga0500639_091609 3300053163 Bacteria 1513
589 Ga0500636_0031372 3300053177 Bacteria 3145
590 Ga0500636_0056309 3300053177 Bacteria 2303
591 Ga0500576_024162 3300053725 Bacteria 2772
592 Ga0500645_015347 3300053730 Bacteria 2428
593 Ga0500552_004656 3300053733 Bacteria 1456
594 Ga0500596_001068 3300053735 Bacteria 5520
595 Ga0500661_000594 3300055283 Bacteria 6768

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028794 Ga0307515_10225939 Ga0307515_102259392 280
2 3300027671 Ga0209588_1000803 Ga0209588_10008036 288
3 3300035118 Ga0373954_0140410 Ga0373954_0140410_128_1075 288
4 3300035172 Ga0373955_0026294 Ga0373955_0026294_2034_2981 288
5 3300035724 Ga0373933_0274242 Ga0373933_0274242_132_1079 288
6 3300035725 Ga0373947_0189845 Ga0373947_0189845_17_895 290
7 3300048915 Ga0496112_0044055 Ga0496112_0044055_20_892 290
8 3300010159 Ga0099796_10068747 Ga0099796_100687471 291
9 3300047469 Ga0495673_0101294 Ga0495673_0101294_125_1078 298
10 3300046537 Ga0495598_0069884 Ga0495598_0069884_34_942 300
11 3300046539 Ga0495621_0030482 Ga0495621_0030482_906_1814 300
12 3300048911 Ga0496108_0465769 Ga0496108_0465769_156_1076 300
13 3300048915 Ga0496112_0291738 Ga0496112_0291738_111_1013 300
14 3300046678 Ga0495599_0090190 Ga0495599_0090190_762_1673 301
15 3300037068 Ga0373925_0060012 Ga0373925_0060012_757_1680 305
16 3300005981 Ga0081538_10129470 Ga0081538_101294701 306
17 3300005719 Ga0068861_100049133 Ga0068861_1000491334 308
18 3300035111 Ga0373923_0029918 Ga0373923_0029918_401_1348 308
19 3300035113 Ga0373936_0005185 Ga0373936_0005185_2733_3680 308
20 3300035119 Ga0373956_0045318 Ga0373956_0045318_973_1920 308
21 3300035171 Ga0373946_0021271 Ga0373946_0021271_1271_2218 308
22 3300035692 Ga0373935_0003476 Ga0373935_0003476_1328_2275 308
23 3300035695 Ga0373927_0007145 Ga0373927_0007145_865_1812 308
24 3300035725 Ga0373947_0008928 Ga0373947_0008928_3974_4921 308
25 3300036401 Ga0373937_0213177 Ga0373937_0213177_170_1117 308
26 3300037068 Ga0373925_0008986 Ga0373925_0008986_3787_4734 308
27 3300046454 Ga0495592_0136885 Ga0495592_0136885_571_1518 308
28 3300046455 Ga0495603_0010687 Ga0495603_0010687_3954_4901 308
29 3300046459 Ga0495629_0013580 Ga0495629_0013580_1288_2235 308
30 3300046461 Ga0495641_0009295 Ga0495641_0009295_3622_4569 308
31 3300046463 Ga0495653_0076013 Ga0495653_0076013_1279_2226 308
32 3300046472 Ga0495580_0010932 Ga0495580_0010932_5567_6514 308
33 3300046473 Ga0495582_0002795 Ga0495582_0002795_2310_3257 308
34 3300046475 Ga0495639_0003127 Ga0495639_0003127_1663_2610 308
35 3300046476 Ga0495662_0013605 Ga0495662_0013605_900_1847 308
36 3300046477 Ga0495664_0070424 Ga0495664_0070424_546_1493 308
37 3300046499 Ga0495594_0024096 Ga0495594_0024096_203_1150 308
38 3300046514 Ga0495618_0068094 Ga0495618_0068094_862_1809 308
39 3300046516 Ga0495628_0107201 Ga0495628_0107201_233_1180 308
40 3300046517 Ga0495630_0010940 Ga0495630_0010940_2316_3263 308
41 3300046526 Ga0495666_0073992 Ga0495666_0073992_649_1596 308
42 3300046529 Ga0495652_0088365 Ga0495652_0088365_327_1274 308
43 3300046531 Ga0495665_0005849 Ga0495665_0005849_5632_6579 308
44 3300046557 Ga0495622_0008327 Ga0495622_0008327_1938_2885 308
45 3300046559 Ga0495667_0067119 Ga0495667_0067119_576_1523 308
46 3300046642 Ga0495634_0023772 Ga0495634_0023772_2496_3443 308
47 3300046663 Ga0495635_0005869 Ga0495635_0005869_3163_4110 308
48 3300046674 Ga0495588_0012755 Ga0495588_0012755_972_1919 308
49 3300046681 Ga0495647_0000756 Ga0495647_0000756_4306_5253 308
50 3300046683 Ga0495658_0002311 Ga0495658_0002311_5682_6629 308
51 3300046689 Ga0495613_0025231 Ga0495613_0025231_2938_3885 308
52 3300046690 Ga0495624_0007368 Ga0495624_0007368_5689_6636 308
53 3300047315 Ga0495581_0031589 Ga0495581_0031589_1026_1973 308
54 3300047319 Ga0495674_0003417 Ga0495674_0003417_8512_9459 308
55 3300047321 Ga0495676_0023928 Ga0495676_0023928_2329_3276 308
56 3300047673 Ga0495593_0001090 Ga0495593_0001090_9372_10319 308
57 3300006177 Ga0075362_10021046 Ga0075362_100210461 310
58 3300039437 Ga0436365_1272752 Ga0436365_1272752_842_1810 310
59 3300053134 Ga0500658_0003745 Ga0500658_0003745_2609_3577 310
60 3300053139 Ga0500568_0004039 Ga0500568_0004039_3576_4544 310
61 3300053140 Ga0500573_0016725 Ga0500573_0016725_438_1370 310
62 3300053177 Ga0500636_0031372 Ga0500636_0031372_1745_2677 310
63 iso_pu_bacteria 2667528175 2671118140 310
64 3300048908 Ga0496105_0257260 Ga0496105_0257260_45_986 311
65 3300048909 Ga0496106_0025125 Ga0496106_0025125_839_1780 311
66 3300048910 Ga0496107_0067888 Ga0496107_0067888_1120_2061 311
67 3300048911 Ga0496108_0032348 Ga0496108_0032348_708_1649 311
68 3300048912 Ga0496109_0036727 Ga0496109_0036727_837_1778 311
69 3300048915 Ga0496112_0013065 Ga0496112_0013065_1596_2537 311
70 iso_pu_bacteria 2513237096 2513658372 311
71 iso_pu_bacteria 2513237101 2513695958 311
72 iso_pu_bacteria 2513237137 2513857552 311
73 iso_pu_bacteria 2513237145 2513920136 311
74 iso_pu_bacteria 2517572143 2517893504 311
75 iso_pu_bacteria 2524023210 2524469956 311
76 iso_pu_bacteria 2524023228 2524538010 311
77 iso_pu_bacteria 2643221651 2644287936 311
78 iso_pu_bacteria 2721755755 2723846187 311
79 iso_pu_bacteria 2728368998 2728747733 311
80 iso_pu_bacteria 2791355196 2793060232 311
81 iso_pu_bacteria 2791355199 2793076640 311
82 iso_pu_bacteria 2874604998 2874610898 311
83 iso_pu_bacteria 2874628541 2874632672 311
84 iso_pu_bacteria 2876808645 2876810410 311
85 iso_pu_bacteria 2879110137 2879110513 311
86 iso_pu_bacteria 2885374607 2885380963 311
87 iso_pu_bacteria 2885383462 2885384462 311
88 iso_pu_bacteria 2889033259 2889041139 311
89 iso_pu_bacteria 2903748898 2903758280 311
90 iso_pu_bacteria 2904690495 2904696877 311
91 iso_pu_bacteria 2906610324 2906610387 311
92 iso_pu_bacteria 2906635258 2906642805 311
93 iso_pu_bacteria 2906660503 2906665940 311
94 iso_pu_bacteria 2908739725 2908743908 311
95 iso_pu_bacteria 2908756301 2908761454 311
96 iso_pu_bacteria 2922361189 2922361986 311
97 iso_pu_bacteria 2922386360 2922392005 311
98 iso_pu_bacteria 2935630451 2935637763 311
99 iso_pu_bacteria 2941507105 2941514436 311
100 iso_pu_bacteria 2941515067 2941522332 311
101 iso_pu_bacteria 2941523033 2941530149 311
102 iso_pu_bacteria 3005474847 3005479119 311
103 iso_pu_bacteria 3005710791 3005713732 311
104 iso_pu_bacteria 8006933436 8006942232 311
105 iso_pu_bacteria 8006964411 8006964545 311
106 iso_pu_bacteria 8006973647 8006981966 311
107 iso_pu_bacteria 8006984368 8006986837 311
108 iso_pu_bacteria 8006994254 8006996055 311
109 iso_pu_bacteria 8019659431 8019663503 311
110 iso_pu_bacteria 8056673599 8056680445 311
111 iso_pu_bacteria 8056681323 8056684504 311
112 3300025297 Ga0209758_1008841 Ga0209758_10088415 314
113 3300049822 Ga0501035_0046144 Ga0501035_0046144_745_1728 314
114 3300003203 JGI25406J46586_10000162 JGI25406J46586_100001624 315
115 3300003203 JGI25406J46586_10015420 JGI25406J46586_100154204 315
116 3300003203 JGI25406J46586_10021918 JGI25406J46586_100219182 315
117 3300003659 JGI25404J52841_10014050 JGI25404J52841_100140502 315
118 3300003659 JGI25404J52841_10020571 JGI25404J52841_100205711 315
119 3300005327 Ga0070658_10065497 Ga0070658_100654972 315
120 3300005327 Ga0070658_10091539 Ga0070658_100915392 315
121 3300005329 Ga0070683_100126479 Ga0070683_1001264793 315
122 3300005329 Ga0070683_100309420 Ga0070683_1003094201 315
123 3300005330 Ga0070690_100067481 Ga0070690_1000674812 315
124 3300005334 Ga0068869_100075256 Ga0068869_1000752562 315
125 3300005335 Ga0070666_10194612 Ga0070666_101946122 315
126 3300005336 Ga0070680_100156871 Ga0070680_1001568712 315
127 3300005337 Ga0070682_100097892 Ga0070682_1000978921 315
128 3300005338 Ga0068868_100107560 Ga0068868_1001075602 315
129 3300005341 Ga0070691_10101928 Ga0070691_101019281 315
130 3300005353 Ga0070669_100048296 Ga0070669_1000482963 315
131 3300005354 Ga0070675_100292447 Ga0070675_1002924472 315
132 3300005355 Ga0070671_100065717 Ga0070671_1000657174 315
133 3300005356 Ga0070674_100157936 Ga0070674_1001579362 315
134 3300005356 Ga0070674_100159235 Ga0070674_1001592351 315
135 3300005434 Ga0070709_10007290 Ga0070709_100072902 315
136 3300005434 Ga0070709_10029833 Ga0070709_100298333 315
137 3300005434 Ga0070709_10179164 Ga0070709_101791641 315
138 3300005435 Ga0070714_100012235 Ga0070714_1000122352 315
139 3300005436 Ga0070713_100019531 Ga0070713_1000195312 315
140 3300005436 Ga0070713_100198414 Ga0070713_1001984142 315
141 3300005437 Ga0070710_10009691 Ga0070710_100096913 315
142 3300005439 Ga0070711_100112504 Ga0070711_1001125042 315
143 3300005455 Ga0070663_100027389 Ga0070663_1000273892 315
144 3300005455 Ga0070663_100143290 Ga0070663_1001432902 315
145 3300005455 Ga0070663_100234649 Ga0070663_1002346492 315
146 3300005456 Ga0070678_100025743 Ga0070678_1000257432 315
147 3300005456 Ga0070678_100226327 Ga0070678_1002263271 315
148 3300005458 Ga0070681_10089919 Ga0070681_100899193 315
149 3300005458 Ga0070681_10200365 Ga0070681_102003652 315
150 3300005458 Ga0070681_10230082 Ga0070681_102300821 315
151 3300005458 Ga0070681_10285790 Ga0070681_102857901 315
152 3300005468 Ga0070707_100545481 Ga0070707_1005454811 315
153 3300005530 Ga0070679_100092381 Ga0070679_1000923814 315
154 3300005530 Ga0070679_100118983 Ga0070679_1001189833 315
155 3300005530 Ga0070679_100152926 Ga0070679_1001529262 315
156 3300005530 Ga0070679_100200429 Ga0070679_1002004292 315
157 3300005535 Ga0070684_100034836 Ga0070684_1000348363 315
158 3300005535 Ga0070684_100368277 Ga0070684_1003682772 315
159 3300005535 Ga0070684_100376382 Ga0070684_1003763821 315
160 3300005539 Ga0068853_100077509 Ga0068853_1000775091 315
161 3300005539 Ga0068853_100107104 Ga0068853_1001071042 315
162 3300005539 Ga0068853_100118787 Ga0068853_1001187872 315
163 3300005547 Ga0070693_100089834 Ga0070693_1000898341 315
164 3300005548 Ga0070665_100042707 Ga0070665_1000427075 315
165 3300005548 Ga0070665_100074604 Ga0070665_1000746042 315
166 3300005548 Ga0070665_100262983 Ga0070665_1002629832 315
167 3300005548 Ga0070665_100361553 Ga0070665_1003615532 315
168 3300005563 Ga0068855_100021801 Ga0068855_1000218017 315
169 3300005563 Ga0068855_100154929 Ga0068855_1001549292 315
170 3300005563 Ga0068855_100158887 Ga0068855_1001588872 315
171 3300005563 Ga0068855_100197906 Ga0068855_1001979063 315
172 3300005564 Ga0070664_100025149 Ga0070664_1000251493 315
173 3300005616 Ga0068852_100106616 Ga0068852_1001066163 315
174 3300005616 Ga0068852_100273986 Ga0068852_1002739862 315
175 3300005617 Ga0068859_100172173 Ga0068859_1001721732 315
176 3300005618 Ga0068864_100030397 Ga0068864_1000303973 315
177 3300005618 Ga0068864_100053526 Ga0068864_1000535264 315
178 3300005719 Ga0068861_100231402 Ga0068861_1002314022 315
179 3300005719 Ga0068861_100456198 Ga0068861_1004561981 315
180 3300005843 Ga0068860_100043210 Ga0068860_1000432105 315
181 3300005843 Ga0068860_100341016 Ga0068860_1003410162 315
182 3300005844 Ga0068862_100164844 Ga0068862_1001648442 315
183 3300005844 Ga0068862_100415962 Ga0068862_1004159621 315
184 3300005937 Ga0081455_10006819 Ga0081455_100068199 315
185 3300005937 Ga0081455_10147325 Ga0081455_101473252 315
186 3300005937 Ga0081455_10160456 Ga0081455_101604561 315
187 3300005983 Ga0081540_1003121 Ga0081540_10031211 315
188 3300005983 Ga0081540_1005500 Ga0081540_10055003 315
189 3300005983 Ga0081540_1009972 Ga0081540_10099723 315
190 3300005983 Ga0081540_1010599 Ga0081540_10105997 315
191 3300005983 Ga0081540_1015311 Ga0081540_10153113 315
192 3300005983 Ga0081540_1016750 Ga0081540_10167505 315
193 3300005983 Ga0081540_1020563 Ga0081540_10205632 315
194 3300005983 Ga0081540_1023691 Ga0081540_10236914 315
195 3300005983 Ga0081540_1033249 Ga0081540_10332493 315
196 3300005983 Ga0081540_1046015 Ga0081540_10460152 315
197 3300005985 Ga0081539_10000203 Ga0081539_100002031 315
198 3300005985 Ga0081539_10001007 Ga0081539_1000100735 315
199 3300005985 Ga0081539_10046196 Ga0081539_100461962 315
200 3300005985 Ga0081539_10053621 Ga0081539_100536213 315
201 3300006028 Ga0070717_10008113 Ga0070717_100081132 315
202 3300006028 Ga0070717_10012395 Ga0070717_100123957 315
203 3300006028 Ga0070717_10012865 Ga0070717_100128658 315
204 3300006038 Ga0075365_10055751 Ga0075365_100557512 315
205 3300006038 Ga0075365_10121570 Ga0075365_101215702 315
206 3300006042 Ga0075368_10014800 Ga0075368_100148003 315
207 3300006048 Ga0075363_100021152 Ga0075363_1000211522 315
208 3300006048 Ga0075363_100044685 Ga0075363_1000446853 315
209 3300006051 Ga0075364_10133930 Ga0075364_101339302 315
210 3300006163 Ga0070715_10006032 Ga0070715_100060322 315
211 3300006173 Ga0070716_100021193 Ga0070716_1000211932 315
212 3300006177 Ga0075362_10054390 Ga0075362_100543902 315
213 3300006178 Ga0075367_10018795 Ga0075367_100187952 315
214 3300006178 Ga0075367_10050292 Ga0075367_100502923 315
215 3300006186 Ga0075369_10029140 Ga0075369_100291402 315
216 3300006195 Ga0075366_10109249 Ga0075366_101092492 315
217 3300006237 Ga0097621_100096028 Ga0097621_1000960282 315
218 3300006353 Ga0075370_10049986 Ga0075370_100499862 315
219 3300006358 Ga0068871_100164814 Ga0068871_1001648142 315
220 3300006844 Ga0075428_100185910 Ga0075428_1001859102 315
221 3300006844 Ga0075428_100221966 Ga0075428_1002219662 315
222 3300006881 Ga0068865_100057305 Ga0068865_1000573053 315
223 3300006931 Ga0097620_100172175 Ga0097620_1001721752 315
224 3300007076 Ga0075435_100243703 Ga0075435_1002437032 315
225 3300007788 Ga0099795_10040124 Ga0099795_100401242 315
226 3300009092 Ga0105250_10054430 Ga0105250_100544302 315
227 3300009093 Ga0105240_10052144 Ga0105240_100521442 315
228 3300009093 Ga0105240_10099593 Ga0105240_100995934 315
229 3300009093 Ga0105240_10278559 Ga0105240_102785592 315
230 3300009094 Ga0111539_10061288 Ga0111539_100612882 315
231 3300009098 Ga0105245_10060845 Ga0105245_100608454 315
232 3300009098 Ga0105245_10197363 Ga0105245_101973632 315
233 3300009098 Ga0105245_10280527 Ga0105245_102805272 315
234 3300009147 Ga0114129_10037091 Ga0114129_1003709110 315
235 3300009148 Ga0105243_10172665 Ga0105243_101726652 315
236 3300009177 Ga0105248_10106832 Ga0105248_101068322 315
237 3300009177 Ga0105248_10176498 Ga0105248_101764982 315
238 3300009177 Ga0105248_10515306 Ga0105248_105153062 315
239 3300009545 Ga0105237_10437781 Ga0105237_104377812 315
240 3300009551 Ga0105238_10375964 Ga0105238_103759641 315
241 3300009553 Ga0105249_10052110 Ga0105249_100521102 315
242 3300010159 Ga0099796_10025047 Ga0099796_100250472 315
243 3300010375 Ga0105239_10050960 Ga0105239_100509603 315
244 3300010375 Ga0105239_10059034 Ga0105239_100590345 315
245 3300010375 Ga0105239_10222468 Ga0105239_102224683 315
246 3300011119 Ga0105246_10189702 Ga0105246_101897021 315
247 3300011119 Ga0105246_10247825 Ga0105246_102478252 315
248 3300011119 Ga0105246_10270250 Ga0105246_102702501 315
249 3300013104 Ga0157370_10137087 Ga0157370_101370872 315
250 3300013105 Ga0157369_10057918 Ga0157369_100579185 315
251 3300013105 Ga0157369_10094109 Ga0157369_100941094 315
252 3300013105 Ga0157369_10264495 Ga0157369_102644951 315
253 3300013105 Ga0157369_10274159 Ga0157369_102741592 315
254 3300013297 Ga0157378_10099691 Ga0157378_100996913 315
255 3300013307 Ga0157372_10104969 Ga0157372_101049692 315
256 3300013307 Ga0157372_10373339 Ga0157372_103733391 315
257 3300013308 Ga0157375_10132405 Ga0157375_101324053 315
258 3300013308 Ga0157375_10264605 Ga0157375_102646053 315
259 3300014325 Ga0163163_10009181 Ga0163163_100091818 315
260 3300014325 Ga0163163_10058180 Ga0163163_100581802 315
261 3300014325 Ga0163163_10073703 Ga0163163_100737032 315
262 3300014326 Ga0157380_10065271 Ga0157380_100652713 315
263 3300014326 Ga0157380_10266019 Ga0157380_102660191 315
264 3300014745 Ga0157377_10089370 Ga0157377_100893702 315
265 3300014745 Ga0157377_10110907 Ga0157377_101109072 315
266 3300014968 Ga0157379_10236417 Ga0157379_102364172 315
267 3300014969 Ga0157376_10046571 Ga0157376_100465711 315
268 3300014969 Ga0157376_10198960 Ga0157376_101989602 315
269 3300017792 Ga0163161_10095664 Ga0163161_100956642 315
270 3300025253 Ga0209677_100683 Ga0209677_1006837 315
271 3300025272 Ga0209455_1003978 Ga0209455_10039782 315
272 3300025297 Ga0209758_1015355 Ga0209758_10153554 315
273 3300025297 Ga0209758_1057789 Ga0209758_10577891 315
274 3300025315 Ga0207697_10043972 Ga0207697_100439722 315
275 3300025898 Ga0207692_10033228 Ga0207692_100332283 315
276 3300025899 Ga0207642_10058186 Ga0207642_100581862 315
277 3300025901 Ga0207688_10089576 Ga0207688_100895762 315
278 3300025905 Ga0207685_10001288 Ga0207685_100012882 315
279 3300025906 Ga0207699_10055499 Ga0207699_100554993 315
280 3300025906 Ga0207699_10061001 Ga0207699_100610013 315
281 3300025906 Ga0207699_10107971 Ga0207699_101079712 315
282 3300025912 Ga0207707_10001527 Ga0207707_1000152710 315
283 3300025912 Ga0207707_10071173 Ga0207707_100711733 315
284 3300025912 Ga0207707_10075388 Ga0207707_100753883 315
285 3300025912 Ga0207707_10147320 Ga0207707_101473202 315
286 3300025912 Ga0207707_10187513 Ga0207707_101875132 315
287 3300025913 Ga0207695_10070439 Ga0207695_100704392 315
288 3300025913 Ga0207695_10146792 Ga0207695_101467922 315
289 3300025913 Ga0207695_10226295 Ga0207695_102262952 315
290 3300025913 Ga0207695_10269330 Ga0207695_102693302 315
291 3300025914 Ga0207671_10102562 Ga0207671_101025622 315
292 3300025915 Ga0207693_10001370 Ga0207693_100013705 315
293 3300025916 Ga0207663_10000401 Ga0207663_100004017 315
294 3300025917 Ga0207660_10002267 Ga0207660_100022675 315
295 3300025917 Ga0207660_10141596 Ga0207660_101415961 315
296 3300025918 Ga0207662_10048762 Ga0207662_100487621 315
297 3300025919 Ga0207657_10051473 Ga0207657_100514732 315
298 3300025920 Ga0207649_10221806 Ga0207649_102218062 315
299 3300025921 Ga0207652_10011331 Ga0207652_1001133110 315
300 3300025921 Ga0207652_10047386 Ga0207652_100473861 315
301 3300025921 Ga0207652_10088570 Ga0207652_100885703 315
302 3300025921 Ga0207652_10118505 Ga0207652_101185052 315
303 3300025927 Ga0207687_10040402 Ga0207687_100404024 315
304 3300025927 Ga0207687_10204075 Ga0207687_102040752 315
305 3300025928 Ga0207700_10063688 Ga0207700_100636881 315
306 3300025929 Ga0207664_10006050 Ga0207664_100060506 315
307 3300025933 Ga0207706_10089367 Ga0207706_100893674 315
308 3300025937 Ga0207669_10016122 Ga0207669_100161222 315
309 3300025937 Ga0207669_10304740 Ga0207669_103047402 315
310 3300025938 Ga0207704_10310009 Ga0207704_103100091 315
311 3300025939 Ga0207665_10006374 Ga0207665_100063742 315
312 3300025939 Ga0207665_10263242 Ga0207665_102632421 315
313 3300025940 Ga0207691_10338864 Ga0207691_103388642 315
314 3300025941 Ga0207711_10089662 Ga0207711_100896622 315
315 3300025941 Ga0207711_10204848 Ga0207711_102048481 315
316 3300025942 Ga0207689_10080649 Ga0207689_100806492 315
317 3300025944 Ga0207661_10338476 Ga0207661_103384762 315
318 3300025944 Ga0207661_10465695 Ga0207661_104656951 315
319 3300025945 Ga0207679_10063875 Ga0207679_100638753 315
320 3300025949 Ga0207667_10043345 Ga0207667_100433453 315
321 3300025949 Ga0207667_10061169 Ga0207667_100611691 315
322 3300025961 Ga0207712_10041957 Ga0207712_100419572 315
323 3300025972 Ga0207668_10156423 Ga0207668_101564232 315
324 3300025972 Ga0207668_10244199 Ga0207668_102441992 315
325 3300025981 Ga0207640_10134410 Ga0207640_101344102 315
326 3300026023 Ga0207677_10136070 Ga0207677_101360702 315
327 3300026023 Ga0207677_10228838 Ga0207677_102288382 315
328 3300026035 Ga0207703_10055174 Ga0207703_100551744 315
329 3300026035 Ga0207703_10266439 Ga0207703_102664392 315
330 3300026041 Ga0207639_10028993 Ga0207639_100289935 315
331 3300026041 Ga0207639_10205704 Ga0207639_102057041 315
332 3300026067 Ga0207678_10046004 Ga0207678_100460042 315
333 3300026067 Ga0207678_10084410 Ga0207678_100844102 315
334 3300026067 Ga0207678_10091509 Ga0207678_100915091 315
335 3300026067 Ga0207678_10214023 Ga0207678_102140231 315
336 3300026067 Ga0207678_10306295 Ga0207678_103062952 315
337 3300026075 Ga0207708_10046583 Ga0207708_100465832 315
338 3300026078 Ga0207702_10001820 Ga0207702_100018204 315
339 3300026078 Ga0207702_10175701 Ga0207702_101757012 315
340 3300026089 Ga0207648_10020807 Ga0207648_100208076 315
341 3300026089 Ga0207648_10177246 Ga0207648_101772462 315
342 3300026116 Ga0207674_10156719 Ga0207674_101567193 315
343 3300026116 Ga0207674_10205094 Ga0207674_102050942 315
344 3300026118 Ga0207675_100137707 Ga0207675_1001377071 315
345 3300026118 Ga0207675_100198773 Ga0207675_1001987732 315
346 3300026118 Ga0207675_100343844 Ga0207675_1003438442 315
347 3300026121 Ga0207683_10037998 Ga0207683_100379985 315
348 3300026121 Ga0207683_10123146 Ga0207683_101231461 315
349 3300026121 Ga0207683_10158095 Ga0207683_101580952 315
350 3300026121 Ga0207683_10160111 Ga0207683_101601112 315
351 3300026142 Ga0207698_10094108 Ga0207698_100941082 315
352 3300027512 Ga0209179_1016377 Ga0209179_10163771 315
353 3300027866 Ga0209813_10013671 Ga0209813_100136712 315
354 3300028379 Ga0268266_10022495 Ga0268266_100224956 315
355 3300028379 Ga0268266_10026512 Ga0268266_100265124 315
356 3300028379 Ga0268266_10091925 Ga0268266_100919253 315
357 3300028379 Ga0268266_10321445 Ga0268266_103214451 315
358 3300028380 Ga0268265_10216042 Ga0268265_102160422 315
359 3300028380 Ga0268265_10390300 Ga0268265_103903001 315
360 3300028573 Ga0265334_10040001 Ga0265334_100400011 315
361 3300028786 Ga0307517_10003022 Ga0307517_1000302225 315
362 3300028794 Ga0307515_10166131 Ga0307515_101661311 315
363 3300030521 Ga0307511_10051446 Ga0307511_100514463 315
364 3300031235 Ga0265330_10009881 Ga0265330_100098817 315
365 3300031235 Ga0265330_10076819 Ga0265330_100768192 315
366 3300031238 Ga0265332_10033579 Ga0265332_100335791 315
367 3300031249 Ga0265339_10002960 Ga0265339_100029601 315
368 3300031249 Ga0265339_10101012 Ga0265339_101010121 315
369 3300031344 Ga0265316_10105608 Ga0265316_101056082 315
370 3300031616 Ga0307508_10098531 Ga0307508_100985312 315
371 3300031616 Ga0307508_10263179 Ga0307508_102631792 315
372 3300031711 Ga0265314_10045096 Ga0265314_100450961 315
373 3300031712 Ga0265342_10005223 Ga0265342_100052237 315
374 3300031712 Ga0265342_10140817 Ga0265342_101408171 315
375 3300031730 Ga0307516_10103001 Ga0307516_101030011 315
376 3300031730 Ga0307516_10264224 Ga0307516_102642242 315
377 3300031824 Ga0307413_10049870 Ga0307413_100498702 315
378 3300031824 Ga0307413_10392337 Ga0307413_103923371 315
379 3300031911 Ga0307412_10242028 Ga0307412_102420282 315
380 3300032002 Ga0307416_100133505 Ga0307416_1001335053 315
381 3300033179 Ga0307507_10049223 Ga0307507_100492233 315
382 3300033180 Ga0307510_10057427 Ga0307510_100574275 315
383 3300033180 Ga0307510_10108238 Ga0307510_101082383 315
384 3300033442 Ga0315911_1000009 Ga0315911_1000009118 315
385 3300034957 Ga0373938_0010029 Ga0373938_0010029_634_1581 315
386 3300035086 Ga0373934_0025016 Ga0373934_0025016_151_1104 315
387 3300035111 Ga0373923_0020712 Ga0373923_0020712_741_1694 315
388 3300035113 Ga0373936_0118676 Ga0373936_0118676_53_1000 315
389 3300035115 Ga0373941_0029263 Ga0373941_0029263_185_1132 315
390 3300035116 Ga0373945_0005479 Ga0373945_0005479_1658_2608 315
391 3300035117 Ga0373953_0010430 Ga0373953_0010430_620_1573 315
392 3300035117 Ga0373953_0073519 Ga0373953_0073519_366_1313 315
393 3300035118 Ga0373954_0001806 Ga0373954_0001806_6903_7856 315
394 3300035119 Ga0373956_0003991 Ga0373956_0003991_2506_3459 315
395 3300035120 Ga0373957_0067147 Ga0373957_0067147_289_1242 315
396 3300035170 Ga0373943_0060393 Ga0373943_0060393_855_1805 315
397 3300035171 Ga0373946_0125125 Ga0373946_0125125_161_1114 315
398 3300035172 Ga0373955_0007659 Ga0373955_0007659_1899_2852 315
399 3300035172 Ga0373955_0105902 Ga0373955_0105902_116_1093 315
400 3300035410 Ga0373924_0014546 Ga0373924_0014546_13_963 315
401 3300035410 Ga0373924_0068467 Ga0373924_0068467_439_1392 315
402 3300035410 Ga0373924_0108849 Ga0373924_0108849_161_1108 315
403 3300035691 Ga0373931_0047397 Ga0373931_0047397_352_1299 315
404 3300035692 Ga0373935_0017063 Ga0373935_0017063_3150_4100 315
405 3300035692 Ga0373935_0249424 Ga0373935_0249424_211_1164 315
406 3300035692 Ga0373935_0261432 Ga0373935_0261432_156_1103 315
407 3300035695 Ga0373927_0006488 Ga0373927_0006488_1020_1973 315
408 3300035695 Ga0373927_0074030 Ga0373927_0074030_440_1393 315
409 3300035695 Ga0373927_0128742 Ga0373927_0128742_305_1255 315
410 3300035724 Ga0373933_0042788 Ga0373933_0042788_149_1102 315
411 3300037068 Ga0373925_0010512 Ga0373925_0010512_4429_5379 315
412 3300037068 Ga0373925_0047030 Ga0373925_0047030_822_1769 315
413 3300037418 Ga0395900_0110000 Ga0395900_0110000_139_1092 315
414 3300037466 Ga0395898_0417438 Ga0395898_0417438_24_974 315
415 3300038443 Ga0395901_0264613 Ga0395901_0264613_691_1638 315
416 3300039447 Ga0436361_1084832 Ga0436361_1084832_24_971 315
417 3300039450 Ga0436363_1616347 Ga0436363_1616347_402_1355 315
418 3300044683 Ga0466965_0012547 Ga0466965_0012547_1875_2828 315
419 3300044694 Ga0466963_0088940 Ga0466963_0088940_291_1244 315
420 3300044901 Ga0466960_0174356 Ga0466960_0174356_100_1053 315
421 3300045976 Ga0466967_0026543 Ga0466967_0026543_3836_4789 315
422 3300045976 Ga0466967_0032174 Ga0466967_0032174_3024_3974 315
423 3300046454 Ga0495592_0005851 Ga0495592_0005851_6897_7850 315
424 3300046455 Ga0495603_0031247 Ga0495603_0031247_222_1175 315
425 3300046455 Ga0495603_0125433 Ga0495603_0125433_472_1425 315
426 3300046455 Ga0495603_0128705 Ga0495603_0128705_289_1239 315
427 3300046459 Ga0495629_0012454 Ga0495629_0012454_1110_2063 315
428 3300046459 Ga0495629_0106255 Ga0495629_0106255_786_1739 315
429 3300046460 Ga0495638_0094796 Ga0495638_0094796_702_1655 315
430 3300046460 Ga0495638_0133683 Ga0495638_0133683_459_1412 315
431 3300046462 Ga0495651_0048795 Ga0495651_0048795_1242_2249 315
432 3300046463 Ga0495653_0011476 Ga0495653_0011476_1448_2401 315
433 3300046471 Ga0495650_0056849 Ga0495650_0056849_25_978 315
434 3300046474 Ga0495605_0015828 Ga0495605_0015828_456_1409 315
435 3300046475 Ga0495639_0015064 Ga0495639_0015064_2114_3091 315
436 3300046477 Ga0495664_0035286 Ga0495664_0035286_1867_2814 315
437 3300046491 Ga0495584_0161645 Ga0495584_0161645_41_994 315
438 3300046499 Ga0495594_0015807 Ga0495594_0015807_491_1444 315
439 3300046501 Ga0495607_0041541 Ga0495607_0041541_594_1547 315
440 3300046514 Ga0495618_0067269 Ga0495618_0067269_525_1478 315
441 3300046514 Ga0495618_0090693 Ga0495618_0090693_227_1177 315
442 3300046516 Ga0495628_0069068 Ga0495628_0069068_585_1538 315
443 3300046516 Ga0495628_0190745 Ga0495628_0190745_246_1199 315
444 3300046516 Ga0495628_0249760 Ga0495628_0249760_26_979 315
445 3300046517 Ga0495630_0290472 Ga0495630_0290472_165_1118 315
446 3300046518 Ga0495631_0102790 Ga0495631_0102790_120_1073 315
447 3300046518 Ga0495631_0120927 Ga0495631_0120927_76_1023 315
448 3300046519 Ga0495632_0128279 Ga0495632_0128279_102_1055 315
449 3300046523 Ga0495644_0040062 Ga0495644_0040062_360_1307 315
450 3300046524 Ga0495648_0001345 Ga0495648_0001345_1434_2387 315
451 3300046529 Ga0495652_0080949 Ga0495652_0080949_1627_2580 315
452 3300046533 Ga0495640_0056506 Ga0495640_0056506_68_1018 315
453 3300046536 Ga0495587_0028352 Ga0495587_0028352_604_1557 315
454 3300046537 Ga0495598_0011004 Ga0495598_0011004_1063_2010 315
455 3300046543 Ga0495645_0050179 Ga0495645_0050179_1041_1994 315
456 3300046558 Ga0495633_0033297 Ga0495633_0033297_89_1042 315
457 3300046559 Ga0495667_0008834 Ga0495667_0008834_2069_3016 315
458 3300046615 Ga0495656_0093408 Ga0495656_0093408_332_1279 315
459 3300046616 Ga0495668_0175286 Ga0495668_0175286_35_988 315
460 3300046642 Ga0495634_0062859 Ga0495634_0062859_1073_2026 315
461 3300046642 Ga0495634_0102617 Ga0495634_0102617_476_1426 315
462 3300046648 Ga0495611_0118588 Ga0495611_0118588_213_1166 315
463 3300046663 Ga0495635_0034211 Ga0495635_0034211_1146_2099 315
464 3300046663 Ga0495635_0143387 Ga0495635_0143387_660_1613 315
465 3300046663 Ga0495635_0296474 Ga0495635_0296474_14_961 315
466 3300046663 Ga0495635_0316838 Ga0495635_0316838_72_1022 315
467 3300046664 Ga0495659_0006196 Ga0495659_0006196_2800_3747 315
468 3300046665 Ga0495661_0137871 Ga0495661_0137871_288_1235 315
469 3300046675 Ga0495657_0003795 Ga0495657_0003795_10237_11190 315
470 3300046678 Ga0495599_0005622 Ga0495599_0005622_4513_5466 315
471 3300046678 Ga0495599_0209899 Ga0495599_0209899_16_963 315
472 3300046679 Ga0495623_0010492 Ga0495623_0010492_725_1678 315
473 3300046680 Ga0495646_0009632 Ga0495646_0009632_3124_4077 315
474 3300046684 Ga0495669_0023135 Ga0495669_0023135_509_1462 315
475 3300046689 Ga0495613_0123960 Ga0495613_0123960_172_1125 315
476 3300046690 Ga0495624_0134605 Ga0495624_0134605_386_1339 315
477 3300046690 Ga0495624_0142868 Ga0495624_0142868_425_1375 315
478 3300046809 Ga0495600_0001231 Ga0495600_0001231_2649_3602 315
479 3300046809 Ga0495600_0046855 Ga0495600_0046855_429_1391 315
480 3300047315 Ga0495581_0116427 Ga0495581_0116427_341_1294 315
481 3300047317 Ga0495604_0038886 Ga0495604_0038886_1214_2167 315
482 3300047318 Ga0495636_0119382 Ga0495636_0119382_172_1119 315
483 3300047319 Ga0495674_0010957 Ga0495674_0010957_3195_4172 315
484 3300047319 Ga0495674_0101947 Ga0495674_0101947_241_1188 315
485 3300047319 Ga0495674_0129131 Ga0495674_0129131_789_1742 315
486 3300047320 Ga0495672_0011803 Ga0495672_0011803_3112_4065 315
487 3300047320 Ga0495672_0020534 Ga0495672_0020534_2632_3585 315
488 3300047321 Ga0495676_0053471 Ga0495676_0053471_730_1683 315
489 3300047321 Ga0495676_0060540 Ga0495676_0060540_1843_2796 315
490 3300047321 Ga0495676_0120858 Ga0495676_0120858_903_1856 315
491 3300047322 Ga0495680_0001397 Ga0495680_0001397_18431_19384 315
492 3300047322 Ga0495680_0063266 Ga0495680_0063266_248_1195 315
493 3300047444 Ga0495675_0024187 Ga0495675_0024187_1146_2099 315
494 3300047471 Ga0495684_0002444 Ga0495684_0002444_12593_13546 315
495 3300047471 Ga0495684_0007684 Ga0495684_0007684_526_1503 315
496 3300047471 Ga0495684_0312286 Ga0495684_0312286_128_1090 315
497 3300047472 Ga0495686_0107252 Ga0495686_0107252_560_1513 315
498 3300047673 Ga0495593_0001188 Ga0495593_0001188_10141_11094 315
499 3300047673 Ga0495593_0020272 Ga0495593_0020272_271_1221 315
500 3300048903 Ga0496100_0048809 Ga0496100_0048809_1655_2608 315
501 3300048903 Ga0496100_0058290 Ga0496100_0058290_762_1727 315
502 3300048903 Ga0496100_0106310 Ga0496100_0106310_496_1443 315
503 3300048903 Ga0496100_0163814 Ga0496100_0163814_458_1411 315
504 3300048904 Ga0496101_0027115 Ga0496101_0027115_1114_2067 315
505 3300048904 Ga0496101_0100053 Ga0496101_0100053_925_1872 315
506 3300048905 Ga0496102_0027842 Ga0496102_0027842_3625_4590 315
507 3300048905 Ga0496102_0035969 Ga0496102_0035969_3052_3999 315
508 3300048905 Ga0496102_0086418 Ga0496102_0086418_715_1668 315
509 3300048905 Ga0496102_0119733 Ga0496102_0119733_89_1042 315
510 3300048906 Ga0496103_0019153 Ga0496103_0019153_2165_3118 315
511 3300048906 Ga0496103_0058793 Ga0496103_0058793_1131_2078 315
512 3300048906 Ga0496103_0160063 Ga0496103_0160063_263_1216 315
513 3300048907 Ga0496104_0045388 Ga0496104_0045388_2425_3372 315
514 3300048907 Ga0496104_0050441 Ga0496104_0050441_2292_3257 315
515 3300048907 Ga0496104_0064124 Ga0496104_0064124_2467_3420 315
516 3300048908 Ga0496105_0017121 Ga0496105_0017121_3308_4261 315
517 3300048908 Ga0496105_0028187 Ga0496105_0028187_2926_3891 315
518 3300048908 Ga0496105_0034952 Ga0496105_0034952_436_1383 315
519 3300048908 Ga0496105_0080592 Ga0496105_0080592_258_1211 315
520 3300048908 Ga0496105_0286876 Ga0496105_0286876_112_1065 315
521 3300048909 Ga0496106_0001842 Ga0496106_0001842_14454_15401 315
522 3300048909 Ga0496106_0052267 Ga0496106_0052267_381_1334 315
523 3300048909 Ga0496106_0079966 Ga0496106_0079966_799_1752 315
524 3300048909 Ga0496106_0119444 Ga0496106_0119444_709_1662 315
525 3300048909 Ga0496106_0176230 Ga0496106_0176230_350_1303 315
526 3300048909 Ga0496106_0277667 Ga0496106_0277667_243_1190 315
527 3300048910 Ga0496107_0095456 Ga0496107_0095456_754_1701 315
528 3300048910 Ga0496107_0102046 Ga0496107_0102046_1047_2000 315
529 3300048910 Ga0496107_0180146 Ga0496107_0180146_188_1141 315
530 3300048911 Ga0496108_0127535 Ga0496108_0127535_1073_2026 315
531 3300048911 Ga0496108_0275684 Ga0496108_0275684_126_1073 315
532 3300048912 Ga0496109_0139905 Ga0496109_0139905_445_1398 315
533 3300048912 Ga0496109_0159672 Ga0496109_0159672_635_1588 315
534 3300048913 Ga0496110_0131480 Ga0496110_0131480_631_1578 315
535 3300048914 Ga0496111_0030324 Ga0496111_0030324_479_1426 315
536 3300048914 Ga0496111_0058811 Ga0496111_0058811_1073_2020 315
537 3300048914 Ga0496111_0075701 Ga0496111_0075701_151_1104 315
538 3300048915 Ga0496112_0000047 Ga0496112_0000047_69727_70674 315
539 3300048915 Ga0496112_0014885 Ga0496112_0014885_2179_3126 315
540 3300048915 Ga0496112_0068053 Ga0496112_0068053_2319_3284 315
541 3300048915 Ga0496112_0079670 Ga0496112_0079670_129_1082 315
542 3300048915 Ga0496112_0292657 Ga0496112_0292657_225_1178 315
543 3300048916 Ga0496113_0018677 Ga0496113_0018677_504_1451 315
544 3300048916 Ga0496113_0108831 Ga0496113_0108831_732_1685 315
545 3300048916 Ga0496113_0208208 Ga0496113_0208208_596_1543 315
546 3300048917 Ga0496114_0180581 Ga0496114_0180581_37_990 315
547 3300048917 Ga0496114_0210506 Ga0496114_0210506_212_1165 315
548 3300048917 Ga0496114_0223916 Ga0496114_0223916_461_1408 315
549 3300048917 Ga0496114_0286466 Ga0496114_0286466_56_1021 315
550 3300048918 Ga0496115_0033405 Ga0496115_0033405_610_1557 315
551 3300048918 Ga0496115_0040832 Ga0496115_0040832_2130_3083 315
552 3300048918 Ga0496115_0260389 Ga0496115_0260389_98_1051 315
553 3300048918 Ga0496115_0329044 Ga0496115_0329044_160_1113 315
554 3300048920 Ga0496117_0078872 Ga0496117_0078872_201_1148 315
555 3300048920 Ga0496117_0153717 Ga0496117_0153717_12_959 315
556 3300048921 Ga0496118_0005620 Ga0496118_0005620_9628_10575 315
557 3300048921 Ga0496118_0051579 Ga0496118_0051579_901_1851 315
558 3300048922 Ga0496119_0025754 Ga0496119_0025754_563_1516 315
559 3300048924 Ga0496121_0003623 Ga0496121_0003623_7955_8902 315
560 3300048924 Ga0496121_0005449 Ga0496121_0005449_11108_12061 315
561 3300048924 Ga0496121_0031652 Ga0496121_0031652_3846_4799 315
562 3300048924 Ga0496121_0057251 Ga0496121_0057251_508_1467 315
563 3300048924 Ga0496121_0059059 Ga0496121_0059059_619_1593 315
564 3300048924 Ga0496121_0102926 Ga0496121_0102926_1119_2078 315
565 3300048924 Ga0496121_0135760 Ga0496121_0135760_290_1243 315
566 3300048924 Ga0496121_0263902 Ga0496121_0263902_45_998 315
567 3300048925 Ga0496122_0056740 Ga0496122_0056740_1216_2199 315
568 3300048927 Ga0496124_0002607 Ga0496124_0002607_9619_10566 315
569 3300048928 Ga0496125_0057339 Ga0496125_0057339_1956_2903 315
570 3300048928 Ga0496125_0066138 Ga0496125_0066138_450_1400 315
571 3300048929 Ga0496126_0017110 Ga0496126_0017110_798_1754 315
572 3300048929 Ga0496126_0028939 Ga0496126_0028939_718_1707 315
573 3300048929 Ga0496126_0032878 Ga0496126_0032878_1707_2690 315
574 3300048929 Ga0496126_0040542 Ga0496126_0040542_2926_3879 315
575 3300048929 Ga0496126_0059411 Ga0496126_0059411_1552_2499 315
576 3300048929 Ga0496126_0068555 Ga0496126_0068555_1162_2136 315
577 3300048929 Ga0496126_0081188 Ga0496126_0081188_638_1585 315
578 3300048929 Ga0496126_0101814 Ga0496126_0101814_409_1356 315
579 3300049583 Ga0501067_0171627 Ga0501067_0171627_55_1014 315
580 3300049586 Ga0501070_0011623 Ga0501070_0011623_5565_6518 315
581 3300049590 Ga0501074_0019024 Ga0501074_0019024_740_1693 315
582 3300049742 Ga0501080_0228437 Ga0501080_0228437_207_1160 315
583 3300049822 Ga0501035_0313297 Ga0501035_0313297_24_977 315
584 3300049822 Ga0501035_0409614 Ga0501035_0409614_109_1062 315
585 3300049823 Ga0501044_0042664 Ga0501044_0042664_3099_4052 315
586 3300050489 nmdc:mga03683_18241_c1 nmdc:mga03683_18241_c1_894_1853 315
587 3300050490 nmdc:mga03n38_7516_c1 nmdc:mga03n38_7516_c1_460_1413 315
588 3300050492 nmdc:mga0yw44_204153_c1 nmdc:mga0yw44_204153_c1_314_1267 315
589 3300050492 nmdc:mga0yw44_91516_c1 nmdc:mga0yw44_91516_c1_472_1425 315
590 3300050494 nmdc:mga06z11_28368_c1 nmdc:mga06z11_28368_c1_399_1352 315
591 3300050494 nmdc:mga06z11_94423_c1 nmdc:mga06z11_94423_c1_201_1154 315
592 3300050495 nmdc:mga04h51_8678_c1 nmdc:mga04h51_8678_c1_1405_2358 315
593 3300050496 nmdc:mga07m45_114939_c1 nmdc:mga07m45_114939_c1_373_1326 315
594 3300050496 nmdc:mga07m45_9011_c1 nmdc:mga07m45_9011_c1_3865_4818 315
595 3300050507 nmdc:mga05p37_20372_c1 nmdc:mga05p37_20372_c1_5418_6377 315
596 3300050511 nmdc:mga08y16_58363_c1 nmdc:mga08y16_58363_c1_1141_2094 315
597 3300053077 Ga0495601_0033375 Ga0495601_0033375_1223_2176 315
598 3300053080 Ga0500635_0017578 Ga0500635_0017578_595_1542 315
599 3300053084 Ga0495595_0007763 Ga0495595_0007763_1326_2279 315
600 3300053085 Ga0495619_0002735 Ga0495619_0002735_6741_7694 315
601 3300053085 Ga0495619_0054013 Ga0495619_0054013_911_1864 315
602 3300053085 Ga0495619_0080463 Ga0495619_0080463_269_1216 315
603 3300053085 Ga0495619_0192100 Ga0495619_0192100_252_1205 315
604 3300053086 Ga0500578_0167698 Ga0500578_0167698_303_1256 315
605 3300053090 Ga0500646_0035743 Ga0500646_0035743_353_1306 315
606 3300053091 Ga0500647_0028787 Ga0500647_0028787_1204_2151 315
607 3300053093 Ga0500651_0030743 Ga0500651_0030743_107_1060 315
608 3300053094 Ga0500566_0008936 Ga0500566_0008936_3756_4703 315
609 3300053094 Ga0500566_0035996 Ga0500566_0035996_1135_2088 315
610 3300053095 Ga0500640_003126 Ga0500640_003126_336_1283 315
611 3300053102 Ga0500554_000823 Ga0500554_000823_864_1817 315
612 3300053111 Ga0500572_001020 Ga0500572_001020_257_1216 315
613 3300053111 Ga0500572_001886 Ga0500572_001886_3313_4260 315
614 3300053119 Ga0500595_004790 Ga0500595_004790_1286_2239 315
615 3300053119 Ga0500595_007854 Ga0500595_007854_667_1620 315
616 3300053119 Ga0500595_010801 Ga0500595_010801_1032_1985 315
617 3300053119 Ga0500595_019428 Ga0500595_019428_1164_2111 315
618 3300053119 Ga0500595_023978 Ga0500595_023978_790_1743 315
619 3300053122 Ga0500608_050701 Ga0500608_050701_974_1921 315
620 3300053123 Ga0500614_001759 Ga0500614_001759_3061_4008 315
621 3300053133 Ga0500655_007495 Ga0500655_007495_46_999 315
622 3300053136 Ga0500559_0001286 Ga0500559_0001286_7491_8450 315
623 3300053136 Ga0500559_0009338 Ga0500559_0009338_391_1338 315
624 3300053139 Ga0500568_0014097 Ga0500568_0014097_179_1132 315
625 3300053139 Ga0500568_0014193 Ga0500568_0014193_690_1643 315
626 3300053148 Ga0500590_046862 Ga0500590_046862_885_1877 315
627 3300053150 Ga0500603_001833 Ga0500603_001833_1165_2112 315
628 3300053150 Ga0500603_001990 Ga0500603_001990_3332_4285 315
629 3300053159 Ga0500630_007371 Ga0500630_007371_1221_2168 315
630 3300053162 Ga0500638_003913 Ga0500638_003913_596_1549 315
631 3300053163 Ga0500639_000165 Ga0500639_000165_1221_2168 315
632 3300053163 Ga0500639_091609 Ga0500639_091609_242_1189 315
633 3300053177 Ga0500636_0056309 Ga0500636_0056309_261_1241 315
634 3300053725 Ga0500576_024162 Ga0500576_024162_1636_2595 315
635 3300053730 Ga0500645_015347 Ga0500645_015347_1280_2233 315
636 3300053733 Ga0500552_004656 Ga0500552_004656_406_1353 315
637 3300053735 Ga0500596_001068 Ga0500596_001068_3539_4486 315
638 3300055283 Ga0500661_000594 Ga0500661_000594_4222_5175 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

28

338

0.96

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

172

286

0.94

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

131

306

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ruz-assembly1.cif.gz_B nadh-dependent coenzyme a disulfide reductase 0.9667 148 176
1nhs-assembly1.cif.gz_A an l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide 0.9617 148 177
1nhr-assembly1.cif.gz_A an l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide 0.9612 148 177
1nhq-assembly1.cif.gz_A crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303 0.9605 148 177
1nhp-assembly1.cif.gz_A crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303 0.9594 148 177
ID Description Score Start End Superfamily
af_Q7XRA3_150_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9653 143 286 3.40.50.720
af_A0A0R0KIU5_101_193_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9616 195 286 3.40.50.720
af_Q2FVW4_141_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9604 143 282 3.40.50.720
af_Q7SZY8_153_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9604 147 282 3.40.50.720
2bc1B02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9601 148 177 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A418V4G4-F1-model_v4 2-hydroxyacid dehydrogenase 0.981 1 315 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A4Q3GWW0-F1-model_v4 deleted 0.9724 76 315
AF-A0A810A6F7-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9712 109 315 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A1H4RLV0-F1-model_v4 Lactate dehydrogenase 0.9699 1 295 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A256G667-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain protein 0.9674 44 315 GO:0005829
GO:0016618
GO:0030267
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.47 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map