F471431

General Info

Members Datasets Scaffolds Average Seq Length
637 213 636 224

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10448916|Ga0207671_104489162
Length 245
Sequence LRIRPDESDSLLSNCHRGRLINTGASVAELGRRLAAEGLGSFFLFACVIGSGIMAEHLSSGNDAIALLGNTLATGAMLFVLITMLGPISGAHMNPAVSLVAASRHELAWRDAGAYVVVQFVFGILGAWAAHVMFGLPALQLSVKARAGLGQWAGEFIATFGLILTILGTVRYRREWVPASVALYITAAYWFTSSTSFANPAITVARSLTNTFAGIAPHDVPLFVLAQLFGAIAAALTARLLFDRD

Samples

Sample ID Description Type Environment
1 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
203 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.31
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 5.02
Rhizosphere 92.94
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000816 3300001989 Bacteria 11417
2 JGI24737J22298_10000296 3300001990 Bacteria 16530
3 JGI24743J22301_10058642 3300001991 Bacteria 791
4 JGI24738J21930_10000065 3300002075 Bacteria 21949
5 JGI24744J21845_10023389 3300002077 Bacteria 1210
6 JGI24035J26624_1003645 3300002126 Bacteria 1454
7 Ga0065715_10105120 3300005293 Bacteria 2913
8 Ga0070658_10022504 3300005327 Bacteria 5058
9 Ga0070658_10110197 3300005327 Bacteria 2280
10 Ga0070676_10004904 3300005328 Bacteria 7089
11 Ga0070676_10014001 3300005328 Bacteria 4402
12 Ga0070690_100004600 3300005330 Bacteria 7674
13 Ga0070690_100023508 3300005330 Bacteria 3780
14 Ga0070690_100033295 3300005330 Bacteria 3224
15 Ga0070690_100199100 3300005330 Bacteria 1393
16 Ga0070670_100008638 3300005331 Bacteria 8695
17 Ga0070670_100037409 3300005331 Bacteria 4176
18 Ga0070670_100173451 3300005331 Bacteria 1871
19 Ga0070670_100316999 3300005331 Bacteria 1365
20 Ga0070670_100497727 3300005331 Bacteria 1083
21 Ga0070677_10000855 3300005333 Bacteria 10030
22 Ga0068869_100000215 3300005334 Bacteria 30140
23 Ga0070666_10007280 3300005335 Bacteria 6817
24 Ga0070666_10023607 3300005335 Bacteria 4003
25 Ga0070666_10039195 3300005335 Bacteria 3157
26 Ga0070666_10103898 3300005335 Bacteria 1960
27 Ga0070666_10150119 3300005335 Bacteria 1626
28 Ga0070680_100031006 3300005336 Bacteria 4296
29 Ga0070682_100041381 3300005337 Bacteria 2840
30 Ga0068868_100000001 3300005338 Bacteria 282170
31 Ga0068868_100000041 3300005338 Bacteria 69601
32 Ga0068868_100027715 3300005338 Bacteria 4323
33 Ga0068868_100045958 3300005338 Bacteria 3417
34 Ga0068868_100146627 3300005338 Bacteria 1941
35 Ga0068868_100215585 3300005338 Bacteria 1606
36 Ga0068868_100265641 3300005338 Bacteria 1448
37 Ga0068868_100281659 3300005338 Bacteria 1407
38 Ga0070660_100003237 3300005339 Bacteria 11177
39 Ga0070660_100005177 3300005339 Bacteria 9017
40 Ga0070660_100005221 3300005339 Bacteria 8982
41 Ga0070660_100017791 3300005339 Bacteria 5184
42 Ga0070660_100170529 3300005339 Bacteria 1758
43 Ga0070660_100196818 3300005339 Bacteria 1634
44 Ga0070660_100734016 3300005339 Bacteria 829
45 Ga0070689_100119824 3300005340 Bacteria 2101
46 Ga0070689_100173503 3300005340 Bacteria 1748
47 Ga0070661_100000202 3300005344 Bacteria 49212
48 Ga0070661_100025208 3300005344 Bacteria 4273
49 Ga0070661_100057413 3300005344 Bacteria 2852
50 Ga0070661_100202856 3300005344 Bacteria 1516
51 Ga0070661_100573942 3300005344 Bacteria 910
52 Ga0070692_10006102 3300005345 Bacteria 5205
53 Ga0070692_10014846 3300005345 Bacteria 3669
54 Ga0070668_100018834 3300005347 Bacteria 5186
55 Ga0070668_100243991 3300005347 Bacteria 1489
56 Ga0070668_100426672 3300005347 Bacteria 1136
57 Ga0070669_100009536 3300005353 Bacteria 6912
58 Ga0070669_100086852 3300005353 Bacteria 2338
59 Ga0070669_100452366 3300005353 Bacteria 1058
60 Ga0070669_100516246 3300005353 Bacteria 993
61 Ga0070671_100000790 3300005355 Bacteria 22794
62 Ga0070671_100032011 3300005355 Bacteria 4348
63 Ga0070671_100053070 3300005355 Bacteria 3370
64 Ga0070671_100072558 3300005355 Bacteria 2875
65 Ga0070671_100075399 3300005355 Bacteria 2817
66 Ga0070671_100093459 3300005355 Bacteria 2520
67 Ga0070671_100509332 3300005355 Bacteria 1036
68 Ga0070674_100003988 3300005356 Bacteria 8365
69 Ga0070674_100045250 3300005356 Bacteria 3007
70 Ga0070674_100087427 3300005356 Bacteria 2241
71 Ga0070673_100000242 3300005364 Bacteria 27415
72 Ga0070673_100000346 3300005364 Bacteria 24441
73 Ga0070673_100008168 3300005364 Bacteria 6946
74 Ga0070673_100025546 3300005364 Bacteria 4350
75 Ga0070673_100045669 3300005364 Bacteria 3398
76 Ga0070673_100286789 3300005364 Bacteria 1446
77 Ga0070673_100536235 3300005364 Bacteria 1062
78 Ga0070673_100762780 3300005364 Bacteria 891
79 Ga0070659_100000001 3300005366 Bacteria 576390
80 Ga0070659_100001924 3300005366 Bacteria 14833
81 Ga0070659_100020999 3300005366 Bacteria 4966
82 Ga0070659_100026352 3300005366 Bacteria 4473
83 Ga0070659_100039606 3300005366 Bacteria 3680
84 Ga0070659_100065290 3300005366 Bacteria 2882
85 Ga0070659_100506038 3300005366 Bacteria 1030
86 Ga0070667_100001538 3300005367 Bacteria 20662
87 Ga0070667_100002695 3300005367 Bacteria 15377
88 Ga0070667_100013153 3300005367 Bacteria 6841
89 Ga0070667_100026415 3300005367 Bacteria 4829
90 Ga0070667_100154767 3300005367 Bacteria 2016
91 Ga0070667_100605771 3300005367 Bacteria 1009
92 Ga0070709_10184874 3300005434 Bacteria 1466
93 Ga0070714_100483671 3300005435 Bacteria 1179
94 Ga0070713_100001736 3300005436 Bacteria 14032
95 Ga0070694_100015173 3300005444 Bacteria 4832
96 Ga0070663_100003596 3300005455 Bacteria 8952
97 Ga0070663_100020557 3300005455 Bacteria 4372
98 Ga0070678_100003987 3300005456 Bacteria 8300
99 Ga0070678_100017595 3300005456 Bacteria 4609
100 Ga0070662_100002998 3300005457 Bacteria 10500
101 Ga0070662_100003201 3300005457 Bacteria 10180
102 Ga0070662_100016475 3300005457 Bacteria 4965
103 Ga0070662_100021755 3300005457 Bacteria 4382
104 Ga0070662_100209927 3300005457 Bacteria 1549
105 Ga0070662_100225437 3300005457 Bacteria 1497
106 Ga0070662_100278994 3300005457 Bacteria 1352
107 Ga0070662_100542478 3300005457 Bacteria 974
108 Ga0070681_10041392 3300005458 Bacteria 4618
109 Ga0070681_10313781 3300005458 Bacteria 1477
110 Ga0068867_100022803 3300005459 Bacteria 4479
111 Ga0068867_100041281 3300005459 Bacteria 3371
112 Ga0070685_10019930 3300005466 Bacteria 3626
113 Ga0070685_10095526 3300005466 Bacteria 1807
114 Ga0070698_100365437 3300005471 Bacteria 1375
115 Ga0070679_100147473 3300005530 Bacteria 2330
116 Ga0070684_100212313 3300005535 Bacteria 1764
117 Ga0070697_100442315 3300005536 Bacteria 1132
118 Ga0068853_100011326 3300005539 Bacteria 7242
119 Ga0068853_100776232 3300005539 Bacteria 917
120 Ga0070672_100004276 3300005543 Bacteria 9334
121 Ga0070672_100004985 3300005543 Bacteria 8749
122 Ga0070672_100010010 3300005543 Bacteria 6560
123 Ga0070672_100020270 3300005543 Bacteria 4846
124 Ga0070672_100068141 3300005543 Bacteria 2822
125 Ga0070672_100093613 3300005543 Bacteria 2428
126 Ga0070672_100113250 3300005543 Bacteria 2214
127 Ga0070672_100681840 3300005543 Bacteria 899
128 Ga0070686_100000303 3300005544 Bacteria 32746
129 Ga0070665_100010149 3300005548 Bacteria 9524
130 Ga0070665_100338409 3300005548 Bacteria 1509
131 Ga0070665_100459027 3300005548 Bacteria 1284
132 Ga0070665_100839250 3300005548 Bacteria 932
133 Ga0068855_100005738 3300005563 Bacteria 15155
134 Ga0068855_100064009 3300005563 Bacteria 4290
135 Ga0068855_100086331 3300005563 Bacteria 3628
136 Ga0070664_100044291 3300005564 Bacteria 3757
137 Ga0070664_100099669 3300005564 Bacteria 2525
138 Ga0070664_100330013 3300005564 Bacteria 1384
139 Ga0068857_100004703 3300005577 Bacteria 11572
140 Ga0068857_100047076 3300005577 Bacteria 3828
141 Ga0068857_100426192 3300005577 Bacteria 1237
142 Ga0068854_100001510 3300005578 Bacteria 14092
143 Ga0068854_100090900 3300005578 Bacteria 2271
144 Ga0068854_100914272 3300005578 Bacteria 772
145 Ga0068856_100061613 3300005614 Bacteria 3707
146 Ga0068852_100018863 3300005616 Bacteria 5445
147 Ga0068852_100037585 3300005616 Bacteria 4061
148 Ga0068852_100074233 3300005616 Bacteria 2994
149 Ga0068859_100000281 3300005617 Bacteria 50775
150 Ga0068859_100002867 3300005617 Bacteria 17497
151 Ga0068859_100053252 3300005617 Bacteria 4069
152 Ga0068859_100154149 3300005617 Bacteria 2374
153 Ga0068864_100000261 3300005618 Bacteria 47015
154 Ga0068864_100000564 3300005618 Bacteria 31589
155 Ga0068864_100012776 3300005618 Bacteria 6941
156 Ga0068864_100030127 3300005618 Bacteria 4599
157 Ga0068864_100045249 3300005618 Bacteria 3775
158 Ga0068864_100151549 3300005618 Bacteria 2101
159 Ga0068864_100229961 3300005618 Bacteria 1714
160 Ga0068866_10011347 3300005718 Bacteria 3852
161 Ga0068866_10181302 3300005718 Bacteria 1244
162 Ga0068851_10159391 3300005834 Bacteria 1238
163 Ga0068870_10108690 3300005840 Bacteria 1579
164 Ga0068863_100000554 3300005841 Bacteria 38065
165 Ga0068863_100000807 3300005841 Bacteria 31405
166 Ga0068863_100047990 3300005841 Bacteria 4049
167 Ga0068863_100053105 3300005841 Bacteria 3840
168 Ga0068863_100077971 3300005841 Bacteria 3136
169 Ga0068863_100078907 3300005841 Bacteria 3118
170 Ga0068863_100456608 3300005841 Bacteria 1254
171 Ga0068858_100001974 3300005842 Bacteria 20959
172 Ga0068858_100002051 3300005842 Bacteria 20516
173 Ga0068858_100007088 3300005842 Bacteria 10883
174 Ga0068858_100034598 3300005842 Bacteria 4686
175 Ga0068858_100078599 3300005842 Bacteria 3066
176 Ga0068858_100170606 3300005842 Bacteria 2051
177 Ga0068860_100000867 3300005843 Bacteria 33656
178 Ga0068860_100021722 3300005843 Bacteria 6211
179 Ga0068860_100029454 3300005843 Bacteria 5281
180 Ga0068860_100064058 3300005843 Bacteria 3491
181 Ga0068862_100006835 3300005844 Bacteria 9457
182 Ga0068862_100007953 3300005844 Bacteria 8771
183 Ga0068862_100098727 3300005844 Bacteria 2551
184 Ga0068862_100100081 3300005844 Bacteria 2535
185 Ga0068862_100179790 3300005844 Bacteria 1898
186 Ga0068862_100279362 3300005844 Bacteria 1530
187 Ga0068862_100314478 3300005844 Bacteria 1444
188 Ga0068862_100594747 3300005844 Bacteria 1061
189 Ga0068862_100812181 3300005844 Bacteria 914
190 Ga0070717_10005724 3300006028 Bacteria 9090
191 Ga0075364_10561627 3300006051 Bacteria 780
192 Ga0075366_10153525 3300006195 Bacteria 1395
193 Ga0097621_100042283 3300006237 Bacteria 3670
194 Ga0097621_100139323 3300006237 Bacteria 2072
195 Ga0097621_100141616 3300006237 Bacteria 2055
196 Ga0068871_100034420 3300006358 Bacteria 4020
197 Ga0068871_100063103 3300006358 Bacteria 3029
198 Ga0068871_100071453 3300006358 Bacteria 2854
199 Ga0068871_100080476 3300006358 Bacteria 2697
200 Ga0068871_100130729 3300006358 Bacteria 2129
201 Ga0068871_100290290 3300006358 Bacteria 1433
202 Ga0075428_100345362 3300006844 Bacteria 1598
203 Ga0075433_10044294 3300006852 Bacteria 3866
204 Ga0075434_100438925 3300006871 Bacteria 1327
205 Ga0075434_101201427 3300006871 Bacteria 770
206 Ga0068865_100000790 3300006881 Bacteria 17803
207 Ga0068865_100014327 3300006881 Bacteria 5037
208 Ga0068865_100022889 3300006881 Bacteria 4084
209 Ga0068865_100034047 3300006881 Bacteria 3415
210 Ga0097620_100000281 3300006931 Bacteria 50775
211 Ga0097620_100002867 3300006931 Bacteria 17497
212 Ga0097620_100053252 3300006931 Bacteria 4069
213 Ga0097620_100154153 3300006931 Bacteria 2374
214 Ga0105250_10066051 3300009092 Bacteria 1458
215 Ga0105240_10385779 3300009093 Bacteria 1581
216 Ga0105245_10000433 3300009098 Bacteria 38731
217 Ga0105245_10038057 3300009098 Bacteria 4278
218 Ga0105245_10235082 3300009098 Bacteria 1774
219 Ga0105245_10271296 3300009098 Bacteria 1655
220 Ga0105243_10006071 3300009148 Bacteria 9339
221 Ga0105243_10460567 3300009148 Bacteria 1195
222 Ga0105241_10005737 3300009174 Bacteria 9168
223 Ga0105242_10902822 3300009176 Bacteria 884
224 Ga0105248_10000070 3300009177 Bacteria 119985
225 Ga0105248_10000313 3300009177 Bacteria 57777
226 Ga0105248_10005539 3300009177 Bacteria 13870
227 Ga0105248_10009267 3300009177 Bacteria 10835
228 Ga0105248_10238459 3300009177 Bacteria 2047
229 Ga0105248_10682638 3300009177 Bacteria 1159
230 Ga0105237_10781247 3300009545 Bacteria 962
231 Ga0105249_10013031 3300009553 Bacteria 7338
232 Ga0105249_10017740 3300009553 Bacteria 6322
233 Ga0105239_10312437 3300010375 Bacteria 1771
234 Ga0105246_10002636 3300011119 Bacteria 10863
235 Ga0105246_10038764 3300011119 Bacteria 3206
236 Ga0105246_10220019 3300011119 Bacteria 1488
237 Ga0157373_10001179 3300013100 Bacteria 19984
238 Ga0157373_10062684 3300013100 Bacteria 2633
239 Ga0157371_10001574 3300013102 Bacteria 23422
240 Ga0157371_10025043 3300013102 Bacteria 4354
241 Ga0157371_10104949 3300013102 Bacteria 2005
242 Ga0157371_10147185 3300013102 Bacteria 1679
243 Ga0157370_10084410 3300013104 Bacteria 2985
244 Ga0157369_10151471 3300013105 Bacteria 2451
245 Ga0157369_10261513 3300013105 Bacteria 1805
246 Ga0157374_10192412 3300013296 Bacteria 1995
247 Ga0157374_10481726 3300013296 Bacteria 1244
248 Ga0157378_10004425 3300013297 Bacteria 12364
249 Ga0157378_10238202 3300013297 Bacteria 1737
250 Ga0163162_10008879 3300013306 Bacteria 9774
251 Ga0163162_10016027 3300013306 Bacteria 7325
252 Ga0163162_10020341 3300013306 Bacteria 6520
253 Ga0163162_10642676 3300013306 Bacteria 1185
254 Ga0157375_10005855 3300013308 Bacteria 10699
255 Ga0157375_10008102 3300013308 Bacteria 9194
256 Ga0157375_10095200 3300013308 Bacteria 3048
257 Ga0157375_11115767 3300013308 Bacteria 924
258 Ga0157375_11139341 3300013308 Bacteria 914
259 Ga0163163_10000135 3300014325 Bacteria 75904
260 Ga0163163_10010877 3300014325 Bacteria 8219
261 Ga0163163_10029586 3300014325 Bacteria 5271
262 Ga0163163_10186969 3300014325 Bacteria 2119
263 Ga0163163_10189189 3300014325 Bacteria 2107
264 Ga0157380_10316674 3300014326 Bacteria 1445
265 Ga0182008_10192183 3300014497 Bacteria 1036
266 Ga0157379_10033815 3300014968 Bacteria 4559
267 Ga0157379_10080896 3300014968 Bacteria 2910
268 Ga0157376_10068909 3300014969 Bacteria 2997
269 Ga0206354_11656559 3300020081 Bacteria 2013
270 Ga0206353_10613120 3300020082 Bacteria 9187
271 Ga0213876_10048732 3300021384 Bacteria 2238
272 Ga0207697_10000157 3300025315 Bacteria 33854
273 Ga0207697_10027085 3300025315 Bacteria 2344
274 Ga0207696_1047510 3300025711 Bacteria 1236
275 Ga0207682_10000868 3300025893 Bacteria 14041
276 Ga0207682_10028209 3300025893 Bacteria 2240
277 Ga0207688_10000953 3300025901 Bacteria 14689
278 Ga0207688_10005358 3300025901 Bacteria 6964
279 Ga0207680_10001970 3300025903 Bacteria 9613
280 Ga0207680_10009968 3300025903 Bacteria 4734
281 Ga0207680_10044837 3300025903 Bacteria 2604
282 Ga0207680_10046147 3300025903 Bacteria 2574
283 Ga0207680_10162167 3300025903 Bacteria 1500
284 Ga0207647_10000047 3300025904 Bacteria 89112
285 Ga0207647_10005300 3300025904 Bacteria 9478
286 Ga0207647_10013156 3300025904 Bacteria 5749
287 Ga0207647_10017602 3300025904 Bacteria 4856
288 Ga0207647_10019838 3300025904 Bacteria 4515
289 Ga0207647_10055973 3300025904 Bacteria 2421
290 Ga0207645_10008285 3300025907 Bacteria 7264
291 Ga0207645_10015768 3300025907 Bacteria 5011
292 Ga0207645_10019269 3300025907 Bacteria 4475
293 Ga0207643_10013980 3300025908 Bacteria 4354
294 Ga0207705_10012007 3300025909 Bacteria 6259
295 Ga0207705_10425824 3300025909 Bacteria 1028
296 Ga0207695_10441041 3300025913 Bacteria 1185
297 Ga0207671_10448916 3300025914 Bacteria 1027
298 Ga0207660_10024638 3300025917 Bacteria 4075
299 Ga0207657_10000826 3300025919 Bacteria 32744
300 Ga0207657_10002279 3300025919 Bacteria 20800
301 Ga0207657_10004171 3300025919 Bacteria 15315
302 Ga0207657_10010150 3300025919 Bacteria 9412
303 Ga0207657_10265072 3300025919 Bacteria 1366
304 Ga0207657_10320804 3300025919 Bacteria 1225
305 Ga0207649_10000106 3300025920 Bacteria 69452
306 Ga0207649_10039805 3300025920 Bacteria 2852
307 Ga0207649_10048199 3300025920 Bacteria 2627
308 Ga0207649_10121972 3300025920 Bacteria 1758
309 Ga0207652_10099086 3300025921 Bacteria 2571
310 Ga0207681_10010855 3300025923 Bacteria 5596
311 Ga0207681_10029122 3300025923 Bacteria 3582
312 Ga0207681_10044180 3300025923 Bacteria 2986
313 Ga0207681_10046258 3300025923 Bacteria 2926
314 Ga0207681_10056807 3300025923 Bacteria 2671
315 Ga0207650_10005773 3300025925 Bacteria 8446
316 Ga0207650_10008191 3300025925 Bacteria 7131
317 Ga0207650_10196951 3300025925 Bacteria 1612
318 Ga0207650_10217294 3300025925 Bacteria 1537
319 Ga0207687_10001801 3300025927 Bacteria 14760
320 Ga0207687_10016532 3300025927 Bacteria 4846
321 Ga0207687_10280457 3300025927 Bacteria 1335
322 Ga0207687_10433536 3300025927 Bacteria 1087
323 Ga0207664_10164585 3300025929 Bacteria 1894
324 Ga0207644_10000430 3300025931 Bacteria 27277
325 Ga0207644_10009928 3300025931 Bacteria 6262
326 Ga0207644_10013850 3300025931 Bacteria 5387
327 Ga0207644_10016242 3300025931 Bacteria 5008
328 Ga0207644_10059434 3300025931 Bacteria 2765
329 Ga0207644_10120577 3300025931 Bacteria 1996
330 Ga0207644_10124255 3300025931 Bacteria 1968
331 Ga0207644_10134607 3300025931 Bacteria 1896
332 Ga0207644_10237358 3300025931 Bacteria 1450
333 Ga0207690_10000018 3300025932 Bacteria 238992
334 Ga0207690_10000680 3300025932 Bacteria 21791
335 Ga0207690_10004003 3300025932 Bacteria 8701
336 Ga0207690_10009628 3300025932 Bacteria 5735
337 Ga0207690_10039377 3300025932 Bacteria 3083
338 Ga0207690_10103221 3300025932 Bacteria 2040
339 Ga0207690_10125217 3300025932 Bacteria 1873
340 Ga0207690_10440760 3300025932 Bacteria 1045
341 Ga0207690_10575927 3300025932 Bacteria 917
342 Ga0207706_10000103 3300025933 Bacteria 89756
343 Ga0207706_10007263 3300025933 Bacteria 10243
344 Ga0207706_10014063 3300025933 Bacteria 7257
345 Ga0207706_10020563 3300025933 Bacteria 5933
346 Ga0207706_10176322 3300025933 Bacteria 1878
347 Ga0207709_10172835 3300025935 Bacteria 1518
348 Ga0207669_10026972 3300025937 Bacteria 3135
349 Ga0207669_10062133 3300025937 Bacteria 2299
350 Ga0207704_10005465 3300025938 Bacteria 5859
351 Ga0207704_10171611 3300025938 Bacteria 1556
352 Ga0207704_10252344 3300025938 Bacteria 1325
353 Ga0207691_10000586 3300025940 Bacteria 36317
354 Ga0207691_10000820 3300025940 Bacteria 30962
355 Ga0207691_10002012 3300025940 Bacteria 19906
356 Ga0207691_10025895 3300025940 Bacteria 5505
357 Ga0207691_10034401 3300025940 Bacteria 4711
358 Ga0207711_10000051 3300025941 Bacteria 140854
359 Ga0207711_10000786 3300025941 Bacteria 31183
360 Ga0207711_10003725 3300025941 Bacteria 13141
361 Ga0207711_10010481 3300025941 Bacteria 7697
362 Ga0207711_10012435 3300025941 Bacteria 7075
363 Ga0207711_10023551 3300025941 Bacteria 5154
364 Ga0207711_10061076 3300025941 Bacteria 3249
365 Ga0207689_10000242 3300025942 Bacteria 48659
366 Ga0207689_10021746 3300025942 Bacteria 5394
367 Ga0207689_10119583 3300025942 Bacteria 2167
368 Ga0207689_10221637 3300025942 Bacteria 1563
369 Ga0207679_10009996 3300025945 Bacteria 6096
370 Ga0207679_10010875 3300025945 Bacteria 5868
371 Ga0207667_10002726 3300025949 Bacteria 21834
372 Ga0207667_10199688 3300025949 Bacteria 2052
373 Ga0207651_10003302 3300025960 Bacteria 7902
374 Ga0207651_10005417 3300025960 Bacteria 6544
375 Ga0207651_10023724 3300025960 Bacteria 3780
376 Ga0207651_10048471 3300025960 Bacteria 2872
377 Ga0207651_10053312 3300025960 Bacteria 2764
378 Ga0207651_10137881 3300025960 Bacteria 1879
379 Ga0207651_10437559 3300025960 Bacteria 1119
380 Ga0207712_10021473 3300025961 Bacteria 4239
381 Ga0207712_10072261 3300025961 Bacteria 2484
382 Ga0207712_10124175 3300025961 Bacteria 1957
383 Ga0207668_10000129 3300025972 Bacteria 53619
384 Ga0207668_10034881 3300025972 Bacteria 3345
385 Ga0207668_10641403 3300025972 Bacteria 929
386 Ga0207640_10000173 3300025981 Bacteria 46801
387 Ga0207640_10118927 3300025981 Bacteria 1888
388 Ga0207658_10005059 3300025986 Bacteria 9073
389 Ga0207658_10009223 3300025986 Bacteria 6688
390 Ga0207658_10011114 3300025986 Bacteria 6132
391 Ga0207658_10012646 3300025986 Bacteria 5764
392 Ga0207658_10021888 3300025986 Bacteria 4444
393 Ga0207658_10046760 3300025986 Bacteria 3162
394 Ga0207658_10080763 3300025986 Bacteria 2491
395 Ga0207658_10099147 3300025986 Bacteria 2278
396 Ga0207658_10154902 3300025986 Bacteria 1871
397 Ga0207658_10187294 3300025986 Bacteria 1717
398 Ga0207658_10211534 3300025986 Bacteria 1625
399 Ga0207677_10000024 3300026023 Bacteria 127407
400 Ga0207677_10001214 3300026023 Bacteria 13926
401 Ga0207677_10012867 3300026023 Bacteria 4830
402 Ga0207677_10028779 3300026023 Bacteria 3521
403 Ga0207677_10082565 3300026023 Bacteria 2310
404 Ga0207677_10347844 3300026023 Bacteria 1241
405 Ga0207703_10002851 3300026035 Bacteria 14738
406 Ga0207703_10003929 3300026035 Bacteria 12332
407 Ga0207703_10033345 3300026035 Bacteria 4081
408 Ga0207703_10103194 3300026035 Bacteria 2420
409 Ga0207639_10004852 3300026041 Bacteria 9066
410 Ga0207639_10279592 3300026041 Bacteria 1467
411 Ga0207678_10002108 3300026067 Bacteria 18018
412 Ga0207678_10010779 3300026067 Bacteria 8031
413 Ga0207702_10011532 3300026078 Bacteria 7364
414 Ga0207702_10093777 3300026078 Bacteria 2633
415 Ga0207702_10298494 3300026078 Bacteria 1528
416 Ga0207641_10000190 3300026088 Bacteria 84715
417 Ga0207641_10004167 3300026088 Bacteria 12599
418 Ga0207641_10013267 3300026088 Bacteria 6759
419 Ga0207641_10014286 3300026088 Bacteria 6507
420 Ga0207641_10120859 3300026088 Bacteria 2337
421 Ga0207641_10168229 3300026088 Bacteria 1998
422 Ga0207641_10228493 3300026088 Bacteria 1728
423 Ga0207648_10000838 3300026089 Bacteria 34648
424 Ga0207648_10025249 3300026089 Bacteria 5294
425 Ga0207648_10036826 3300026089 Bacteria 4310
426 Ga0207676_10001202 3300026095 Bacteria 19413
427 Ga0207676_10002035 3300026095 Bacteria 14696
428 Ga0207676_10012153 3300026095 Bacteria 6163
429 Ga0207676_10114584 3300026095 Bacteria 2261
430 Ga0207676_10227925 3300026095 Bacteria 1664
431 Ga0207674_10000060 3300026116 Bacteria 112806
432 Ga0207674_10000308 3300026116 Bacteria 62120
433 Ga0207674_10010304 3300026116 Bacteria 10601
434 Ga0207674_10024788 3300026116 Bacteria 6403
435 Ga0207675_100072458 3300026118 Bacteria 3222
436 Ga0207683_10001795 3300026121 Bacteria 18993
437 Ga0207683_10002607 3300026121 Bacteria 15741
438 Ga0207698_10000760 3300026142 Bacteria 18747
439 Ga0209982_1013038 3300027552 Bacteria 1250
440 Ga0209983_1006277 3300027665 Bacteria 2448
441 Ga0209974_10001653 3300027876 Bacteria 8065
442 Ga0268266_10067429 3300028379 Bacteria 3097
443 Ga0268266_10152229 3300028379 Bacteria 2086
444 Ga0268266_10355792 3300028379 Bacteria 1377
445 Ga0268266_10740388 3300028379 Bacteria 948
446 Ga0268265_10004496 3300028380 Bacteria 9649
447 Ga0268265_10109706 3300028380 Bacteria 2250
448 Ga0268265_10127451 3300028380 Bacteria 2109
449 Ga0268265_10142184 3300028380 Bacteria 2010
450 Ga0268265_10158802 3300028380 Bacteria 1917
451 Ga0268265_10193889 3300028380 Bacteria 1757
452 Ga0268265_10450939 3300028380 Bacteria 1201
453 Ga0268265_11098671 3300028380 Bacteria 789
454 Ga0268264_10000778 3300028381 Bacteria 35132
455 Ga0268264_10006123 3300028381 Bacteria 10163
456 Ga0268264_10007677 3300028381 Bacteria 8991
457 Ga0268264_10014717 3300028381 Bacteria 6428
458 Ga0268264_10020183 3300028381 Bacteria 5446
459 Ga0268264_10023546 3300028381 Bacteria 5021
460 Ga0268264_10076258 3300028381 Bacteria 2852
461 Ga0268264_10153210 3300028381 Bacteria 2069
462 Ga0307515_10050956 3300028794 Bacteria 6185
463 Ga0265338_10019635 3300028800 Bacteria 7154
464 Ga0307513_10365243 3300031456 Bacteria 1187
465 Ga0307408_100058588 3300031548 Bacteria 2800
466 Ga0307408_100106372 3300031548 Bacteria 2146
467 Ga0307408_100114656 3300031548 Bacteria 2077
468 Ga0307408_100182910 3300031548 Bacteria 1682
469 Ga0307408_100217852 3300031548 Bacteria 1556
470 Ga0307408_100547473 3300031548 Bacteria 1021
471 Ga0307405_10002056 3300031731 Bacteria 8749
472 Ga0307405_10015446 3300031731 Bacteria 4137
473 Ga0307405_10084367 3300031731 Bacteria 2085
474 Ga0307405_10118504 3300031731 Bacteria 1807
475 Ga0307413_10004731 3300031824 Bacteria 5976
476 Ga0307413_10030161 3300031824 Bacteria 3043
477 Ga0307413_10038109 3300031824 Bacteria 2783
478 Ga0307413_10052167 3300031824 Bacteria 2468
479 Ga0307410_10021686 3300031852 Bacteria 3954
480 Ga0307410_10022287 3300031852 Bacteria 3912
481 Ga0307410_10041309 3300031852 Bacteria 3040
482 Ga0307410_10061229 3300031852 Bacteria 2575
483 Ga0307410_10145169 3300031852 Bacteria 1760
484 Ga0307410_10153818 3300031852 Bacteria 1715
485 Ga0307410_10280381 3300031852 Bacteria 1307
486 Ga0307410_10310129 3300031852 Bacteria 1248
487 Ga0307410_10313986 3300031852 Bacteria 1241
488 Ga0307410_10625523 3300031852 Bacteria 900
489 Ga0307406_10000566 3300031901 Bacteria 21309
490 Ga0307406_10054163 3300031901 Bacteria 2559
491 Ga0307406_10296031 3300031901 Bacteria 1241
492 Ga0307406_10440932 3300031901 Bacteria 1042
493 Ga0307406_10614553 3300031901 Bacteria 898
494 Ga0307407_10004272 3300031903 Bacteria 6031
495 Ga0307407_10009087 3300031903 Bacteria 4609
496 Ga0307407_10014927 3300031903 Bacteria 3820
497 Ga0307407_10042917 3300031903 Bacteria 2539
498 Ga0307407_10045237 3300031903 Bacteria 2486
499 Ga0307407_10241749 3300031903 Bacteria 1232
500 Ga0307412_10001240 3300031911 Bacteria 14426
501 Ga0307412_10042782 3300031911 Bacteria 2946
502 Ga0307412_10046032 3300031911 Bacteria 2856
503 Ga0307412_10130272 3300031911 Bacteria 1826
504 Ga0307409_100003788 3300031995 Bacteria 8326
505 Ga0307409_100008505 3300031995 Bacteria 6235
506 Ga0307409_100011473 3300031995 Bacteria 5591
507 Ga0307409_100020648 3300031995 Bacteria 4494
508 Ga0307409_100115558 3300031995 Bacteria 2260
509 Ga0307409_100140688 3300031995 Bacteria 2079
510 Ga0307409_100214113 3300031995 Bacteria 1734
511 Ga0307409_100249011 3300031995 Bacteria 1623
512 Ga0307409_100435591 3300031995 Bacteria 1261
513 Ga0307409_100553029 3300031995 Bacteria 1130
514 Ga0307409_100580177 3300031995 Bacteria 1105
515 Ga0307416_100001154 3300032002 Bacteria 14190
516 Ga0307416_100042481 3300032002 Bacteria 3549
517 Ga0307416_100102541 3300032002 Bacteria 2495
518 Ga0307416_100824649 3300032002 Bacteria 1024
519 Ga0307414_10000897 3300032004 Bacteria 15247
520 Ga0307414_10027386 3300032004 Bacteria 3683
521 Ga0307414_10055807 3300032004 Bacteria 2767
522 Ga0307414_10084865 3300032004 Bacteria 2331
523 Ga0307414_10230293 3300032004 Bacteria 1527
524 Ga0307411_10000460 3300032005 Bacteria 14059
525 Ga0307411_10006896 3300032005 Bacteria 5726
526 Ga0307411_10016408 3300032005 Bacteria 4191
527 Ga0307411_10023919 3300032005 Bacteria 3630
528 Ga0307411_10181276 3300032005 Bacteria 1599
529 Ga0307411_10292240 3300032005 Bacteria 1303
530 Ga0307411_10334707 3300032005 Bacteria 1228
531 Ga0307415_100005203 3300032126 Bacteria 6873
532 Ga0307415_100384153 3300032126 Bacteria 1193
533 Ga0373931_0179240 3300035691 Bacteria 1254
534 Ga0395899_0000104 3300037312 Bacteria 147238
535 Ga0395899_0005097 3300037312 Bacteria 10226
536 Ga0395899_0042658 3300037312 Bacteria 3386
537 Ga0395899_0085524 3300037312 Bacteria 2291
538 Ga0395899_0093741 3300037312 Bacteria 2173
539 Ga0395899_0095481 3300037312 Bacteria 2151
540 Ga0395900_0000161 3300037418 Bacteria 110637
541 Ga0395900_0011557 3300037418 Bacteria 9034
542 Ga0395900_0017797 3300037418 Bacteria 7255
543 Ga0395900_0116289 3300037418 Bacteria 2744
544 Ga0395900_0186397 3300037418 Bacteria 2106
545 Ga0395900_0266951 3300037418 Bacteria 1707
546 Ga0395900_0289170 3300037418 Bacteria 1628
547 Ga0395900_0296420 3300037418 Bacteria 1604
548 Ga0395900_0565394 3300037418 Bacteria 1080
549 Ga0395898_0000169 3300037466 Bacteria 168667
550 Ga0395898_0004993 3300037466 Bacteria 14389
551 Ga0395898_0005963 3300037466 Bacteria 13081
552 Ga0395898_0048325 3300037466 Bacteria 4173
553 Ga0395898_0126782 3300037466 Bacteria 2445
554 Ga0395905_0000120 3300037471 Bacteria 130865
555 Ga0395905_0001020 3300037471 Bacteria 35732
556 Ga0395905_0003861 3300037471 Bacteria 15809
557 Ga0395905_0005327 3300037471 Bacteria 13147
558 Ga0395905_0047771 3300037471 Bacteria 4010
559 Ga0395905_0092554 3300037471 Bacteria 2835
560 Ga0395905_0112519 3300037471 Bacteria 2557
561 Ga0395905_0114472 3300037471 Bacteria 2534
562 Ga0395905_0214578 3300037471 Bacteria 1802
563 Ga0395905_0337339 3300037471 Bacteria 1398
564 Ga0395905_0347737 3300037471 Bacteria 1374
565 Ga0395905_0561714 3300037471 Bacteria 1042
566 Ga0395905_0779903 3300037471 Bacteria 859
567 Ga0395905_0805503 3300037471 Bacteria 842
568 Ga0395901_0000871 3300038443 Bacteria 33284
569 Ga0395901_0024999 3300038443 Bacteria 6129
570 Ga0395901_0060625 3300038443 Bacteria 3937
571 Ga0395901_0075162 3300038443 Bacteria 3524
572 Ga0395901_0085407 3300038443 Bacteria 3299
573 Ga0395901_0333334 3300038443 Bacteria 1568
574 Ga0395901_0590069 3300038443 Bacteria 1121
575 Ga0436365_1289842 3300039437 Bacteria 27584
576 Ga0436365_1495235 3300039437 Bacteria 1389
577 Ga0436365_1822759 3300039437 Bacteria 842
578 Ga0436362_1265242 3300039453 Bacteria 2318
579 Ga0439465_0027895 3300041413 Bacteria 1789
580 Ga0439445_0001414 3300042004 Bacteria 5219
581 Ga0439432_097258 3300042006 Bacteria 882
582 Ga0439449_0022256 3300042007 Bacteria 2372
583 Ga0450890_032407 3300042127 Bacteria 748
584 Ga0439458_0008867 3300042157 Bacteria 2244
585 Ga0439464_0000949 3300042439 Bacteria 6545
586 Ga0495663_0032603 3300046525 Bacteria 1552
587 Ga0495668_0006091 3300046616 Bacteria 7985
588 Ga0495668_0029130 3300046616 Bacteria 3121
589 Ga0495659_0168724 3300046664 Bacteria 887
590 Ga0495669_0062480 3300046684 Bacteria 1687
591 Ga0495669_0063024 3300046684 Bacteria 1681
592 Ga0495670_0044839 3300046691 Bacteria 2208
593 Ga0496100_0090357 3300048903 Bacteria 2088
594 Ga0496102_0029295 3300048905 Bacteria 4926
595 Ga0496103_0042439 3300048906 Bacteria 2799
596 Ga0496103_0067015 3300048906 Bacteria 2241
597 Ga0496104_0099237 3300048907 Bacteria 2788
598 Ga0496105_0217630 3300048908 Bacteria 1555
599 Ga0496106_0050336 3300048909 Bacteria 3140
600 Ga0496106_0103744 3300048909 Bacteria 2207
601 Ga0496107_0017661 3300048910 Bacteria 5018
602 Ga0496107_0047190 3300048910 Bacteria 3102
603 Ga0496107_0072953 3300048910 Bacteria 2496
604 Ga0496107_0336404 3300048910 Bacteria 1123
605 Ga0496108_0000614 3300048911 Bacteria 27954
606 Ga0496108_0001766 3300048911 Bacteria 17208
607 Ga0496108_0007343 3300048911 Bacteria 8931
608 Ga0496108_0021253 3300048911 Bacteria 5333
609 Ga0496108_0120245 3300048911 Bacteria 2252
610 Ga0496109_0024669 3300048912 Bacteria 5348
611 Ga0496109_0033263 3300048912 Bacteria 4638
612 Ga0496109_0424125 3300048912 Bacteria 1256
613 Ga0496110_0065465 3300048913 Bacteria 3213
614 Ga0496110_0106391 3300048913 Bacteria 2517
615 Ga0496111_0003461 3300048914 Bacteria 9767
616 Ga0496111_0004079 3300048914 Bacteria 9171
617 Ga0496111_0008366 3300048914 Bacteria 6841
618 Ga0496112_0007277 3300048915 Bacteria 9809
619 Ga0496112_0053098 3300048915 Bacteria 3979
620 Ga0496112_0068996 3300048915 Bacteria 3492
621 Ga0496113_0031264 3300048916 Bacteria 3862
622 Ga0496113_0160255 3300048916 Bacteria 1778
623 Ga0496113_0164476 3300048916 Bacteria 1755
624 Ga0496114_0038235 3300048917 Bacteria 3970
625 Ga0501223_047246 3300049663 Bacteria 835
626 Ga0501282_010539 3300049778 Bacteria 993
627 nmdc:mga07m45_308020_c1 3300050496 Bacteria 921
628 nmdc:mga05p37_400134_c1 3300050507 Bacteria 1603
629 nmdc:mga08y16_759230_c1 3300050511 Bacteria 965
630 nmdc:mga0n895_310749_c1 3300050512 Bacteria 1597
631 nmdc:mga0a205_402888_c1 3300050515 Bacteria 1232
632 Ga0495655_0035272 3300053083 Bacteria 1243
633 Ga0500658_0000022 3300053134 Bacteria 129341
634 Ga0500568_0000992 3300053139 Bacteria 19446
635 Ga0500616_0000080 3300053153 Bacteria 200381
636 Ga0500587_000543 3300053739 Bacteria 4635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032005 Ga0307411_10181276 Ga0307411_101812762 181
2 3300005345 Ga0070692_10006102 Ga0070692_100061024 192
3 3300006358 Ga0068871_100290290 Ga0068871_1002902902 192
4 3300031548 Ga0307408_100106372 Ga0307408_1001063724 195
5 3300039453 Ga0436362_1265242 Ga0436362_1265242_130_846 196
6 3300005539 Ga0068853_100776232 Ga0068853_1007762322 198
7 3300005844 Ga0068862_100812181 Ga0068862_1008121812 198
8 3300005844 Ga0068862_100314478 Ga0068862_1003144782 200
9 3300028800 Ga0265338_10019635 Ga0265338_100196353 200
10 3300005333 Ga0070677_10000855 Ga0070677_100008556 201
11 3300025893 Ga0207682_10000868 Ga0207682_100008684 201
12 3300032002 Ga0307416_100824649 Ga0307416_1008246492 201
13 3300048903 Ga0496100_0090357 Ga0496100_0090357_176_883 201
14 3300053739 Ga0500587_000543 Ga0500587_000543_1654_2343 201
15 3300025927 Ga0207687_10433536 Ga0207687_104335361 203
16 3300025932 Ga0207690_10004003 Ga0207690_100040036 204
17 3300028794 Ga0307515_10050956 Ga0307515_100509562 205
18 3300005366 Ga0070659_100026352 Ga0070659_1000263523 208
19 3300037312 Ga0395899_0093741 Ga0395899_0093741_42_710 208
20 3300046684 Ga0495669_0063024 Ga0495669_0063024_50_691 209
21 3300048911 Ga0496108_0120245 Ga0496108_0120245_1475_2119 211
22 3300037471 Ga0395905_0112519 Ga0395905_0112519_1026_1664 212
23 3300037471 Ga0395905_0337339 Ga0395905_0337339_365_1003 212
24 3300038443 Ga0395901_0333334 Ga0395901_0333334_194_832 212
25 3300031731 Ga0307405_10084367 Ga0307405_100843672 214
26 3300031731 Ga0307405_10118504 Ga0307405_101185042 214
27 3300031824 Ga0307413_10004731 Ga0307413_100047316 214
28 3300031852 Ga0307410_10145169 Ga0307410_101451691 214
29 3300031903 Ga0307407_10045237 Ga0307407_100452373 214
30 3300031995 Ga0307409_100008505 Ga0307409_1000085057 214
31 3300032004 Ga0307414_10084865 Ga0307414_100848652 214
32 3300032004 Ga0307414_10230293 Ga0307414_102302931 214
33 3300032126 Ga0307415_100384153 Ga0307415_1003841531 214
34 3300053139 Ga0500568_0000992 Ga0500568_0000992_17624_18277 214
35 3300053153 Ga0500616_0000080 Ga0500616_0000080_117744_118397 214
36 3300026088 Ga0207641_10014286 Ga0207641_100142869 215
37 3300037418 Ga0395900_0565394 Ga0395900_0565394_151_801 215
38 3300037471 Ga0395905_0092554 Ga0395905_0092554_785_1435 215
39 3300025932 Ga0207690_10000680 Ga0207690_1000068025 216
40 3300037471 Ga0395905_0047771 Ga0395905_0047771_1792_2451 216
41 3300048911 Ga0496108_0021253 Ga0496108_0021253_4456_5115 216
42 iso_pu_bacteria 2896429255 2896429385 216
43 3300005339 Ga0070660_100196818 Ga0070660_1001968182 218
44 3300005355 Ga0070671_100053070 Ga0070671_1000530702 218
45 3300005355 Ga0070671_100075399 Ga0070671_1000753992 218
46 3300005457 Ga0070662_100209927 Ga0070662_1002099272 218
47 3300005543 Ga0070672_100113250 Ga0070672_1001132502 218
48 3300005841 Ga0068863_100053105 Ga0068863_1000531056 218
49 3300005842 Ga0068858_100078599 Ga0068858_1000785993 218
50 3300009177 Ga0105248_10238459 Ga0105248_102384591 218
51 3300009545 Ga0105237_10781247 Ga0105237_107812472 218
52 3300013100 Ga0157373_10062684 Ga0157373_100626844 218
53 3300013296 Ga0157374_10481726 Ga0157374_104817262 218
54 3300014325 Ga0163163_10186969 Ga0163163_101869692 218
55 3300014497 Ga0182008_10192183 Ga0182008_101921831 218
56 3300014968 Ga0157379_10033815 Ga0157379_100338155 218
57 3300025919 Ga0207657_10320804 Ga0207657_103208042 218
58 3300025931 Ga0207644_10013850 Ga0207644_100138501 218
59 3300025931 Ga0207644_10124255 Ga0207644_101242554 218
60 3300025941 Ga0207711_10061076 Ga0207711_100610761 218
61 3300025986 Ga0207658_10012646 Ga0207658_100126464 218
62 3300025986 Ga0207658_10099147 Ga0207658_100991474 218
63 3300026078 Ga0207702_10011532 Ga0207702_100115324 218
64 3300026116 Ga0207674_10000060 Ga0207674_1000006059 218
65 3300028380 Ga0268265_10450939 Ga0268265_104509392 218
66 3300028381 Ga0268264_10153210 Ga0268264_101532103 218
67 3300037418 Ga0395900_0186397 Ga0395900_0186397_745_1416 218
68 3300037471 Ga0395905_0347737 Ga0395905_0347737_324_995 218
69 3300046691 Ga0495670_0044839 Ga0495670_0044839_1258_1917 218
70 3300048905 Ga0496102_0029295 Ga0496102_0029295_3488_4159 218
71 3300048906 Ga0496103_0067015 Ga0496103_0067015_168_839 218
72 3300048910 Ga0496107_0072953 Ga0496107_0072953_1660_2331 218
73 3300048910 Ga0496107_0336404 Ga0496107_0336404_373_1041 218
74 3300048912 Ga0496109_0424125 Ga0496109_0424125_277_948 218
75 3300048914 Ga0496111_0004079 Ga0496111_0004079_4750_5421 218
76 3300048916 Ga0496113_0160255 Ga0496113_0160255_989_1660 218
77 3300039437 Ga0436365_1822759 Ga0436365_1822759_42_707 219
78 3300005331 Ga0070670_100173451 Ga0070670_1001734513 220
79 3300005337 Ga0070682_100041381 Ga0070682_1000413814 220
80 3300005338 Ga0068868_100000001 Ga0068868_100000001207 220
81 3300005339 Ga0070660_100005221 Ga0070660_1000052211 220
82 3300005340 Ga0070689_100119824 Ga0070689_1001198242 220
83 3300005344 Ga0070661_100202856 Ga0070661_1002028562 220
84 3300005347 Ga0070668_100426672 Ga0070668_1004266722 220
85 3300005353 Ga0070669_100516246 Ga0070669_1005162461 220
86 3300005366 Ga0070659_100000001 Ga0070659_100000001147 220
87 3300005455 Ga0070663_100020557 Ga0070663_1000205578 220
88 3300005458 Ga0070681_10313781 Ga0070681_103137812 220
89 3300005564 Ga0070664_100044291 Ga0070664_1000442911 220
90 3300005577 Ga0068857_100004703 Ga0068857_10000470313 220
91 3300005617 Ga0068859_100053252 Ga0068859_1000532524 220
92 3300005618 Ga0068864_100012776 Ga0068864_1000127763 220
93 3300005842 Ga0068858_100007088 Ga0068858_10000708810 220
94 3300005844 Ga0068862_100594747 Ga0068862_1005947471 220
95 3300006931 Ga0097620_100053252 Ga0097620_1000532522 220
96 3300009177 Ga0105248_10682638 Ga0105248_106826382 220
97 3300009553 Ga0105249_10017740 Ga0105249_100177403 220
98 3300011119 Ga0105246_10220019 Ga0105246_102200192 220
99 3300014325 Ga0163163_10189189 Ga0163163_101891893 220
100 3300025919 Ga0207657_10004171 Ga0207657_1000417118 220
101 3300025923 Ga0207681_10044180 Ga0207681_100441802 220
102 3300025927 Ga0207687_10280457 Ga0207687_102804572 220
103 3300025932 Ga0207690_10000018 Ga0207690_10000018118 220
104 3300025932 Ga0207690_10575927 Ga0207690_105759272 220
105 3300025942 Ga0207689_10021746 Ga0207689_100217463 220
106 3300025945 Ga0207679_10010875 Ga0207679_1001087512 220
107 3300025961 Ga0207712_10072261 Ga0207712_100722613 220
108 3300026023 Ga0207677_10000024 Ga0207677_10000024125 220
109 3300026035 Ga0207703_10103194 Ga0207703_101031942 220
110 3300026067 Ga0207678_10010779 Ga0207678_100107793 220
111 3300026088 Ga0207641_10168229 Ga0207641_101682293 220
112 3300026095 Ga0207676_10012153 Ga0207676_1001215312 220
113 3300026116 Ga0207674_10010304 Ga0207674_100103046 220
114 3300028380 Ga0268265_11098671 Ga0268265_110986712 220
115 3300028381 Ga0268264_10014717 Ga0268264_100147179 220
116 3300031824 Ga0307413_10038109 Ga0307413_100381095 220
117 3300031901 Ga0307406_10440932 Ga0307406_104409321 220
118 3300031903 Ga0307407_10014927 Ga0307407_100149275 220
119 3300031995 Ga0307409_100115558 Ga0307409_1001155582 220
120 3300037312 Ga0395899_0095481 Ga0395899_0095481_1311_1982 220
121 3300037418 Ga0395900_0017797 Ga0395900_0017797_5461_6132 220
122 3300037418 Ga0395900_0266951 Ga0395900_0266951_938_1600 220
123 3300037418 Ga0395900_0289170 Ga0395900_0289170_414_1085 220
124 3300037466 Ga0395898_0126782 Ga0395898_0126782_722_1384 220
125 3300037471 Ga0395905_0005327 Ga0395905_0005327_10300_10971 220
126 3300037471 Ga0395905_0805503 Ga0395905_0805503_131_802 220
127 3300038443 Ga0395901_0060625 Ga0395901_0060625_2116_2787 220
128 3300046664 Ga0495659_0168724 Ga0495659_0168724_80_745 220
129 3300046684 Ga0495669_0062480 Ga0495669_0062480_697_1368 220
130 3300048915 Ga0496112_0068996 Ga0496112_0068996_468_1148 220
131 3300005327 Ga0070658_10110197 Ga0070658_101101973 221
132 3300005328 Ga0070676_10014001 Ga0070676_100140013 221
133 3300005330 Ga0070690_100033295 Ga0070690_1000332954 221
134 3300005335 Ga0070666_10007280 Ga0070666_100072803 221
135 3300005335 Ga0070666_10039195 Ga0070666_100391954 221
136 3300005336 Ga0070680_100031006 Ga0070680_1000310063 221
137 3300005338 Ga0068868_100045958 Ga0068868_1000459583 221
138 3300005338 Ga0068868_100146627 Ga0068868_1001466273 221
139 3300005338 Ga0068868_100265641 Ga0068868_1002656412 221
140 3300005339 Ga0070660_100017791 Ga0070660_1000177913 221
141 3300005339 Ga0070660_100734016 Ga0070660_1007340161 221
142 3300005340 Ga0070689_100173503 Ga0070689_1001735032 221
143 3300005353 Ga0070669_100452366 Ga0070669_1004523661 221
144 3300005355 Ga0070671_100032011 Ga0070671_1000320113 221
145 3300005355 Ga0070671_100093459 Ga0070671_1000934592 221
146 3300005356 Ga0070674_100045250 Ga0070674_1000452503 221
147 3300005364 Ga0070673_100286789 Ga0070673_1002867892 221
148 3300005364 Ga0070673_100536235 Ga0070673_1005362351 221
149 3300005366 Ga0070659_100506038 Ga0070659_1005060381 221
150 3300005367 Ga0070667_100002695 Ga0070667_10000269513 221
151 3300005367 Ga0070667_100605771 Ga0070667_1006057711 221
152 3300005455 Ga0070663_100003596 Ga0070663_1000035963 221
153 3300005457 Ga0070662_100225437 Ga0070662_1002254371 221
154 3300005457 Ga0070662_100542478 Ga0070662_1005424781 221
155 3300005458 Ga0070681_10041392 Ga0070681_100413927 221
156 3300005466 Ga0070685_10095526 Ga0070685_100955263 221
157 3300005530 Ga0070679_100147473 Ga0070679_1001474731 221
158 3300005535 Ga0070684_100212313 Ga0070684_1002123131 221
159 3300005543 Ga0070672_100093613 Ga0070672_1000936134 221
160 3300005544 Ga0070686_100000303 Ga0070686_1000003033 221
161 3300005563 Ga0068855_100086331 Ga0068855_1000863312 221
162 3300005614 Ga0068856_100061613 Ga0068856_1000616132 221
163 3300005616 Ga0068852_100074233 Ga0068852_1000742331 221
164 3300005618 Ga0068864_100151549 Ga0068864_1001515493 221
165 3300005841 Ga0068863_100047990 Ga0068863_1000479903 221
166 3300005841 Ga0068863_100078907 Ga0068863_1000789071 221
167 3300005842 Ga0068858_100034598 Ga0068858_1000345984 221
168 3300005843 Ga0068860_100064058 Ga0068860_1000640582 221
169 3300005844 Ga0068862_100006835 Ga0068862_1000068352 221
170 3300006237 Ga0097621_100042283 Ga0097621_1000422832 221
171 3300006237 Ga0097621_100141616 Ga0097621_1001416164 221
172 3300006358 Ga0068871_100080476 Ga0068871_1000804763 221
173 3300006881 Ga0068865_100022889 Ga0068865_1000228892 221
174 3300009148 Ga0105243_10460567 Ga0105243_104605671 221
175 3300009177 Ga0105248_10009267 Ga0105248_100092677 221
176 3300013104 Ga0157370_10084410 Ga0157370_100844103 221
177 3300013105 Ga0157369_10151471 Ga0157369_101514713 221
178 3300021384 Ga0213876_10048732 Ga0213876_100487322 221
179 3300025903 Ga0207680_10009968 Ga0207680_100099682 221
180 3300025903 Ga0207680_10044837 Ga0207680_100448373 221
181 3300025904 Ga0207647_10019838 Ga0207647_100198384 221
182 3300025907 Ga0207645_10019269 Ga0207645_100192695 221
183 3300025909 Ga0207705_10012007 Ga0207705_100120079 221
184 3300025909 Ga0207705_10425824 Ga0207705_104258241 221
185 3300025917 Ga0207660_10024638 Ga0207660_100246383 221
186 3300025919 Ga0207657_10002279 Ga0207657_1000227918 221
187 3300025919 Ga0207657_10265072 Ga0207657_102650721 221
188 3300025921 Ga0207652_10099086 Ga0207652_100990862 221
189 3300025931 Ga0207644_10016242 Ga0207644_100162422 221
190 3300025931 Ga0207644_10059434 Ga0207644_100594343 221
191 3300025931 Ga0207644_10120577 Ga0207644_101205772 221
192 3300025932 Ga0207690_10440760 Ga0207690_104407602 221
193 3300025935 Ga0207709_10172835 Ga0207709_101728353 221
194 3300025937 Ga0207669_10026972 Ga0207669_100269723 221
195 3300025938 Ga0207704_10171611 Ga0207704_101716113 221
196 3300025941 Ga0207711_10000786 Ga0207711_1000078628 221
197 3300025941 Ga0207711_10010481 Ga0207711_100104813 221
198 3300025960 Ga0207651_10048471 Ga0207651_100484712 221
199 3300025986 Ga0207658_10009223 Ga0207658_100092232 221
200 3300025986 Ga0207658_10154902 Ga0207658_101549023 221
201 3300026023 Ga0207677_10028779 Ga0207677_100287793 221
202 3300026035 Ga0207703_10002851 Ga0207703_1000285110 221
203 3300026067 Ga0207678_10002108 Ga0207678_1000210814 221
204 3300026078 Ga0207702_10093777 Ga0207702_100937772 221
205 3300026088 Ga0207641_10120859 Ga0207641_101208594 221
206 3300026095 Ga0207676_10227925 Ga0207676_102279251 221
207 3300028380 Ga0268265_10004496 Ga0268265_100044969 221
208 3300028381 Ga0268264_10020183 Ga0268264_100201839 221
209 3300028381 Ga0268264_10023546 Ga0268264_100235462 221
210 3300031548 Ga0307408_100058588 Ga0307408_1000585885 221
211 3300031548 Ga0307408_100217852 Ga0307408_1002178522 221
212 3300031731 Ga0307405_10002056 Ga0307405_100020567 221
213 3300031824 Ga0307413_10052167 Ga0307413_100521672 221
214 3300031852 Ga0307410_10021686 Ga0307410_100216865 221
215 3300031852 Ga0307410_10041309 Ga0307410_100413092 221
216 3300031852 Ga0307410_10153818 Ga0307410_101538183 221
217 3300031852 Ga0307410_10313986 Ga0307410_103139862 221
218 3300031901 Ga0307406_10000566 Ga0307406_1000056624 221
219 3300031903 Ga0307407_10009087 Ga0307407_100090872 221
220 3300031911 Ga0307412_10001240 Ga0307412_100012402 221
221 3300031995 Ga0307409_100003788 Ga0307409_10000378812 221
222 3300031995 Ga0307409_100214113 Ga0307409_1002141131 221
223 3300031995 Ga0307409_100249011 Ga0307409_1002490113 221
224 3300032002 Ga0307416_100001154 Ga0307416_1000011545 221
225 3300032002 Ga0307416_100102541 Ga0307416_1001025412 221
226 3300032004 Ga0307414_10000897 Ga0307414_1000089712 221
227 3300032004 Ga0307414_10027386 Ga0307414_100273863 221
228 3300032005 Ga0307411_10000460 Ga0307411_1000046011 221
229 3300032005 Ga0307411_10006896 Ga0307411_100068965 221
230 3300032005 Ga0307411_10292240 Ga0307411_102922402 221
231 3300037312 Ga0395899_0005097 Ga0395899_0005097_8719_9387 221
232 3300037312 Ga0395899_0085524 Ga0395899_0085524_109_816 221
233 3300037418 Ga0395900_0116289 Ga0395900_0116289_790_1455 221
234 3300037418 Ga0395900_0296420 Ga0395900_0296420_652_1359 221
235 3300037466 Ga0395898_0005963 Ga0395898_0005963_9995_10663 221
236 3300037471 Ga0395905_0214578 Ga0395905_0214578_106_813 221
237 3300037471 Ga0395905_0561714 Ga0395905_0561714_105_776 221
238 3300038443 Ga0395901_0024999 Ga0395901_0024999_1165_1833 221
239 3300038443 Ga0395901_0085407 Ga0395901_0085407_488_1195 221
240 3300038443 Ga0395901_0590069 Ga0395901_0590069_333_1040 221
241 3300039437 Ga0436365_1289842 Ga0436365_1289842_327_1025 221
242 3300042004 Ga0439445_0001414 Ga0439445_0001414_3672_4343 221
243 3300048909 Ga0496106_0050336 Ga0496106_0050336_2067_2732 221
244 3300048910 Ga0496107_0017661 Ga0496107_0017661_2293_2958 221
245 3300048912 Ga0496109_0033263 Ga0496109_0033263_1537_2202 221
246 3300048913 Ga0496110_0065465 Ga0496110_0065465_295_960 221
247 3300048914 Ga0496111_0008366 Ga0496111_0008366_2373_3038 221
248 3300048915 Ga0496112_0007277 Ga0496112_0007277_5930_6595 221
249 3300048916 Ga0496113_0164476 Ga0496113_0164476_782_1447 221
250 3300049663 Ga0501223_047246 Ga0501223_047246_83_751 221
251 3300001991 JGI24743J22301_10058642 JGI24743J22301_100586421 222
252 3300005293 Ga0065715_10105120 Ga0065715_101051202 222
253 3300005330 Ga0070690_100023508 Ga0070690_1000235084 222
254 3300005330 Ga0070690_100199100 Ga0070690_1001991002 222
255 3300005331 Ga0070670_100037409 Ga0070670_1000374096 222
256 3300005331 Ga0070670_100497727 Ga0070670_1004977271 222
257 3300005335 Ga0070666_10103898 Ga0070666_101038983 222
258 3300005338 Ga0068868_100215585 Ga0068868_1002155851 222
259 3300005338 Ga0068868_100281659 Ga0068868_1002816592 222
260 3300005339 Ga0070660_100170529 Ga0070660_1001705292 222
261 3300005344 Ga0070661_100000202 Ga0070661_10000020210 222
262 3300005344 Ga0070661_100057413 Ga0070661_1000574134 222
263 3300005344 Ga0070661_100573942 Ga0070661_1005739422 222
264 3300005345 Ga0070692_10014846 Ga0070692_100148462 222
265 3300005347 Ga0070668_100243991 Ga0070668_1002439912 222
266 3300005356 Ga0070674_100087427 Ga0070674_1000874273 222
267 3300005364 Ga0070673_100000346 Ga0070673_10000034630 222
268 3300005364 Ga0070673_100025546 Ga0070673_1000255464 222
269 3300005364 Ga0070673_100045669 Ga0070673_1000456694 222
270 3300005366 Ga0070659_100020999 Ga0070659_1000209992 222
271 3300005366 Ga0070659_100039606 Ga0070659_1000396063 222
272 3300005366 Ga0070659_100065290 Ga0070659_1000652903 222
273 3300005367 Ga0070667_100026415 Ga0070667_1000264156 222
274 3300005367 Ga0070667_100154767 Ga0070667_1001547673 222
275 3300005434 Ga0070709_10184874 Ga0070709_101848741 222
276 3300005435 Ga0070714_100483671 Ga0070714_1004836711 222
277 3300005436 Ga0070713_100001736 Ga0070713_10000173616 222
278 3300005444 Ga0070694_100015173 Ga0070694_1000151733 222
279 3300005456 Ga0070678_100003987 Ga0070678_1000039871 222
280 3300005456 Ga0070678_100017595 Ga0070678_1000175957 222
281 3300005457 Ga0070662_100003201 Ga0070662_1000032016 222
282 3300005457 Ga0070662_100016475 Ga0070662_1000164754 222
283 3300005457 Ga0070662_100021755 Ga0070662_1000217553 222
284 3300005457 Ga0070662_100278994 Ga0070662_1002789942 222
285 3300005459 Ga0068867_100041281 Ga0068867_1000412814 222
286 3300005471 Ga0070698_100365437 Ga0070698_1003654372 222
287 3300005536 Ga0070697_100442315 Ga0070697_1004423152 222
288 3300005543 Ga0070672_100004985 Ga0070672_10000498513 222
289 3300005543 Ga0070672_100010010 Ga0070672_1000100104 222
290 3300005543 Ga0070672_100020270 Ga0070672_1000202709 222
291 3300005543 Ga0070672_100068141 Ga0070672_1000681411 222
292 3300005543 Ga0070672_100681840 Ga0070672_1006818402 222
293 3300005548 Ga0070665_100010149 Ga0070665_10001014910 222
294 3300005548 Ga0070665_100338409 Ga0070665_1003384092 222
295 3300005563 Ga0068855_100064009 Ga0068855_1000640093 222
296 3300005564 Ga0070664_100099669 Ga0070664_1000996691 222
297 3300005577 Ga0068857_100047076 Ga0068857_1000470763 222
298 3300005577 Ga0068857_100426192 Ga0068857_1004261923 222
299 3300005578 Ga0068854_100090900 Ga0068854_1000909003 222
300 3300005616 Ga0068852_100037585 Ga0068852_1000375856 222
301 3300005617 Ga0068859_100154149 Ga0068859_1001541492 222
302 3300005618 Ga0068864_100030127 Ga0068864_1000301273 222
303 3300005618 Ga0068864_100045249 Ga0068864_1000452493 222
304 3300005618 Ga0068864_100229961 Ga0068864_1002299612 222
305 3300005840 Ga0068870_10108690 Ga0068870_101086901 222
306 3300005841 Ga0068863_100077971 Ga0068863_1000779712 222
307 3300005842 Ga0068858_100170606 Ga0068858_1001706061 222
308 3300005843 Ga0068860_100021722 Ga0068860_1000217229 222
309 3300005844 Ga0068862_100098727 Ga0068862_1000987273 222
310 3300005844 Ga0068862_100179790 Ga0068862_1001797901 222
311 3300005844 Ga0068862_100279362 Ga0068862_1002793622 222
312 3300006028 Ga0070717_10005724 Ga0070717_100057247 222
313 3300006051 Ga0075364_10561627 Ga0075364_105616271 222
314 3300006195 Ga0075366_10153525 Ga0075366_101535252 222
315 3300006358 Ga0068871_100034420 Ga0068871_1000344206 222
316 3300006358 Ga0068871_100063103 Ga0068871_1000631033 222
317 3300006358 Ga0068871_100071453 Ga0068871_1000714535 222
318 3300006852 Ga0075433_10044294 Ga0075433_100442943 222
319 3300006871 Ga0075434_100438925 Ga0075434_1004389252 222
320 3300006871 Ga0075434_101201427 Ga0075434_1012014271 222
321 3300006881 Ga0068865_100014327 Ga0068865_1000143273 222
322 3300006881 Ga0068865_100034047 Ga0068865_1000340474 222
323 3300006931 Ga0097620_100154153 Ga0097620_1001541532 222
324 3300009098 Ga0105245_10235082 Ga0105245_102350822 222
325 3300009098 Ga0105245_10271296 Ga0105245_102712962 222
326 3300009176 Ga0105242_10902822 Ga0105242_109028221 222
327 3300009177 Ga0105248_10005539 Ga0105248_100055394 222
328 3300010375 Ga0105239_10312437 Ga0105239_103124373 222
329 3300011119 Ga0105246_10038764 Ga0105246_100387644 222
330 3300013102 Ga0157371_10025043 Ga0157371_100250434 222
331 3300013102 Ga0157371_10104949 Ga0157371_101049492 222
332 3300013102 Ga0157371_10147185 Ga0157371_101471852 222
333 3300013105 Ga0157369_10261513 Ga0157369_102615132 222
334 3300013296 Ga0157374_10192412 Ga0157374_101924123 222
335 3300013297 Ga0157378_10238202 Ga0157378_102382022 222
336 3300013306 Ga0163162_10642676 Ga0163162_106426761 222
337 3300013308 Ga0157375_10005855 Ga0157375_1000585515 222
338 3300013308 Ga0157375_10095200 Ga0157375_100952004 222
339 3300013308 Ga0157375_11115767 Ga0157375_111157672 222
340 3300014325 Ga0163163_10010877 Ga0163163_100108775 222
341 3300014325 Ga0163163_10029586 Ga0163163_100295864 222
342 3300014326 Ga0157380_10316674 Ga0157380_103166742 222
343 3300014969 Ga0157376_10068909 Ga0157376_100689092 222
344 3300025315 Ga0207697_10027085 Ga0207697_100270852 222
345 3300025901 Ga0207688_10005358 Ga0207688_100053584 222
346 3300025903 Ga0207680_10046147 Ga0207680_100461474 222
347 3300025903 Ga0207680_10162167 Ga0207680_101621673 222
348 3300025904 Ga0207647_10005300 Ga0207647_100053008 222
349 3300025904 Ga0207647_10013156 Ga0207647_100131564 222
350 3300025904 Ga0207647_10017602 Ga0207647_100176023 222
351 3300025904 Ga0207647_10055973 Ga0207647_100559733 222
352 3300025907 Ga0207645_10008285 Ga0207645_100082854 222
353 3300025908 Ga0207643_10013980 Ga0207643_100139806 222
354 3300025914 Ga0207671_10448916 Ga0207671_104489162 222
355 3300025919 Ga0207657_10010150 Ga0207657_1001015011 222
356 3300025920 Ga0207649_10000106 Ga0207649_1000010610 222
357 3300025920 Ga0207649_10039805 Ga0207649_100398055 222
358 3300025920 Ga0207649_10121972 Ga0207649_101219722 222
359 3300025923 Ga0207681_10046258 Ga0207681_100462583 222
360 3300025923 Ga0207681_10056807 Ga0207681_100568072 222
361 3300025925 Ga0207650_10005773 Ga0207650_1000577313 222
362 3300025925 Ga0207650_10196951 Ga0207650_101969512 222
363 3300025925 Ga0207650_10217294 Ga0207650_102172942 222
364 3300025929 Ga0207664_10164585 Ga0207664_101645854 222
365 3300025931 Ga0207644_10009928 Ga0207644_100099288 222
366 3300025932 Ga0207690_10009628 Ga0207690_1000962810 222
367 3300025932 Ga0207690_10039377 Ga0207690_100393773 222
368 3300025932 Ga0207690_10125217 Ga0207690_101252172 222
369 3300025933 Ga0207706_10007263 Ga0207706_100072639 222
370 3300025933 Ga0207706_10014063 Ga0207706_100140637 222
371 3300025933 Ga0207706_10020563 Ga0207706_100205635 222
372 3300025938 Ga0207704_10252344 Ga0207704_102523441 222
373 3300025940 Ga0207691_10000820 Ga0207691_1000082037 222
374 3300025940 Ga0207691_10002012 Ga0207691_1000201217 222
375 3300025940 Ga0207691_10025895 Ga0207691_100258957 222
376 3300025940 Ga0207691_10034401 Ga0207691_100344013 222
377 3300025941 Ga0207711_10012435 Ga0207711_100124352 222
378 3300025941 Ga0207711_10023551 Ga0207711_100235513 222
379 3300025942 Ga0207689_10119583 Ga0207689_101195832 222
380 3300025949 Ga0207667_10199688 Ga0207667_101996883 222
381 3300025960 Ga0207651_10005417 Ga0207651_100054176 222
382 3300025960 Ga0207651_10023724 Ga0207651_100237244 222
383 3300025960 Ga0207651_10053312 Ga0207651_100533123 222
384 3300025960 Ga0207651_10437559 Ga0207651_104375591 222
385 3300025961 Ga0207712_10124175 Ga0207712_101241752 222
386 3300025972 Ga0207668_10000129 Ga0207668_1000012955 222
387 3300025972 Ga0207668_10641403 Ga0207668_106414032 222
388 3300025981 Ga0207640_10118927 Ga0207640_101189272 222
389 3300025986 Ga0207658_10021888 Ga0207658_100218882 222
390 3300025986 Ga0207658_10046760 Ga0207658_100467604 222
391 3300025986 Ga0207658_10187294 Ga0207658_101872943 222
392 3300025986 Ga0207658_10211534 Ga0207658_102115342 222
393 3300026023 Ga0207677_10082565 Ga0207677_100825652 222
394 3300026023 Ga0207677_10347844 Ga0207677_103478441 222
395 3300026078 Ga0207702_10298494 Ga0207702_102984941 222
396 3300026088 Ga0207641_10013267 Ga0207641_100132679 222
397 3300026088 Ga0207641_10228493 Ga0207641_102284932 222
398 3300026089 Ga0207648_10000838 Ga0207648_1000083813 222
399 3300026089 Ga0207648_10025249 Ga0207648_100252498 222
400 3300026095 Ga0207676_10002035 Ga0207676_100020354 222
401 3300026116 Ga0207674_10000308 Ga0207674_1000030842 222
402 3300026116 Ga0207674_10024788 Ga0207674_100247886 222
403 3300026121 Ga0207683_10001795 Ga0207683_1000179526 222
404 3300026121 Ga0207683_10002607 Ga0207683_100026077 222
405 3300027552 Ga0209982_1013038 Ga0209982_10130381 222
406 3300027665 Ga0209983_1006277 Ga0209983_10062772 222
407 3300027876 Ga0209974_10001653 Ga0209974_100016539 222
408 3300028379 Ga0268266_10067429 Ga0268266_100674294 222
409 3300028379 Ga0268266_10152229 Ga0268266_101522293 222
410 3300028380 Ga0268265_10109706 Ga0268265_101097065 222
411 3300028380 Ga0268265_10142184 Ga0268265_101421842 222
412 3300028380 Ga0268265_10193889 Ga0268265_101938892 222
413 3300028381 Ga0268264_10006123 Ga0268264_1000612311 222
414 3300031456 Ga0307513_10365243 Ga0307513_103652431 222
415 3300031548 Ga0307408_100182910 Ga0307408_1001829102 222
416 3300031548 Ga0307408_100547473 Ga0307408_1005474731 222
417 3300031731 Ga0307405_10015446 Ga0307405_100154463 222
418 3300031824 Ga0307413_10030161 Ga0307413_100301613 222
419 3300031852 Ga0307410_10022287 Ga0307410_100222876 222
420 3300031852 Ga0307410_10280381 Ga0307410_102803812 222
421 3300031901 Ga0307406_10054163 Ga0307406_100541634 222
422 3300031901 Ga0307406_10614553 Ga0307406_106145532 222
423 3300031903 Ga0307407_10004272 Ga0307407_100042727 222
424 3300031903 Ga0307407_10042917 Ga0307407_100429171 222
425 3300031903 Ga0307407_10241749 Ga0307407_102417492 222
426 3300031911 Ga0307412_10042782 Ga0307412_100427822 222
427 3300031911 Ga0307412_10130272 Ga0307412_101302722 222
428 3300031995 Ga0307409_100011473 Ga0307409_10001147310 222
429 3300031995 Ga0307409_100020648 Ga0307409_1000206486 222
430 3300031995 Ga0307409_100140688 Ga0307409_1001406883 222
431 3300031995 Ga0307409_100553029 Ga0307409_1005530292 222
432 3300032002 Ga0307416_100042481 Ga0307416_1000424814 222
433 3300032004 Ga0307414_10055807 Ga0307414_100558074 222
434 3300032005 Ga0307411_10016408 Ga0307411_100164083 222
435 3300032005 Ga0307411_10023919 Ga0307411_100239196 222
436 3300032005 Ga0307411_10334707 Ga0307411_103347071 222
437 3300032126 Ga0307415_100005203 Ga0307415_1000052034 222
438 3300035691 Ga0373931_0179240 Ga0373931_0179240_423_1097 222
439 3300037312 Ga0395899_0000104 Ga0395899_0000104_101625_102296 222
440 3300037418 Ga0395900_0000161 Ga0395900_0000161_27729_28400 222
441 3300037466 Ga0395898_0000169 Ga0395898_0000169_114561_115232 222
442 3300037466 Ga0395898_0048325 Ga0395898_0048325_267_935 222
443 3300037471 Ga0395905_0000120 Ga0395905_0000120_27917_28588 222
444 3300037471 Ga0395905_0114472 Ga0395905_0114472_229_897 222
445 3300038443 Ga0395901_0000871 Ga0395901_0000871_7095_7766 222
446 3300039437 Ga0436365_1495235 Ga0436365_1495235_435_1124 222
447 3300042157 Ga0439458_0008867 Ga0439458_0008867_431_1141 222
448 3300046525 Ga0495663_0032603 Ga0495663_0032603_496_1191 222
449 3300046616 Ga0495668_0006091 Ga0495668_0006091_2707_3378 222
450 3300046616 Ga0495668_0029130 Ga0495668_0029130_1473_2150 222
451 3300048906 Ga0496103_0042439 Ga0496103_0042439_1931_2605 222
452 3300048907 Ga0496104_0099237 Ga0496104_0099237_1383_2057 222
453 3300048908 Ga0496105_0217630 Ga0496105_0217630_716_1390 222
454 3300048909 Ga0496106_0103744 Ga0496106_0103744_171_845 222
455 3300048911 Ga0496108_0001766 Ga0496108_0001766_686_1360 222
456 3300048911 Ga0496108_0007343 Ga0496108_0007343_8204_8893 222
457 3300048912 Ga0496109_0024669 Ga0496109_0024669_3680_4369 222
458 3300048913 Ga0496110_0106391 Ga0496110_0106391_770_1459 222
459 3300048914 Ga0496111_0003461 Ga0496111_0003461_1295_1984 222
460 3300048915 Ga0496112_0053098 Ga0496112_0053098_269_958 222
461 3300048916 Ga0496113_0031264 Ga0496113_0031264_1956_2645 222
462 3300049778 Ga0501282_010539 Ga0501282_010539_72_767 222
463 3300050512 nmdc:mga0n895_310749_c1 nmdc:mga0n895_310749_c1_454_1125 222
464 3300050515 nmdc:mga0a205_402888_c1 nmdc:mga0a205_402888_c1_332_1003 222
465 3300053083 Ga0495655_0035272 Ga0495655_0035272_56_742 222
466 3300053134 Ga0500658_0000022 Ga0500658_0000022_111425_112096 222
467 3300001989 JGI24739J22299_10000816 JGI24739J22299_1000081615 223
468 3300001990 JGI24737J22298_10000296 JGI24737J22298_1000029612 223
469 3300002075 JGI24738J21930_10000065 JGI24738J21930_1000006519 223
470 3300002077 JGI24744J21845_10023389 JGI24744J21845_100233892 223
471 3300002126 JGI24035J26624_1003645 JGI24035J26624_10036452 223
472 3300005327 Ga0070658_10022504 Ga0070658_100225049 223
473 3300005328 Ga0070676_10004904 Ga0070676_100049041 223
474 3300005330 Ga0070690_100004600 Ga0070690_10000460010 223
475 3300005331 Ga0070670_100008638 Ga0070670_1000086389 223
476 3300005331 Ga0070670_100316999 Ga0070670_1003169992 223
477 3300005334 Ga0068869_100000215 Ga0068869_10000021524 223
478 3300005335 Ga0070666_10023607 Ga0070666_100236078 223
479 3300005335 Ga0070666_10150119 Ga0070666_101501193 223
480 3300005338 Ga0068868_100000041 Ga0068868_10000004137 223
481 3300005338 Ga0068868_100027715 Ga0068868_1000277154 223
482 3300005339 Ga0070660_100003237 Ga0070660_10000323716 223
483 3300005339 Ga0070660_100005177 Ga0070660_10000517714 223
484 3300005344 Ga0070661_100025208 Ga0070661_1000252088 223
485 3300005347 Ga0070668_100018834 Ga0070668_1000188348 223
486 3300005353 Ga0070669_100009536 Ga0070669_1000095368 223
487 3300005353 Ga0070669_100086852 Ga0070669_1000868523 223
488 3300005355 Ga0070671_100000790 Ga0070671_10000079021 223
489 3300005355 Ga0070671_100072558 Ga0070671_1000725582 223
490 3300005355 Ga0070671_100509332 Ga0070671_1005093321 223
491 3300005356 Ga0070674_100003988 Ga0070674_10000398813 223
492 3300005364 Ga0070673_100000242 Ga0070673_10000024220 223
493 3300005364 Ga0070673_100008168 Ga0070673_1000081687 223
494 3300005364 Ga0070673_100762780 Ga0070673_1007627802 223
495 3300005366 Ga0070659_100001924 Ga0070659_1000019246 223
496 3300005367 Ga0070667_100001538 Ga0070667_1000015389 223
497 3300005367 Ga0070667_100013153 Ga0070667_1000131535 223
498 3300005457 Ga0070662_100002998 Ga0070662_1000029989 223
499 3300005459 Ga0068867_100022803 Ga0068867_1000228038 223
500 3300005466 Ga0070685_10019930 Ga0070685_100199302 223
501 3300005539 Ga0068853_100011326 Ga0068853_10001132615 223
502 3300005543 Ga0070672_100004276 Ga0070672_10000427610 223
503 3300005548 Ga0070665_100459027 Ga0070665_1004590273 223
504 3300005548 Ga0070665_100839250 Ga0070665_1008392501 223
505 3300005563 Ga0068855_100005738 Ga0068855_1000057387 223
506 3300005564 Ga0070664_100330013 Ga0070664_1003300132 223
507 3300005578 Ga0068854_100001510 Ga0068854_1000015108 223
508 3300005578 Ga0068854_100914272 Ga0068854_1009142721 223
509 3300005616 Ga0068852_100018863 Ga0068852_1000188634 223
510 3300005617 Ga0068859_100000281 Ga0068859_10000028136 223
511 3300005617 Ga0068859_100002867 Ga0068859_1000028679 223
512 3300005618 Ga0068864_100000261 Ga0068864_10000026116 223
513 3300005618 Ga0068864_100000564 Ga0068864_10000056431 223
514 3300005718 Ga0068866_10011347 Ga0068866_100113478 223
515 3300005718 Ga0068866_10181302 Ga0068866_101813021 223
516 3300005834 Ga0068851_10159391 Ga0068851_101593912 223
517 3300005841 Ga0068863_100000554 Ga0068863_10000055434 223
518 3300005841 Ga0068863_100000807 Ga0068863_10000080720 223
519 3300005841 Ga0068863_100456608 Ga0068863_1004566082 223
520 3300005842 Ga0068858_100001974 Ga0068858_10000197415 223
521 3300005842 Ga0068858_100002051 Ga0068858_10000205113 223
522 3300005843 Ga0068860_100000867 Ga0068860_10000086733 223
523 3300005843 Ga0068860_100029454 Ga0068860_1000294545 223
524 3300005844 Ga0068862_100007953 Ga0068862_1000079534 223
525 3300005844 Ga0068862_100100081 Ga0068862_1001000813 223
526 3300006237 Ga0097621_100139323 Ga0097621_1001393232 223
527 3300006358 Ga0068871_100130729 Ga0068871_1001307293 223
528 3300006844 Ga0075428_100345362 Ga0075428_1003453622 223
529 3300006881 Ga0068865_100000790 Ga0068865_10000079016 223
530 3300006931 Ga0097620_100000281 Ga0097620_10000028136 223
531 3300006931 Ga0097620_100002867 Ga0097620_1000028679 223
532 3300009092 Ga0105250_10066051 Ga0105250_100660512 223
533 3300009093 Ga0105240_10385779 Ga0105240_103857793 223
534 3300009098 Ga0105245_10000433 Ga0105245_1000043313 223
535 3300009098 Ga0105245_10038057 Ga0105245_100380572 223
536 3300009148 Ga0105243_10006071 Ga0105243_100060711 223
537 3300009174 Ga0105241_10005737 Ga0105241_1000573714 223
538 3300009177 Ga0105248_10000070 Ga0105248_1000007091 223
539 3300009177 Ga0105248_10000313 Ga0105248_1000031352 223
540 3300009553 Ga0105249_10013031 Ga0105249_100130318 223
541 3300011119 Ga0105246_10002636 Ga0105246_1000263616 223
542 3300013100 Ga0157373_10001179 Ga0157373_1000117915 223
543 3300013102 Ga0157371_10001574 Ga0157371_100015747 223
544 3300013297 Ga0157378_10004425 Ga0157378_100044257 223
545 3300013306 Ga0163162_10008879 Ga0163162_100088792 223
546 3300013306 Ga0163162_10016027 Ga0163162_1001602712 223
547 3300013306 Ga0163162_10020341 Ga0163162_1002034110 223
548 3300013308 Ga0157375_10008102 Ga0157375_1000810213 223
549 3300013308 Ga0157375_11139341 Ga0157375_111393412 223
550 3300014325 Ga0163163_10000135 Ga0163163_100001359 223
551 3300014968 Ga0157379_10080896 Ga0157379_100808965 223
552 3300020081 Ga0206354_11656559 Ga0206354_116565592 223
553 3300020082 Ga0206353_10613120 Ga0206353_1061312013 223
554 3300025315 Ga0207697_10000157 Ga0207697_1000015714 223
555 3300025711 Ga0207696_1047510 Ga0207696_10475102 223
556 3300025893 Ga0207682_10028209 Ga0207682_100282091 223
557 3300025901 Ga0207688_10000953 Ga0207688_1000095315 223
558 3300025903 Ga0207680_10001970 Ga0207680_100019702 223
559 3300025904 Ga0207647_10000047 Ga0207647_1000004727 223
560 3300025907 Ga0207645_10015768 Ga0207645_100157689 223
561 3300025913 Ga0207695_10441041 Ga0207695_104410412 223
562 3300025919 Ga0207657_10000826 Ga0207657_1000082626 223
563 3300025920 Ga0207649_10048199 Ga0207649_100481994 223
564 3300025923 Ga0207681_10010855 Ga0207681_100108559 223
565 3300025923 Ga0207681_10029122 Ga0207681_100291222 223
566 3300025925 Ga0207650_10008191 Ga0207650_100081918 223
567 3300025927 Ga0207687_10001801 Ga0207687_1000180115 223
568 3300025927 Ga0207687_10016532 Ga0207687_100165322 223
569 3300025931 Ga0207644_10000430 Ga0207644_1000043015 223
570 3300025931 Ga0207644_10134607 Ga0207644_101346073 223
571 3300025931 Ga0207644_10237358 Ga0207644_102373582 223
572 3300025932 Ga0207690_10103221 Ga0207690_101032214 223
573 3300025933 Ga0207706_10000103 Ga0207706_1000010336 223
574 3300025933 Ga0207706_10176322 Ga0207706_101763223 223
575 3300025937 Ga0207669_10062133 Ga0207669_100621332 223
576 3300025938 Ga0207704_10005465 Ga0207704_100054659 223
577 3300025940 Ga0207691_10000586 Ga0207691_1000058623 223
578 3300025941 Ga0207711_10000051 Ga0207711_1000005165 223
579 3300025941 Ga0207711_10003725 Ga0207711_100037252 223
580 3300025942 Ga0207689_10000242 Ga0207689_1000024228 223
581 3300025942 Ga0207689_10221637 Ga0207689_102216372 223
582 3300025945 Ga0207679_10009996 Ga0207679_1000999611 223
583 3300025949 Ga0207667_10002726 Ga0207667_1000272615 223
584 3300025960 Ga0207651_10003302 Ga0207651_1000330212 223
585 3300025960 Ga0207651_10137881 Ga0207651_101378813 223
586 3300025961 Ga0207712_10021473 Ga0207712_100214733 223
587 3300025972 Ga0207668_10034881 Ga0207668_100348814 223
588 3300025981 Ga0207640_10000173 Ga0207640_1000017330 223
589 3300025986 Ga0207658_10005059 Ga0207658_1000505912 223
590 3300025986 Ga0207658_10011114 Ga0207658_100111149 223
591 3300025986 Ga0207658_10080763 Ga0207658_100807632 223
592 3300026023 Ga0207677_10001214 Ga0207677_1000121418 223
593 3300026023 Ga0207677_10012867 Ga0207677_100128675 223
594 3300026035 Ga0207703_10003929 Ga0207703_1000392915 223
595 3300026035 Ga0207703_10033345 Ga0207703_100333453 223
596 3300026041 Ga0207639_10004852 Ga0207639_100048522 223
597 3300026041 Ga0207639_10279592 Ga0207639_102795922 223
598 3300026088 Ga0207641_10000190 Ga0207641_1000019063 223
599 3300026088 Ga0207641_10004167 Ga0207641_1000416716 223
600 3300026089 Ga0207648_10036826 Ga0207648_100368262 223
601 3300026095 Ga0207676_10001202 Ga0207676_100012024 223
602 3300026095 Ga0207676_10114584 Ga0207676_101145843 223
603 3300026118 Ga0207675_100072458 Ga0207675_1000724585 223
604 3300026142 Ga0207698_10000760 Ga0207698_100007608 223
605 3300028379 Ga0268266_10355792 Ga0268266_103557922 223
606 3300028379 Ga0268266_10740388 Ga0268266_107403881 223
607 3300028380 Ga0268265_10127451 Ga0268265_101274513 223
608 3300028380 Ga0268265_10158802 Ga0268265_101588023 223
609 3300028381 Ga0268264_10000778 Ga0268264_1000077830 223
610 3300028381 Ga0268264_10007677 Ga0268264_1000767714 223
611 3300028381 Ga0268264_10076258 Ga0268264_100762584 223
612 3300031548 Ga0307408_100114656 Ga0307408_1001146563 223
613 3300031852 Ga0307410_10061229 Ga0307410_100612293 223
614 3300031852 Ga0307410_10310129 Ga0307410_103101292 223
615 3300031852 Ga0307410_10625523 Ga0307410_106255232 223
616 3300031901 Ga0307406_10296031 Ga0307406_102960312 223
617 3300031911 Ga0307412_10046032 Ga0307412_100460324 223
618 3300031995 Ga0307409_100435591 Ga0307409_1004355912 223
619 3300031995 Ga0307409_100580177 Ga0307409_1005801771 223
620 3300037312 Ga0395899_0042658 Ga0395899_0042658_510_1220 223
621 3300037418 Ga0395900_0011557 Ga0395900_0011557_5134_5844 223
622 3300037466 Ga0395898_0004993 Ga0395898_0004993_5090_5800 223
623 3300037471 Ga0395905_0001020 Ga0395905_0001020_31354_32031 223
624 3300037471 Ga0395905_0003861 Ga0395905_0003861_2228_2917 223
625 3300037471 Ga0395905_0779903 Ga0395905_0779903_30_704 223
626 3300038443 Ga0395901_0075162 Ga0395901_0075162_664_1374 223
627 3300041413 Ga0439465_0027895 Ga0439465_0027895_352_1026 223
628 3300042006 Ga0439432_097258 Ga0439432_097258_15_716 223
629 3300042007 Ga0439449_0022256 Ga0439449_0022256_474_1148 223
630 3300042127 Ga0450890_032407 Ga0450890_032407_48_722 223
631 3300042439 Ga0439464_0000949 Ga0439464_0000949_442_1155 223
632 3300048910 Ga0496107_0047190 Ga0496107_0047190_2140_2856 223
633 3300048911 Ga0496108_0000614 Ga0496108_0000614_5965_6669 223
634 3300048917 Ga0496114_0038235 Ga0496114_0038235_3048_3758 223
635 3300050496 nmdc:mga07m45_308020_c1 nmdc:mga07m45_308020_c1_163_834 223
636 3300050507 nmdc:mga05p37_400134_c1 nmdc:mga05p37_400134_c1_876_1547 223
637 3300050511 nmdc:mga08y16_759230_c1 nmdc:mga08y16_759230_c1_223_936 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

25

193

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o9g-assembly1.cif.gz_A crystal structure of aqpz mutant l170c complexed with mercury. 0.8555 6 223
2o9e-assembly1.cif.gz_A crystal structure of aqpz mutant t183c complexed with mercury 0.851 7 223
3nka-assembly2.cif.gz_B crystal structure of aqpz h174g,t183f 0.8506 8 223
2abm-assembly1.cif.gz_A crystal structure of aquaporin z tetramer reveals both open and closed water-conducting channels 0.849 9 219
1rc2-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8483 9 222
ID Description Score Start End Superfamily
af_Q7Z138_18_164_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.923 7 113 1.20.1080.10
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9113 3 107 1.20.1080.10
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8631 3 107 1.20.1080.10
3ne2C00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8617 5 222 1.20.1080.10
af_A0A0P0WDK9_2_139_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8542 9 115 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A3C1B8D7-F1-model_v4 Aquaporin family protein 0.9895 7 172 GO:0015267
GO:0016020
AF-A5PEN6-F1-model_v4 Uncharacterized protein 0.9891 4 166 GO:0005737
GO:0005886
GO:0012505
GO:0015250
GO:0043231
AF-A0A6I5WSB3-F1-model_v4 Aquaporin family protein 0.9886 7 223 GO:0015267
GO:0016020
AF-A0A258KZE2-F1-model_v4 Aquaporin family protein 0.9853 6 219 GO:0005886
GO:0015250
AF-A0A3B8R918-F1-model_v4 Aquaporin family protein 0.9851 12 219 GO:0005886
GO:0015250

Feature Viewer

pLDDT pTM Quality
94.16 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map