F471426

General Info

Members Datasets Scaffolds Average Seq Length
637 254 631 409

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_10588212|Ga0206353_105882121
Length 467
Sequence VEALEAKAQLETDAQVESKRLEQRLTASETSGGGSEMSERPTIRTVGCLCAATLALVACGCGGSKGNSTGVSSTSVTFGTHQPLTGPAAPGYSEIAPASVAFFEYLNAQGGIYGRKIHLIVKDDAYNPTQTVNVVHQLVLDEKVFGIFEGLGTPTHTKVVGFLNGEKVPDMFVASGCPCWDNGSAQPYTFGWQPNYTIEGKILGQYIKQHFASAKVGVFYQNDDFGKGGLTGIKDELPAHQIVSTQPYEPGITNVAPQISSIKASGATVLVDFTVPIYTALGQLASFTLGYKPQLVSSSVGIDPTTVGGLLKTFSKGKAGTELIEGAITDGYLPSVAETSNPWIALFRKVHNRYDSSAPFDGNVEYGMAAAYTLAQTLQLAGKNLTREGIVKALQEKGAQLNGPGLVPFRYSSSDHGGYSGAQMGQVKGGAITLFGPRLVTTPEAGSPIKTFTGTQPSPPESGVSVP

Samples

Sample ID Description Type Environment
1 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
2 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
3 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
4 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
5 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
254 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 3.61
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 2.04
Rhizosphere 92.62
Stem 0
Stem Tuber 0
Unclassified 5.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002973 3300003203 Bacteria 8003
2 Ga0058861_10034382 3300004800 Bacteria 1469
3 Ga0070658_10059259 3300005327 Bacteria 3118
4 Ga0070658_10106693 3300005327 Bacteria 2318
5 Ga0070683_100000449 3300005329 Bacteria 28762
6 Ga0070683_100087131 3300005329 Bacteria 2928
7 Ga0070683_100217341 3300005329 Bacteria 1816
8 Ga0070666_10140574 3300005335 Bacteria 1681
9 Ga0070680_100000948 3300005336 Bacteria 20539
10 Ga0070680_100007003 3300005336 Bacteria 8593
11 Ga0070680_100011382 3300005336 Bacteria 6880
12 Ga0070660_100004443 3300005339 Bacteria 9689
13 Ga0070660_100014588 3300005339 Bacteria 5667
14 Ga0070660_100015509 3300005339 Bacteria 5505
15 Ga0070660_100041926 3300005339 Bacteria 3491
16 Ga0070660_100052755 3300005339 Bacteria 3135
17 Ga0070689_100025487 3300005340 Bacteria 4443
18 Ga0070691_10008557 3300005341 Bacteria 4686
19 Ga0070687_100026964 3300005343 Bacteria 2770
20 Ga0070661_100063547 3300005344 Bacteria 2711
21 Ga0070692_10018720 3300005345 Bacteria 3334
22 Ga0070668_100019709 3300005347 Bacteria 5079
23 Ga0070674_100018164 3300005356 Bacteria 4441
24 Ga0070674_100093404 3300005356 Bacteria 2176
25 Ga0070673_100116084 3300005364 Bacteria 2226
26 Ga0070659_100099997 3300005366 Bacteria 2333
27 Ga0070659_100160034 3300005366 Bacteria 1841
28 Ga0070703_10011017 3300005406 Bacteria 2552
29 Ga0070709_10000482 3300005434 Bacteria 23485
30 Ga0070709_10013597 3300005434 Bacteria 4581
31 Ga0070709_10014506 3300005434 Bacteria 4457
32 Ga0070709_10021320 3300005434 Bacteria 3772
33 Ga0070709_10044225 3300005434 Bacteria 2757
34 Ga0070714_100000563 3300005435 Bacteria 26691
35 Ga0070714_100001859 3300005435 Bacteria 15374
36 Ga0070714_100019218 3300005435 Bacteria 5561
37 Ga0070714_100048209 3300005435 Bacteria 3622
38 Ga0070714_100060504 3300005435 Bacteria 3250
39 Ga0070714_100118481 3300005435 Bacteria 2352
40 Ga0070714_100209726 3300005435 Bacteria 1785
41 Ga0070713_100001453 3300005436 Bacteria 15114
42 Ga0070713_100039282 3300005436 Bacteria 3840
43 Ga0070713_100039871 3300005436 Bacteria 3815
44 Ga0070713_100072870 3300005436 Bacteria 2906
45 Ga0070713_100094594 3300005436 Bacteria 2576
46 Ga0070713_100098894 3300005436 Bacteria 2523
47 Ga0070713_100227509 3300005436 Unclassified 1694
48 Ga0070713_100228177 3300005436 Unclassified 1692
49 Ga0070713_100244358 3300005436 Bacteria 1635
50 Ga0070710_10000452 3300005437 Bacteria 19246
51 Ga0070710_10068809 3300005437 Unclassified 2035
52 Ga0070711_100000259 3300005439 Bacteria 27048
53 Ga0070711_100009183 3300005439 Bacteria 6078
54 Ga0070711_100043210 3300005439 Bacteria 3051
55 Ga0070700_100133923 3300005441 Bacteria 1676
56 Ga0070708_100002228 3300005445 Bacteria 14985
57 Ga0070708_100021384 3300005445 Bacteria 5468
58 Ga0070663_100146738 3300005455 Bacteria 1805
59 Ga0070681_10000440 3300005458 Bacteria 33837
60 Ga0070681_10014348 3300005458 Bacteria 7885
61 Ga0070681_10178342 3300005458 Bacteria 2046
62 Ga0070685_10020592 3300005466 Bacteria 3570
63 Ga0070706_100001026 3300005467 Bacteria 30302
64 Ga0070706_100005186 3300005467 Bacteria 12436
65 Ga0070706_100005590 3300005467 Bacteria 11958
66 Ga0070706_100016829 3300005467 Bacteria 6753
67 Ga0070706_100030917 3300005467 Bacteria 4936
68 Ga0070706_100043139 3300005467 Bacteria 4166
69 Ga0070706_100091238 3300005467 Bacteria 2825
70 Ga0070707_100000482 3300005468 Bacteria 39396
71 Ga0070707_100004919 3300005468 Bacteria 12525
72 Ga0070707_100008998 3300005468 Bacteria 9260
73 Ga0070707_100018776 3300005468 Bacteria 6509
74 Ga0070707_100095675 3300005468 Bacteria 2876
75 Ga0070698_100000318 3300005471 Bacteria 49028
76 Ga0070698_100001046 3300005471 Bacteria 30470
77 Ga0070698_100001605 3300005471 Bacteria 25142
78 Ga0070698_100019024 3300005471 Bacteria 7224
79 Ga0070698_100024025 3300005471 Bacteria 6363
80 Ga0070698_100027120 3300005471 Bacteria 5957
81 Ga0070698_100137514 3300005471 Bacteria 2396
82 Ga0070699_100000219 3300005518 Bacteria 56992
83 Ga0070699_100002268 3300005518 Bacteria 17306
84 Ga0070699_100041918 3300005518 Bacteria 3960
85 Ga0070699_100116526 3300005518 Bacteria 2348
86 Ga0070679_100001605 3300005530 Bacteria 20304
87 Ga0070679_100049478 3300005530 Bacteria 4186
88 Ga0070679_100056758 3300005530 Bacteria 3902
89 Ga0070679_100071526 3300005530 Bacteria 3459
90 Ga0070684_100015250 3300005535 Bacteria 6252
91 Ga0070684_100090325 3300005535 Bacteria 2724
92 Ga0070684_100194653 3300005535 Bacteria 1846
93 Ga0070697_100000078 3300005536 Bacteria 77882
94 Ga0070697_100013273 3300005536 Bacteria 6462
95 Ga0070697_100049225 3300005536 Bacteria 3420
96 Ga0068853_100179514 3300005539 Bacteria 1919
97 Ga0070696_100011166 3300005546 Bacteria 6009
98 Ga0068855_100091673 3300005563 Bacteria 3505
99 Ga0068855_100210296 3300005563 Bacteria 2186
100 Ga0068857_100019359 3300005577 Bacteria 5976
101 Ga0068857_100041694 3300005577 Bacteria 4070
102 Ga0068857_100108385 3300005577 Bacteria 2496
103 Ga0068856_100036180 3300005614 Bacteria 4841
104 Ga0070702_100011637 3300005615 Bacteria 4381
105 Ga0068852_100145012 3300005616 Bacteria 2201
106 Ga0068859_100036163 3300005617 Bacteria 4957
107 Ga0068866_10017860 3300005718 Bacteria 3197
108 Ga0068870_10006344 3300005840 Bacteria 5206
109 Ga0068860_100048994 3300005843 Bacteria 4026
110 Ga0068862_100042995 3300005844 Bacteria 3851
111 Ga0081540_1000548 3300005983 Bacteria 36395
112 Ga0081540_1029390 3300005983 Bacteria 3062
113 Ga0081539_10000756 3300005985 Bacteria 64265
114 Ga0081539_10008851 3300005985 Bacteria 8606
115 Ga0070717_10000562 3300006028 Bacteria 23638
116 Ga0070717_10003170 3300006028 Bacteria 11747
117 Ga0070717_10006820 3300006028 Bacteria 8431
118 Ga0070717_10010287 3300006028 Bacteria 7052
119 Ga0070717_10014005 3300006028 Bacteria 6161
120 Ga0070717_10019483 3300006028 Bacteria 5321
121 Ga0070717_10020438 3300006028 Bacteria 5207
122 Ga0070717_10035019 3300006028 Bacteria 4061
123 Ga0070717_10058182 3300006028 Bacteria 3196
124 Ga0070717_10104595 3300006028 Bacteria 2408
125 Ga0070717_10111110 3300006028 Bacteria 2338
126 Ga0070717_10244195 3300006028 Bacteria 1584
127 Ga0070716_100000717 3300006173 Bacteria 14159
128 Ga0070716_100015538 3300006173 Bacteria 3913
129 Ga0070716_100032031 3300006173 Bacteria 2864
130 Ga0070712_100001363 3300006175 Bacteria 14811
131 Ga0070712_100013920 3300006175 Bacteria 5151
132 Ga0070712_100029360 3300006175 Bacteria 3684
133 Ga0070712_100048048 3300006175 Bacteria 2956
134 Ga0070712_100058703 3300006175 Bacteria 2707
135 Ga0097621_100068620 3300006237 Bacteria 2925
136 Ga0068871_100052823 3300006358 Bacteria 3292
137 Ga0075431_100194647 3300006847 Bacteria 2076
138 Ga0075433_10105537 3300006852 Bacteria 2496
139 Ga0075434_100327486 3300006871 Bacteria 1552
140 Ga0097620_100036163 3300006931 Bacteria 4957
141 Ga0075435_100134596 3300007076 Bacteria 2069
142 Ga0075435_100205381 3300007076 Bacteria 1670
143 Ga0105251_10022340 3300009011 Bacteria 3285
144 Ga0111539_10203859 3300009094 Bacteria 2306
145 Ga0105245_10185811 3300009098 Bacteria 1988
146 Ga0114129_10001880 3300009147 Bacteria 28626
147 Ga0105242_10024359 3300009176 Bacteria 4779
148 Ga0105248_10117171 3300009177 Bacteria 3004
149 Ga0105238_10027715 3300009551 Bacteria 5774
150 Ga0105239_10298518 3300010375 Bacteria 1814
151 Ga0157371_10124723 3300013102 Bacteria 1831
152 Ga0157370_10138803 3300013104 Bacteria 2265
153 Ga0157369_10010356 3300013105 Bacteria 10631
154 Ga0157369_10015531 3300013105 Bacteria 8581
155 Ga0157369_10100455 3300013105 Bacteria 3084
156 Ga0157378_10089296 3300013297 Bacteria 2798
157 Ga0157372_10117267 3300013307 Bacteria 3053
158 Ga0157372_10284699 3300013307 Bacteria 1922
159 Ga0157375_10110205 3300013308 Bacteria 2850
160 Ga0157380_10299082 3300014326 Bacteria 1481
161 Ga0157379_10030366 3300014968 Bacteria 4810
162 Ga0182005_1037576 3300015265 Bacteria 1317
163 Ga0197907_10358968 3300020069 Bacteria 1465
164 Ga0197907_10621403 3300020069 Bacteria 1336
165 Ga0197907_10768012 3300020069 Bacteria 1391
166 Ga0197907_10983208 3300020069 Bacteria 1440
167 Ga0197907_11038918 3300020069 Bacteria 1653
168 Ga0206349_1519633 3300020075 Bacteria 2123
169 Ga0206351_10040353 3300020077 Bacteria 2461
170 Ga0206351_10967451 3300020077 Bacteria 1460
171 Ga0206352_10328706 3300020078 Bacteria 1701
172 Ga0206352_10423748 3300020078 Bacteria 1469
173 Ga0206350_10445704 3300020080 Bacteria 1517
174 Ga0206350_10489830 3300020080 Bacteria 1737
175 Ga0206350_10935520 3300020080 Unclassified 1363
176 Ga0206350_11336934 3300020080 Bacteria 1712
177 Ga0206354_10952510 3300020081 Bacteria 2623
178 Ga0206353_10588212 3300020082 Unclassified 1681
179 Ga0206353_11857616 3300020082 Bacteria 5299
180 Ga0206353_12019109 3300020082 Bacteria 2716
181 Ga0154015_1307906 3300020610 Bacteria 1884
182 Ga0213874_10003263 3300021377 Bacteria 3579
183 Ga0213874_10005763 3300021377 Bacteria 2902
184 Ga0213874_10012929 3300021377 Unclassified 2152
185 Ga0213876_10013507 3300021384 Bacteria 4335
186 Ga0213875_10000501 3300021388 Bacteria 32825
187 Ga0213875_10007882 3300021388 Bacteria 5474
188 Ga0213875_10031229 3300021388 Bacteria 2520
189 Ga0224712_10016677 3300022467 Bacteria 2419
190 Ga0224712_10022674 3300022467 Bacteria 2168
191 Ga0224712_10070293 3300022467 Bacteria 1419
192 Ga0224572_1005029 3300024225 Bacteria 2339
193 Ga0207653_10008805 3300025885 Bacteria 3147
194 Ga0207692_10000260 3300025898 Bacteria 18211
195 Ga0207699_10000522 3300025906 Bacteria 19005
196 Ga0207699_10004044 3300025906 Bacteria 7019
197 Ga0207699_10005230 3300025906 Bacteria 6210
198 Ga0207699_10012107 3300025906 Bacteria 4380
199 Ga0207699_10043224 3300025906 Unclassified 2616
200 Ga0207645_10083271 3300025907 Bacteria 2051
201 Ga0207705_10078098 3300025909 Bacteria 2409
202 Ga0207684_10000304 3300025910 Bacteria 69992
203 Ga0207684_10006176 3300025910 Bacteria 10954
204 Ga0207684_10014227 3300025910 Bacteria 6866
205 Ga0207684_10039662 3300025910 Bacteria 3992
206 Ga0207684_10107474 3300025910 Bacteria 2387
207 Ga0207684_10146707 3300025910 Bacteria 2030
208 Ga0207684_10163904 3300025910 Bacteria 1915
209 Ga0207684_10174207 3300025910 Bacteria 1854
210 Ga0207707_10000654 3300025912 Bacteria 34287
211 Ga0207707_10005866 3300025912 Bacteria 10734
212 Ga0207695_10067413 3300025913 Bacteria 3671
213 Ga0207693_10000783 3300025915 Bacteria 28458
214 Ga0207693_10003202 3300025915 Bacteria 14050
215 Ga0207693_10020888 3300025915 Bacteria 5205
216 Ga0207693_10022791 3300025915 Bacteria 4971
217 Ga0207693_10041084 3300025915 Bacteria 3642
218 Ga0207693_10054914 3300025915 Bacteria 3125
219 Ga0207693_10150301 3300025915 Bacteria 1832
220 Ga0207693_10154552 3300025915 Bacteria 1805
221 Ga0207663_10001104 3300025916 Bacteria 12404
222 Ga0207663_10003923 3300025916 Bacteria 7357
223 Ga0207663_10011716 3300025916 Bacteria 4717
224 Ga0207663_10021552 3300025916 Bacteria 3670
225 Ga0207663_10063971 3300025916 Bacteria 2345
226 Ga0207663_10070568 3300025916 Bacteria 2251
227 Ga0207660_10000383 3300025917 Bacteria 28961
228 Ga0207660_10003503 3300025917 Bacteria 10223
229 Ga0207660_10009683 3300025917 Bacteria 6235
230 Ga0207662_10025474 3300025918 Bacteria 3407
231 Ga0207657_10004757 3300025919 Bacteria 14335
232 Ga0207657_10012608 3300025919 Bacteria 8332
233 Ga0207657_10015593 3300025919 Bacteria 7354
234 Ga0207657_10038388 3300025919 Bacteria 4264
235 Ga0207657_10046870 3300025919 Bacteria 3784
236 Ga0207649_10059798 3300025920 Bacteria 2392
237 Ga0207652_10000629 3300025921 Bacteria 34954
238 Ga0207652_10060600 3300025921 Bacteria 3265
239 Ga0207646_10001035 3300025922 Bacteria 35522
240 Ga0207646_10001177 3300025922 Bacteria 33005
241 Ga0207646_10001555 3300025922 Bacteria 28083
242 Ga0207646_10006954 3300025922 Bacteria 11601
243 Ga0207646_10007619 3300025922 Bacteria 10963
244 Ga0207646_10018595 3300025922 Bacteria 6479
245 Ga0207646_10022777 3300025922 Bacteria 5761
246 Ga0207659_10115042 3300025926 Bacteria 2051
247 Ga0207687_10053797 3300025927 Bacteria 2814
248 Ga0207700_10000211 3300025928 Bacteria 34862
249 Ga0207700_10008172 3300025928 Bacteria 6462
250 Ga0207700_10013181 3300025928 Bacteria 5367
251 Ga0207700_10019667 3300025928 Bacteria 4565
252 Ga0207700_10024357 3300025928 Bacteria 4188
253 Ga0207700_10050236 3300025928 Bacteria 3107
254 Ga0207700_10089146 3300025928 Unclassified 2430
255 Ga0207700_10095832 3300025928 Bacteria 2354
256 Ga0207700_10150966 3300025928 Bacteria 1920
257 Ga0207700_10199271 3300025928 Bacteria 1686
258 Ga0207664_10000122 3300025929 Bacteria 68140
259 Ga0207664_10000453 3300025929 Bacteria 29102
260 Ga0207664_10008721 3300025929 Bacteria 7088
261 Ga0207664_10010168 3300025929 Bacteria 6640
262 Ga0207664_10021775 3300025929 Bacteria 4775
263 Ga0207664_10025589 3300025929 Bacteria 4449
264 Ga0207664_10034815 3300025929 Bacteria 3881
265 Ga0207664_10041403 3300025929 Bacteria 3588
266 Ga0207664_10055475 3300025929 Bacteria 3144
267 Ga0207644_10071558 3300025931 Bacteria 2537
268 Ga0207690_10126137 3300025932 Bacteria 1867
269 Ga0207706_10061391 3300025933 Bacteria 3310
270 Ga0207670_10093338 3300025936 Bacteria 2132
271 Ga0207669_10013791 3300025937 Bacteria 4030
272 Ga0207665_10000052 3300025939 Bacteria 74914
273 Ga0207665_10075106 3300025939 Bacteria 2314
274 Ga0207665_10085904 3300025939 Bacteria 2172
275 Ga0207691_10033815 3300025940 Bacteria 4759
276 Ga0207661_10004314 3300025944 Bacteria 9951
277 Ga0207661_10006614 3300025944 Bacteria 8192
278 Ga0207661_10037264 3300025944 Bacteria 3802
279 Ga0207661_10133149 3300025944 Bacteria 2132
280 Ga0207661_10155910 3300025944 Bacteria 1978
281 Ga0207651_10034699 3300025960 Bacteria 3271
282 Ga0207712_10057516 3300025961 Bacteria 2744
283 Ga0207677_10108395 3300026023 Bacteria 2062
284 Ga0207678_10002186 3300026067 Bacteria 17665
285 Ga0207678_10033499 3300026067 Bacteria 4474
286 Ga0207708_10060425 3300026075 Bacteria 2893
287 Ga0207702_10062839 3300026078 Bacteria 3173
288 Ga0207702_10074304 3300026078 Bacteria 2934
289 Ga0207641_10032829 3300026088 Bacteria 4312
290 Ga0207674_10002613 3300026116 Bacteria 22584
291 Ga0207674_10102931 3300026116 Bacteria 2835
292 Ga0207674_10112581 3300026116 Bacteria 2695
293 Ga0207675_100019776 3300026118 Bacteria 6286
294 Ga0207683_10001474 3300026121 Bacteria 21196
295 Ga0268265_10235363 3300028380 Bacteria 1613
296 Ga0265337_1001178 3300028556 Bacteria 13321
297 Ga0265319_1001961 3300028563 Bacteria 11639
298 Ga0265334_10001149 3300028573 Bacteria 12936
299 Ga0265318_10008285 3300028577 Bacteria 4636
300 Ga0265323_10021042 3300028653 Bacteria 2503
301 Ga0265336_10049707 3300028666 Unclassified 1269
302 Ga0265338_10012278 3300028800 Bacteria 9779
303 Ga0265324_10005120 3300029957 Bacteria 5728
304 Ga0316181_1036461 3300030744 Bacteria 4731
305 Ga0265332_10041967 3300031238 Bacteria 1978
306 Ga0265320_10007404 3300031240 Bacteria 6816
307 Ga0265325_10014637 3300031241 Bacteria 4427
308 Ga0265340_10004989 3300031247 Bacteria 7377
309 Ga0265339_10087784 3300031249 Bacteria 1634
310 Ga0265316_10003419 3300031344 Bacteria 16065
311 Ga0307513_10001441 3300031456 Bacteria 34231
312 Ga0265313_10002734 3300031595 Bacteria 14913
313 Ga0265342_10001585 3300031712 Bacteria 20992
314 Ga0307409_100044062 3300031995 Bacteria 3357
315 Ga0307416_100197173 3300032002 Bacteria 1906
316 Ga0307415_100164427 3300032126 Bacteria 1724
317 Ga0307415_100226261 3300032126 Bacteria 1503
318 Ga0373926_0000529 3300035083 Bacteria 10214
319 Ga0373926_0009754 3300035083 Bacteria 3208
320 Ga0373934_0000415 3300035086 Bacteria 14940
321 Ga0373934_0037983 3300035086 Unclassified 1896
322 Ga0373944_0001519 3300035089 Bacteria 5879
323 Ga0373944_0001673 3300035089 Bacteria 5607
324 Ga0373923_0079678 3300035111 Unclassified 1419
325 Ga0373932_0019114 3300035112 Bacteria 1782
326 Ga0373936_0004289 3300035113 Bacteria 5387
327 Ga0373953_0041693 3300035117 Unclassified 1827
328 Ga0373954_0018305 3300035118 Bacteria 3152
329 Ga0373956_0000476 3300035119 Bacteria 16441
330 Ga0373956_0016748 3300035119 Bacteria 3080
331 Ga0373956_0036431 3300035119 Bacteria 2171
332 Ga0373957_0000506 3300035120 Bacteria 9767
333 Ga0373957_0000665 3300035120 Bacteria 8844
334 Ga0373957_0018640 3300035120 Bacteria 2434
335 Ga0373943_0004681 3300035170 Bacteria 6189
336 Ga0373946_0002867 3300035171 Bacteria 6109
337 Ga0373946_0004328 3300035171 Bacteria 5078
338 Ga0373955_0000004 3300035172 Bacteria 108650
339 Ga0373955_0005415 3300035172 Bacteria 5736
340 Ga0373955_0005912 3300035172 Bacteria 5535
341 Ga0373955_0017668 3300035172 Bacteria 3533
342 Ga0373955_0063411 3300035172 Bacteria 2046
343 Ga0373955_0092407 3300035172 Unclassified 1726
344 Ga0373924_0000854 3300035410 Bacteria 9582
345 Ga0373924_0006113 3300035410 Bacteria 4299
346 Ga0373924_0040858 3300035410 Bacteria 1899
347 Ga0373935_0041578 3300035692 Bacteria 2888
348 Ga0373927_0002586 3300035695 Bacteria 13198
349 Ga0373933_0000005 3300035724 Bacteria 128820
350 Ga0373933_0023399 3300035724 Bacteria 3528
351 Ga0373933_0023726 3300035724 Bacteria 3507
352 Ga0373933_0027163 3300035724 Bacteria 3293
353 Ga0373933_0044744 3300035724 Bacteria 2623
354 Ga0373933_0071469 3300035724 Bacteria 2113
355 Ga0373947_0002056 3300035725 Bacteria 12272
356 Ga0373947_0006281 3300035725 Bacteria 6907
357 Ga0373947_0097650 3300035725 Bacteria 1841
358 Ga0373937_0000077 3300036401 Bacteria 89075
359 Ga0373937_0008718 3300036401 Bacteria 8810
360 Ga0373937_0017337 3300036401 Bacteria 6414
361 Ga0373937_0037855 3300036401 Bacteria 4396
362 Ga0373937_0054858 3300036401 Bacteria 3657
363 Ga0373937_0106173 3300036401 Bacteria 2610
364 Ga0373937_0331932 3300036401 Bacteria 1439
365 Ga0373925_0000153 3300037068 Bacteria 73990
366 Ga0373925_0002811 3300037068 Bacteria 13741
367 Ga0373925_0031553 3300037068 Bacteria 3894
368 Ga0373925_0042213 3300037068 Bacteria 3383
369 Ga0395899_0060302 3300037312 Bacteria 2795
370 Ga0395898_0009496 3300037466 Bacteria 10214
371 Ga0395898_0021754 3300037466 Bacteria 6499
372 Ga0395898_0053717 3300037466 Bacteria 3934
373 Ga0395905_0006853 3300037471 Bacteria 11391
374 Ga0436364_0193728 3300037853 Bacteria 39312
375 Ga0436364_0437726 3300037853 Bacteria 7301
376 Ga0436364_0541300 3300037853 Bacteria 17363
377 Ga0436364_0610522 3300037853 Bacteria 2202
378 Ga0436364_0614465 3300037853 Bacteria 45940
379 Ga0436364_0617202 3300037853 Bacteria 29703
380 Ga0436364_1064013 3300037853 Bacteria 3799
381 Ga0395901_0022296 3300038443 Bacteria 6489
382 Ga0395901_0147178 3300038443 Bacteria 2475
383 Ga0395901_0168277 3300038443 Bacteria 2300
384 Ga0436365_0408680 3300039437 Bacteria 14684
385 Ga0436365_0838871 3300039437 Bacteria 4543
386 Ga0436365_1528513 3300039437 Bacteria 4550
387 Ga0436365_1554923 3300039437 Bacteria 9931
388 Ga0436363_1262730 3300039450 Bacteria 6204
389 Ga0436363_1297689 3300039450 Bacteria 6056
390 Ga0436363_1323463 3300039450 Bacteria 3495
391 Ga0436363_1359460 3300039450 Bacteria 3079
392 Ga0436363_1444078 3300039450 Bacteria 6144
393 Ga0436363_1531465 3300039450 Bacteria 2917
394 Ga0436363_1607112 3300039450 Bacteria 4522
395 Ga0436362_0475719 3300039453 Bacteria 7861
396 Ga0466969_0008195 3300044656 Bacteria 5546
397 Ga0466965_0045735 3300044683 Bacteria 2166
398 Ga0466966_0031567 3300044684 Bacteria 3435
399 Ga0466966_0085236 3300044684 Bacteria 1964
400 Ga0466961_0037666 3300044693 Bacteria 3103
401 Ga0466961_0039602 3300044693 Bacteria 3021
402 Ga0466963_0018109 3300044694 Bacteria 4398
403 Ga0466963_0021895 3300044694 Bacteria 4040
404 Ga0466963_0053186 3300044694 Bacteria 2688
405 Ga0466971_0027887 3300044719 Bacteria 2529
406 Ga0466957_0005052 3300044842 Bacteria 7384
407 Ga0466959_0034822 3300045049 Bacteria 3725
408 Ga0466959_0047156 3300045049 Bacteria 3170
409 Ga0466959_0146228 3300045049 Bacteria 1668
410 Ga0466958_0012924 3300045836 Bacteria 4742
411 Ga0466958_0140492 3300045836 Bacteria 1520
412 Ga0466967_0008479 3300045976 Bacteria 7540
413 Ga0466967_0012164 3300045976 Bacteria 6566
414 Ga0466967_0013303 3300045976 Bacteria 6351
415 Ga0466967_0038241 3300045976 Bacteria 4113
416 Ga0466967_0070100 3300045976 Bacteria 3135
417 Ga0466967_0148874 3300045976 Bacteria 2186
418 Ga0495592_0000010 3300046454 Bacteria 157001
419 Ga0495592_0033716 3300046454 Bacteria 3861
420 Ga0495592_0049643 3300046454 Bacteria 3118
421 Ga0495592_0058409 3300046454 Bacteria 2845
422 Ga0495592_0063002 3300046454 Bacteria 2720
423 Ga0495592_0174515 3300046454 Bacteria 1469
424 Ga0495603_0046360 3300046455 Bacteria 2590
425 Ga0495629_0005204 3300046459 Bacteria 9741
426 Ga0495629_0012726 3300046459 Bacteria 6092
427 Ga0495629_0032689 3300046459 Bacteria 3682
428 Ga0495641_0001209 3300046461 Bacteria 22153
429 Ga0495641_0007724 3300046461 Bacteria 6669
430 Ga0495641_0008684 3300046461 Bacteria 6146
431 Ga0495651_0000006 3300046462 Bacteria 171575
432 Ga0495651_0003311 3300046462 Bacteria 12370
433 Ga0495651_0008483 3300046462 Bacteria 7875
434 Ga0495651_0022866 3300046462 Bacteria 4861
435 Ga0495651_0029306 3300046462 Bacteria 4291
436 Ga0495651_0030748 3300046462 Bacteria 4186
437 Ga0495651_0069479 3300046462 Bacteria 2682
438 Ga0495653_0029654 3300046463 Bacteria 4364
439 Ga0495653_0043083 3300046463 Bacteria 3511
440 Ga0495653_0054715 3300046463 Bacteria 3048
441 Ga0495582_0001277 3300046473 Bacteria 14138
442 Ga0495582_0132751 3300046473 Bacteria 1407
443 Ga0495639_0001779 3300046475 Bacteria 9549
444 Ga0495639_0006433 3300046475 Bacteria 5055
445 Ga0495662_0000438 3300046476 Bacteria 18719
446 Ga0495662_0005432 3300046476 Bacteria 6379
447 Ga0495664_0000703 3300046477 Bacteria 17024
448 Ga0495664_0002025 3300046477 Bacteria 10827
449 Ga0495664_0012160 3300046477 Bacteria 4871
450 Ga0495664_0022877 3300046477 Bacteria 3625
451 Ga0495664_0023345 3300046477 Bacteria 3590
452 Ga0495664_0047186 3300046477 Bacteria 2555
453 Ga0495608_0000161 3300046511 Bacteria 47857
454 Ga0495608_0004587 3300046511 Bacteria 9870
455 Ga0495608_0007761 3300046511 Bacteria 7556
456 Ga0495608_0017738 3300046511 Bacteria 4921
457 Ga0495608_0017943 3300046511 Bacteria 4891
458 Ga0495608_0020857 3300046511 Bacteria 4501
459 Ga0495608_0021586 3300046511 Bacteria 4419
460 Ga0495608_0147293 3300046511 Bacteria 1501
461 Ga0495618_0008253 3300046514 Bacteria 6308
462 Ga0495618_0025715 3300046514 Bacteria 3655
463 Ga0495618_0029222 3300046514 Bacteria 3438
464 Ga0495618_0049297 3300046514 Bacteria 2659
465 Ga0495618_0145223 3300046514 Bacteria 1517
466 Ga0495628_0005475 3300046516 Bacteria 11117
467 Ga0495628_0010850 3300046516 Bacteria 7712
468 Ga0495628_0015650 3300046516 Bacteria 6332
469 Ga0495628_0059235 3300046516 Bacteria 3007
470 Ga0495628_0113284 3300046516 Bacteria 2084
471 Ga0495628_0162330 3300046516 Unclassified 1697
472 Ga0495666_0001008 3300046526 Bacteria 13337
473 Ga0495666_0036524 3300046526 Bacteria 2393
474 Ga0495652_0004827 3300046529 Bacteria 12820
475 Ga0495652_0005532 3300046529 Bacteria 11884
476 Ga0495652_0023905 3300046529 Bacteria 5412
477 Ga0495652_0035434 3300046529 Bacteria 4343
478 Ga0495652_0051256 3300046529 Bacteria 3525
479 Ga0495652_0169816 3300046529 Bacteria 1685
480 Ga0495665_0000615 3300046531 Bacteria 18098
481 Ga0495665_0009737 3300046531 Bacteria 5201
482 Ga0495665_0019745 3300046531 Bacteria 3624
483 Ga0495640_0003463 3300046533 Bacteria 12702
484 Ga0495640_0032737 3300046533 Bacteria 3699
485 Ga0495640_0083853 3300046533 Bacteria 2115
486 Ga0495586_0008545 3300046535 Bacteria 5451
487 Ga0495586_0023756 3300046535 Bacteria 3273
488 Ga0495587_0000152 3300046536 Bacteria 51432
489 Ga0495587_0005082 3300046536 Bacteria 8601
490 Ga0495587_0022458 3300046536 Bacteria 3885
491 Ga0495587_0022633 3300046536 Bacteria 3868
492 Ga0495587_0023313 3300046536 Bacteria 3803
493 Ga0495587_0028458 3300046536 Bacteria 3398
494 Ga0495587_0028459 3300046536 Bacteria 3398
495 Ga0495587_0075038 3300046536 Bacteria 1963
496 Ga0495645_0002116 3300046543 Bacteria 13480
497 Ga0495645_0026301 3300046543 Bacteria 4223
498 Ga0495645_0033262 3300046543 Bacteria 3761
499 Ga0495645_0046605 3300046543 Bacteria 3159
500 Ga0495667_0000153 3300046559 Bacteria 46974
501 Ga0495667_0000634 3300046559 Bacteria 22314
502 Ga0495667_0004286 3300046559 Bacteria 9619
503 Ga0495667_0011026 3300046559 Bacteria 6111
504 Ga0495667_0012041 3300046559 Bacteria 5857
505 Ga0495667_0014094 3300046559 Bacteria 5395
506 Ga0495667_0030286 3300046559 Bacteria 3638
507 Ga0495667_0046702 3300046559 Bacteria 2862
508 Ga0495667_0070511 3300046559 Bacteria 2279
509 Ga0495634_0008304 3300046642 Bacteria 7737
510 Ga0495634_0030940 3300046642 Bacteria 3689
511 Ga0495634_0039566 3300046642 Bacteria 3211
512 Ga0495634_0048603 3300046642 Bacteria 2856
513 Ga0495634_0098070 3300046642 Bacteria 1896
514 Ga0495634_0100889 3300046642 Bacteria 1865
515 Ga0495635_0000969 3300046663 Bacteria 18900
516 Ga0495635_0002118 3300046663 Bacteria 13471
517 Ga0495635_0013038 3300046663 Bacteria 5819
518 Ga0495635_0035731 3300046663 Bacteria 3445
519 Ga0495635_0073701 3300046663 Bacteria 2339
520 Ga0495635_0093288 3300046663 Bacteria 2058
521 Ga0495657_0000082 3300046675 Bacteria 85101
522 Ga0495657_0009845 3300046675 Bacteria 7212
523 Ga0495657_0011883 3300046675 Bacteria 6489
524 Ga0495657_0013758 3300046675 Bacteria 5957
525 Ga0495657_0015842 3300046675 Bacteria 5506
526 Ga0495657_0037737 3300046675 Bacteria 3327
527 Ga0495657_0039820 3300046675 Bacteria 3227
528 Ga0495657_0065582 3300046675 Bacteria 2387
529 Ga0495599_0000028 3300046678 Bacteria 113952
530 Ga0495599_0024317 3300046678 Bacteria 3788
531 Ga0495599_0029610 3300046678 Bacteria 3432
532 Ga0495599_0036569 3300046678 Bacteria 3084
533 Ga0495623_0000746 3300046679 Bacteria 21773
534 Ga0495623_0007162 3300046679 Bacteria 7242
535 Ga0495623_0021487 3300046679 Bacteria 4167
536 Ga0495646_0035556 3300046680 Bacteria 3089
537 Ga0495646_0042159 3300046680 Bacteria 2801
538 Ga0495646_0054077 3300046680 Bacteria 2417
539 Ga0495646_0090545 3300046680 Bacteria 1767
540 Ga0495646_0133274 3300046680 Bacteria 1397
541 Ga0495658_0024747 3300046683 Bacteria 3201
542 Ga0495613_0001172 3300046689 Bacteria 19992
543 Ga0495613_0031241 3300046689 Bacteria 3955
544 Ga0495613_0118305 3300046689 Bacteria 1905
545 Ga0495624_0004182 3300046690 Bacteria 10611
546 Ga0495624_0011390 3300046690 Bacteria 6111
547 Ga0495624_0013877 3300046690 Bacteria 5484
548 Ga0495600_0002631 3300046809 Bacteria 10358
549 Ga0495600_0009958 3300046809 Bacteria 5888
550 Ga0495600_0044844 3300046809 Bacteria 2884
551 Ga0495600_0074720 3300046809 Bacteria 2213
552 Ga0495600_0138231 3300046809 Bacteria 1581
553 Ga0495600_0163855 3300046809 Bacteria 1436
554 Ga0495581_0001358 3300047315 Bacteria 13543
555 Ga0495581_0012400 3300047315 Bacteria 4938
556 Ga0495581_0033786 3300047315 Bacteria 2960
557 Ga0495604_0000086 3300047317 Bacteria 79200
558 Ga0495604_0000380 3300047317 Bacteria 40074
559 Ga0495604_0002931 3300047317 Bacteria 13668
560 Ga0495604_0005120 3300047317 Bacteria 10377
561 Ga0495604_0015793 3300047317 Bacteria 6026
562 Ga0495604_0145182 3300047317 Bacteria 1691
563 Ga0495674_0002882 3300047319 Bacteria 16731
564 Ga0495674_0003593 3300047319 Bacteria 15080
565 Ga0495674_0046975 3300047319 Bacteria 3830
566 Ga0495674_0131665 3300047319 Bacteria 2107
567 Ga0495674_0222069 3300047319 Bacteria 1561
568 Ga0495676_0006369 3300047321 Bacteria 10874
569 Ga0495680_0000326 3300047322 Bacteria 53618
570 Ga0495680_0003505 3300047322 Bacteria 15388
571 Ga0495680_0004337 3300047322 Bacteria 13590
572 Ga0495680_0005787 3300047322 Bacteria 11569
573 Ga0495680_0014272 3300047322 Bacteria 6886
574 Ga0495680_0039401 3300047322 Bacteria 3770
575 Ga0495680_0051860 3300047322 Bacteria 3200
576 Ga0495680_0054107 3300047322 Bacteria 3118
577 Ga0495680_0065880 3300047322 Bacteria 2773
578 Ga0495675_0000729 3300047444 Bacteria 20553
579 Ga0495675_0006332 3300047444 Bacteria 7247
580 Ga0495675_0018230 3300047444 Bacteria 4455
581 Ga0495675_0019430 3300047444 Bacteria 4317
582 Ga0495684_0004137 3300047471 Bacteria 11333
583 Ga0495684_0004649 3300047471 Bacteria 10713
584 Ga0495684_0026389 3300047471 Bacteria 4464
585 Ga0495684_0050580 3300047471 Bacteria 3172
586 Ga0495684_0059454 3300047471 Bacteria 2910
587 Ga0495684_0074657 3300047471 Bacteria 2576
588 Ga0495684_0110363 3300047471 Bacteria 2076
589 Ga0495593_0009241 3300047673 Bacteria 5716
590 Ga0495593_0028905 3300047673 Bacteria 3043
591 Ga0495602_0000049 3300048088 Bacteria 114354
592 Ga0495602_0059098 3300048088 Bacteria 3350
593 Ga0495602_0081890 3300048088 Bacteria 2711
594 Ga0495602_0136076 3300048088 Bacteria 1951
595 Ga0495602_0153212 3300048088 Bacteria 1808
596 Ga0495602_0189884 3300048088 Bacteria 1576
597 Ga0495614_0001493 3300048089 Bacteria 10123
598 Ga0496101_0208185 3300048904 Bacteria 1514
599 Ga0496104_0000030 3300048907 Bacteria 201919
600 Ga0496104_0068929 3300048907 Bacteria 3361
601 Ga0496104_0090677 3300048907 Unclassified 2921
602 Ga0496104_0239767 3300048907 Bacteria 1725
603 Ga0496110_0000690 3300048913 Bacteria 23269
604 Ga0496110_0165457 3300048913 Bacteria 2006
605 Ga0496110_0180945 3300048913 Bacteria 1914
606 Ga0496110_0488609 3300048913 Unclassified 1121
607 Ga0496111_0003130 3300048914 Bacteria 10180
608 Ga0496111_0128711 3300048914 Bacteria 1872
609 Ga0496113_0037325 3300048916 Bacteria 3564
610 Ga0496114_0094476 3300048917 Bacteria 2543
611 Ga0496126_0017472 3300048929 Bacteria 7145
612 Ga0501042_0006227 3300049578 Bacteria 7746
613 nmdc:mga05p37_23596_c1 3300050507 Bacteria 7466
614 nmdc:mga06r32_227710_c1 3300050510 Bacteria 1852
615 nmdc:mga08y16_337209_c1 3300050511 Bacteria 1550
616 nmdc:mga0n895_128412_c1 3300050512 Bacteria 2560
617 nmdc:mga0rr50_158231_c1 3300050513 Bacteria 1837
618 nmdc:mga0rr50_68970_c1 3300050513 Bacteria 2690
619 nmdc:mga08x19_29753_c1 3300050514 Bacteria 3427
620 nmdc:mga0a205_108059_c1 3300050515 Bacteria 2680
621 Ga0495601_0049207 3300053077 Bacteria 2657
622 Ga0495601_0170770 3300053077 Bacteria 1421
623 Ga0495612_0000809 3300053078 Bacteria 12742
624 Ga0495612_0033590 3300053078 Bacteria 2076
625 Ga0495595_0000194 3300053084 Bacteria 24737
626 Ga0495619_0000751 3300053085 Bacteria 21143
627 Ga0495619_0001138 3300053085 Bacteria 17467
628 Ga0495619_0023403 3300053085 Unclassified 3960
629 Ga0500616_0003685 3300053153 Bacteria 11481
630 Ga0466962_0055902 3300061719 Bacteria 1886
631 Ga0466962_0082346 3300061719 Bacteria 1539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015265 Ga0182005_1037576 Ga0182005_10375761 346
2 3300028666 Ga0265336_10049707 Ga0265336_100497071 351
3 3300044684 Ga0466966_0085236 Ga0466966_0085236_361_1452 355
4 3300048913 Ga0496110_0488609 Ga0496110_0488609_11_1102 355
5 3300006173 Ga0070716_100015538 Ga0070716_1000155383 366
6 3300025906 Ga0207699_10012107 Ga0207699_100121074 366
7 3300025916 Ga0207663_10063971 Ga0207663_100639712 366
8 3300025929 Ga0207664_10025589 Ga0207664_100255894 366
9 3300048904 Ga0496101_0208185 Ga0496101_0208185_170_1504 366
10 3300048907 Ga0496104_0239767 Ga0496104_0239767_256_1590 366
11 3300048916 Ga0496113_0037325 Ga0496113_0037325_119_1450 366
12 3300048917 Ga0496114_0094476 Ga0496114_0094476_359_1693 366
13 3300050513 nmdc:mga0rr50_68970_c1 nmdc:mga0rr50_68970_c1_856_2187 366
14 3300050514 nmdc:mga08x19_29753_c1 nmdc:mga08x19_29753_c1_728_2059 366
15 3300050515 nmdc:mga0a205_108059_c1 nmdc:mga0a205_108059_c1_800_2131 366
16 3300009177 Ga0105248_10117171 Ga0105248_101171713 369
17 3300035119 Ga0373956_0016748 Ga0373956_0016748_138_1400 369
18 3300035724 Ga0373933_0023726 Ga0373933_0023726_603_1865 369
19 3300036401 Ga0373937_0037855 Ga0373937_0037855_2796_4058 369
20 3300046462 Ga0495651_0003311 Ga0495651_0003311_4006_5268 369
21 3300046511 Ga0495608_0021586 Ga0495608_0021586_1437_2699 369
22 3300046514 Ga0495618_0145223 Ga0495618_0145223_149_1411 369
23 3300046529 Ga0495652_0051256 Ga0495652_0051256_522_1784 369
24 3300046559 Ga0495667_0012041 Ga0495667_0012041_2785_4047 369
25 3300046675 Ga0495657_0015842 Ga0495657_0015842_2312_3574 369
26 3300047322 Ga0495680_0005787 Ga0495680_0005787_8468_9730 369
27 3300044683 Ga0466965_0045735 Ga0466965_0045735_68_1369 372
28 3300061719 Ga0466962_0082346 Ga0466962_0082346_158_1459 372
29 3300022467 Ga0224712_10016677 Ga0224712_100166772 374
30 3300009098 Ga0105245_10185811 Ga0105245_101858112 380
31 3300046454 Ga0495592_0063002 Ga0495592_0063002_1434_2630 381
32 3300046462 Ga0495651_0029306 Ga0495651_0029306_2766_3962 381
33 3300046511 Ga0495608_0017738 Ga0495608_0017738_1730_2926 381
34 3300046514 Ga0495618_0029222 Ga0495618_0029222_1341_2537 381
35 3300046642 Ga0495634_0100889 Ga0495634_0100889_77_1273 381
36 3300037466 Ga0395898_0053717 Ga0395898_0053717_1778_3088 382
37 3300038443 Ga0395901_0168277 Ga0395901_0168277_223_1533 382
38 3300044684 Ga0466966_0031567 Ga0466966_0031567_1209_2549 382
39 3300046477 Ga0495664_0022877 Ga0495664_0022877_19_1335 382
40 3300047319 Ga0495674_0046975 Ga0495674_0046975_1622_2938 382
41 3300021388 Ga0213875_10007882 Ga0213875_100078824 383
42 3300037853 Ga0436364_0541300 Ga0436364_0541300_9886_11199 383
43 3300048907 Ga0496104_0090677 Ga0496104_0090677_36_1208 383
44 3300005518 Ga0070699_100041918 Ga0070699_1000419181 384
45 3300025922 Ga0207646_10006954 Ga0207646_100069547 385
46 3300044693 Ga0466961_0039602 Ga0466961_0039602_1637_2980 385
47 3300045836 Ga0466958_0012924 Ga0466958_0012924_27_1379 385
48 3300035086 Ga0373934_0037983 Ga0373934_0037983_208_1524 387
49 3300035118 Ga0373954_0018305 Ga0373954_0018305_1605_2945 387
50 3300035172 Ga0373955_0005415 Ga0373955_0005415_4325_5641 387
51 3300035724 Ga0373933_0044744 Ga0373933_0044744_61_1377 387
52 3300036401 Ga0373937_0054858 Ga0373937_0054858_465_1805 387
53 3300044656 Ga0466969_0008195 Ga0466969_0008195_433_1785 387
54 3300045976 Ga0466967_0070100 Ga0466967_0070100_582_1886 387
55 3300046454 Ga0495592_0058409 Ga0495592_0058409_328_1668 387
56 3300046462 Ga0495651_0022866 Ga0495651_0022866_590_1930 387
57 3300046463 Ga0495653_0029654 Ga0495653_0029654_2125_3465 387
58 3300046511 Ga0495608_0007761 Ga0495608_0007761_482_1822 387
59 3300046535 Ga0495586_0023756 Ga0495586_0023756_1852_3192 387
60 3300046536 Ga0495587_0022633 Ga0495587_0022633_1031_2347 387
61 3300046543 Ga0495645_0046605 Ga0495645_0046605_1430_2770 387
62 3300046678 Ga0495599_0036569 Ga0495599_0036569_1156_2496 387
63 3300046680 Ga0495646_0042159 Ga0495646_0042159_1349_2689 387
64 3300046809 Ga0495600_0138231 Ga0495600_0138231_120_1460 387
65 3300047315 Ga0495581_0033786 Ga0495581_0033786_1487_2827 387
66 3300047322 Ga0495680_0065880 Ga0495680_0065880_34_1350 387
67 3300048088 Ga0495602_0059098 Ga0495602_0059098_1800_3116 387
68 3300048088 Ga0495602_0189884 Ga0495602_0189884_26_1342 387
69 3300053077 Ga0495601_0170770 Ga0495601_0170770_51_1367 387
70 3300061719 Ga0466962_0055902 Ga0466962_0055902_64_1365 387
71 3300005435 Ga0070714_100048209 Ga0070714_1000482092 388
72 3300005436 Ga0070713_100039871 Ga0070713_1000398715 388
73 3300005471 Ga0070698_100137514 Ga0070698_1001375141 388
74 3300005518 Ga0070699_100116526 Ga0070699_1001165262 388
75 3300006028 Ga0070717_10019483 Ga0070717_100194837 388
76 3300006175 Ga0070712_100048048 Ga0070712_1000480484 388
77 3300013307 Ga0157372_10117267 Ga0157372_101172672 388
78 3300020080 Ga0206350_10445704 Ga0206350_104457042 388
79 3300025915 Ga0207693_10041084 Ga0207693_100410844 388
80 3300025928 Ga0207700_10008172 Ga0207700_100081724 388
81 3300013105 Ga0157369_10100455 Ga0157369_101004553 389
82 3300020077 Ga0206351_10967451 Ga0206351_109674511 389
83 3300025915 Ga0207693_10022791 Ga0207693_100227916 389
84 3300025916 Ga0207663_10070568 Ga0207663_100705682 389
85 3300037853 Ga0436364_0610522 Ga0436364_0610522_622_1818 389
86 3300037853 Ga0436364_1064013 Ga0436364_1064013_116_1312 389
87 3300039437 Ga0436365_1554923 Ga0436365_1554923_8237_9433 389
88 3300039450 Ga0436363_1262730 Ga0436363_1262730_1302_2498 389
89 3300046559 Ga0495667_0004286 Ga0495667_0004286_4165_5361 389
90 3300046679 Ga0495623_0021487 Ga0495623_0021487_1506_2702 389
91 3300047471 Ga0495684_0004649 Ga0495684_0004649_9396_10592 389
92 3300048907 Ga0496104_0068929 Ga0496104_0068929_1715_2911 389
93 3300020069 Ga0197907_10983208 Ga0197907_109832081 390
94 3300020069 Ga0197907_11038918 Ga0197907_110389182 390
95 3300037068 Ga0373925_0002811 Ga0373925_0002811_9590_10906 390
96 3300005445 Ga0070708_100021384 Ga0070708_1000213844 391
97 3300005518 Ga0070699_100000219 Ga0070699_1000002193 391
98 3300006028 Ga0070717_10020438 Ga0070717_100204386 391
99 3300013104 Ga0157370_10138803 Ga0157370_101388032 391
100 3300013105 Ga0157369_10015531 Ga0157369_100155317 391
101 3300025922 Ga0207646_10007619 Ga0207646_100076193 391
102 3300005434 Ga0070709_10014506 Ga0070709_100145063 392
103 3300005436 Ga0070713_100228177 Ga0070713_1002281771 392
104 3300005439 Ga0070711_100009183 Ga0070711_1000091832 392
105 3300005577 Ga0068857_100019359 Ga0068857_1000193591 392
106 3300005983 Ga0081540_1000548 Ga0081540_100054815 392
107 3300025915 Ga0207693_10000783 Ga0207693_1000078323 392
108 3300025916 Ga0207663_10021552 Ga0207663_100215522 392
109 3300035725 Ga0373947_0097650 Ga0373947_0097650_300_1661 392
110 3300044693 Ga0466961_0037666 Ga0466961_0037666_41_1327 392
111 3300044694 Ga0466963_0018109 Ga0466963_0018109_2924_4273 392
112 3300046809 Ga0495600_0163855 Ga0495600_0163855_98_1402 392
113 3300005339 Ga0070660_100015509 Ga0070660_1000155093 393
114 3300005366 Ga0070659_100160034 Ga0070659_1001600342 393
115 3300005436 Ga0070713_100094594 Ga0070713_1000945943 393
116 3300005467 Ga0070706_100091238 Ga0070706_1000912382 393
117 3300005536 Ga0070697_100049225 Ga0070697_1000492252 393
118 3300005614 Ga0068856_100036180 Ga0068856_1000361802 393
119 3300009176 Ga0105242_10024359 Ga0105242_100243593 393
120 3300025910 Ga0207684_10039662 Ga0207684_100396623 393
121 3300025919 Ga0207657_10015593 Ga0207657_100155938 393
122 3300025932 Ga0207690_10126137 Ga0207690_101261372 393
123 3300025944 Ga0207661_10133149 Ga0207661_101331492 393
124 3300036401 Ga0373937_0008718 Ga0373937_0008718_10_1299 393
125 3300046679 Ga0495623_0007162 Ga0495623_0007162_798_2111 393
126 3300047317 Ga0495604_0005120 Ga0495604_0005120_5111_6424 393
127 3300047444 Ga0495675_0006332 Ga0495675_0006332_803_2116 393
128 3300005455 Ga0070663_100146738 Ga0070663_1001467382 394
129 3300005535 Ga0070684_100194653 Ga0070684_1001946531 394
130 3300006028 Ga0070717_10003170 Ga0070717_100031703 394
131 3300020082 Ga0206353_11857616 Ga0206353_118576162 394
132 3300025928 Ga0207700_10199271 Ga0207700_101992711 394
133 3300026067 Ga0207678_10033499 Ga0207678_100334992 394
134 3300044694 Ga0466963_0021895 Ga0466963_0021895_2462_3763 394
135 3300045976 Ga0466967_0013303 Ga0466967_0013303_4945_6255 394
136 3300005434 Ga0070709_10044225 Ga0070709_100442253 395
137 3300006175 Ga0070712_100058703 Ga0070712_1000587032 395
138 3300026078 Ga0207702_10062839 Ga0207702_100628392 395
139 3300026116 Ga0207674_10102931 Ga0207674_101029313 395
140 3300032126 Ga0307415_100226261 Ga0307415_1002262611 395
141 3300035086 Ga0373934_0000415 Ga0373934_0000415_13529_14839 395
142 3300035119 Ga0373956_0000476 Ga0373956_0000476_6841_8151 395
143 3300035120 Ga0373957_0000665 Ga0373957_0000665_5318_6628 395
144 3300035120 Ga0373957_0018640 Ga0373957_0018640_165_1499 395
145 3300035172 Ga0373955_0000004 Ga0373955_0000004_6880_8190 395
146 3300035410 Ga0373924_0006113 Ga0373924_0006113_1008_2318 395
147 3300035724 Ga0373933_0000005 Ga0373933_0000005_5315_6625 395
148 3300036401 Ga0373937_0000077 Ga0373937_0000077_5310_6620 395
149 3300037068 Ga0373925_0000153 Ga0373925_0000153_41233_42588 395
150 3300039450 Ga0436363_1359460 Ga0436363_1359460_824_2131 395
151 3300046454 Ga0495592_0000010 Ga0495592_0000010_22814_24124 395
152 3300046462 Ga0495651_0000006 Ga0495651_0000006_131168_132478 395
153 3300046511 Ga0495608_0000161 Ga0495608_0000161_7476_8786 395
154 3300046516 Ga0495628_0005475 Ga0495628_0005475_19_1329 395
155 3300046529 Ga0495652_0004827 Ga0495652_0004827_6254_7564 395
156 3300046536 Ga0495587_0000152 Ga0495587_0000152_22801_24111 395
157 3300046559 Ga0495667_0000153 Ga0495667_0000153_39401_40711 395
158 3300046675 Ga0495657_0000082 Ga0495657_0000082_10527_11837 395
159 3300046678 Ga0495599_0000028 Ga0495599_0000028_39401_40711 395
160 3300046679 Ga0495623_0000746 Ga0495623_0000746_5876_7186 395
161 3300047317 Ga0495604_0000086 Ga0495604_0000086_73273_74583 395
162 3300047322 Ga0495680_0000326 Ga0495680_0000326_5292_6602 395
163 3300047444 Ga0495675_0000729 Ga0495675_0000729_14653_15963 395
164 3300048088 Ga0495602_0000049 Ga0495602_0000049_22817_24127 395
165 3300053084 Ga0495595_0000194 Ga0495595_0000194_22191_23501 395
166 3300005985 Ga0081539_10008851 Ga0081539_100088518 396
167 3300006028 Ga0070717_10010287 Ga0070717_100102875 396
168 3300025928 Ga0207700_10095832 Ga0207700_100958322 396
169 3300039453 Ga0436362_0475719 Ga0436362_0475719_5230_6570 396
170 3300044694 Ga0466963_0053186 Ga0466963_0053186_757_2046 396
171 3300045976 Ga0466967_0008479 Ga0466967_0008479_2964_4253 396
172 3300046533 Ga0495640_0003463 Ga0495640_0003463_9177_10511 396
173 3300046680 Ga0495646_0054077 Ga0495646_0054077_607_1911 396
174 3300047319 Ga0495674_0003593 Ga0495674_0003593_8235_9569 396
175 3300047471 Ga0495684_0004137 Ga0495684_0004137_4441_5751 396
176 3300005327 Ga0070658_10106693 Ga0070658_101066933 397
177 3300005329 Ga0070683_100087131 Ga0070683_1000871311 397
178 3300005336 Ga0070680_100011382 Ga0070680_1000113822 397
179 3300005341 Ga0070691_10008557 Ga0070691_100085572 397
180 3300005345 Ga0070692_10018720 Ga0070692_100187202 397
181 3300005458 Ga0070681_10014348 Ga0070681_100143487 397
182 3300005535 Ga0070684_100015250 Ga0070684_1000152506 397
183 3300005577 Ga0068857_100108385 Ga0068857_1001083853 397
184 3300020080 Ga0206350_10489830 Ga0206350_104898301 397
185 3300020080 Ga0206350_10935520 Ga0206350_109355201 397
186 3300025909 Ga0207705_10078098 Ga0207705_100780983 397
187 3300025912 Ga0207707_10005866 Ga0207707_1000586610 397
188 3300025917 Ga0207660_10003503 Ga0207660_100035032 397
189 3300025944 Ga0207661_10006614 Ga0207661_100066143 397
190 3300026088 Ga0207641_10032829 Ga0207641_100328293 397
191 3300026116 Ga0207674_10112581 Ga0207674_101125813 397
192 3300045049 Ga0466959_0047156 Ga0466959_0047156_864_2183 397
193 3300045836 Ga0466958_0140492 Ga0466958_0140492_56_1357 397
194 3300045976 Ga0466967_0148874 Ga0466967_0148874_452_1744 397
195 3300046680 Ga0495646_0133274 Ga0495646_0133274_57_1379 397
196 3300053153 Ga0500616_0003685 Ga0500616_0003685_10074_11405 397
197 3300005336 Ga0070680_100000948 Ga0070680_10000094815 398
198 3300005458 Ga0070681_10000440 Ga0070681_1000044020 398
199 3300005468 Ga0070707_100004919 Ga0070707_1000049199 398
200 3300005471 Ga0070698_100024025 Ga0070698_1000240253 398
201 3300005530 Ga0070679_100001605 Ga0070679_10000160520 398
202 3300020069 Ga0197907_10621403 Ga0197907_106214031 398
203 3300020069 Ga0197907_10768012 Ga0197907_107680121 398
204 3300020077 Ga0206351_10040353 Ga0206351_100403532 398
205 3300020078 Ga0206352_10423748 Ga0206352_104237481 398
206 3300020610 Ga0154015_1307906 Ga0154015_13079062 398
207 3300022467 Ga0224712_10070293 Ga0224712_100702931 398
208 3300025912 Ga0207707_10000654 Ga0207707_1000065420 398
209 3300025917 Ga0207660_10000383 Ga0207660_100003837 398
210 3300025921 Ga0207652_10000629 Ga0207652_1000062915 398
211 3300025922 Ga0207646_10022777 Ga0207646_100227774 398
212 3300025944 Ga0207661_10155910 Ga0207661_101559102 398
213 3300035172 Ga0373955_0063411 Ga0373955_0063411_75_1421 398
214 3300035172 Ga0373955_0092407 Ga0373955_0092407_273_1604 398
215 3300035724 Ga0373933_0027163 Ga0373933_0027163_1894_3240 398
216 3300036401 Ga0373937_0331932 Ga0373937_0331932_43_1389 398
217 3300046454 Ga0495592_0033716 Ga0495592_0033716_1577_2908 398
218 3300046462 Ga0495651_0069479 Ga0495651_0069479_82_1428 398
219 3300046463 Ga0495653_0043083 Ga0495653_0043083_76_1422 398
220 3300046477 Ga0495664_0023345 Ga0495664_0023345_2120_3466 398
221 3300046511 Ga0495608_0004587 Ga0495608_0004587_1062_2393 398
222 3300046511 Ga0495608_0147293 Ga0495608_0147293_50_1396 398
223 3300046514 Ga0495618_0025715 Ga0495618_0025715_1655_2986 398
224 3300046514 Ga0495618_0049297 Ga0495618_0049297_24_1370 398
225 3300046516 Ga0495628_0113284 Ga0495628_0113284_73_1419 398
226 3300046516 Ga0495628_0162330 Ga0495628_0162330_410_1684 398
227 3300046529 Ga0495652_0005532 Ga0495652_0005532_9962_11293 398
228 3300046536 Ga0495587_0005082 Ga0495587_0005082_6484_7815 398
229 3300046536 Ga0495587_0023313 Ga0495587_0023313_2360_3706 398
230 3300046559 Ga0495667_0000634 Ga0495667_0000634_1764_3095 398
231 3300046559 Ga0495667_0014094 Ga0495667_0014094_1770_3116 398
232 3300046642 Ga0495634_0039566 Ga0495634_0039566_1478_2809 398
233 3300046663 Ga0495635_0002118 Ga0495635_0002118_1705_3036 398
234 3300046663 Ga0495635_0093288 Ga0495635_0093288_12_1358 398
235 3300046675 Ga0495657_0065582 Ga0495657_0065582_147_1493 398
236 3300046678 Ga0495599_0029610 Ga0495599_0029610_1570_2901 398
237 3300047317 Ga0495604_0002931 Ga0495604_0002931_3011_4342 398
238 3300047319 Ga0495674_0131665 Ga0495674_0131665_111_1457 398
239 3300047322 Ga0495680_0014272 Ga0495680_0014272_4012_5343 398
240 3300047322 Ga0495680_0039401 Ga0495680_0039401_966_2312 398
241 3300047444 Ga0495675_0018230 Ga0495675_0018230_147_1478 398
242 3300047471 Ga0495684_0050580 Ga0495684_0050580_722_2053 398
243 3300048088 Ga0495602_0081890 Ga0495602_0081890_377_1723 398
244 3300048929 Ga0496126_0017472 Ga0496126_0017472_770_1996 398
245 3300005434 Ga0070709_10013597 Ga0070709_100135975 399
246 3300005435 Ga0070714_100001859 Ga0070714_1000018596 399
247 3300005435 Ga0070714_100118481 Ga0070714_1001184812 399
248 3300005436 Ga0070713_100072870 Ga0070713_1000728703 399
249 3300005436 Ga0070713_100244358 Ga0070713_1002443581 399
250 3300006028 Ga0070717_10244195 Ga0070717_102441952 399
251 3300006173 Ga0070716_100032031 Ga0070716_1000320312 399
252 3300006175 Ga0070712_100013920 Ga0070712_1000139202 399
253 3300025915 Ga0207693_10054914 Ga0207693_100549142 399
254 3300025916 Ga0207663_10011716 Ga0207663_100117165 399
255 3300025928 Ga0207700_10019667 Ga0207700_100196674 399
256 3300025928 Ga0207700_10050236 Ga0207700_100502362 399
257 3300025928 Ga0207700_10150966 Ga0207700_101509662 399
258 3300025929 Ga0207664_10000453 Ga0207664_1000045317 399
259 3300025929 Ga0207664_10010168 Ga0207664_100101682 399
260 3300025929 Ga0207664_10021775 Ga0207664_100217752 399
261 3300025929 Ga0207664_10041403 Ga0207664_100414033 399
262 3300035692 Ga0373935_0041578 Ga0373935_0041578_411_1745 399
263 3300045976 Ga0466967_0012164 Ga0466967_0012164_4334_5641 399
264 3300046536 Ga0495587_0022458 Ga0495587_0022458_1773_3104 399
265 3300046675 Ga0495657_0013758 Ga0495657_0013758_702_2033 399
266 3300047317 Ga0495604_0015793 Ga0495604_0015793_3413_4744 399
267 3300047322 Ga0495680_0003505 Ga0495680_0003505_3660_4991 399
268 3300047471 Ga0495684_0110363 Ga0495684_0110363_144_1490 399
269 3300005336 Ga0070680_100007003 Ga0070680_1000070032 400
270 3300005339 Ga0070660_100004443 Ga0070660_1000044434 400
271 3300005339 Ga0070660_100052755 Ga0070660_1000527553 400
272 3300005344 Ga0070661_100063547 Ga0070661_1000635472 400
273 3300005436 Ga0070713_100098894 Ga0070713_1000988941 400
274 3300005530 Ga0070679_100049478 Ga0070679_1000494782 400
275 3300005616 Ga0068852_100145012 Ga0068852_1001450122 400
276 3300006847 Ga0075431_100194647 Ga0075431_1001946472 400
277 3300006852 Ga0075433_10105537 Ga0075433_101055372 400
278 3300009094 Ga0111539_10203859 Ga0111539_102038591 400
279 3300009147 Ga0114129_10001880 Ga0114129_100018803 400
280 3300009551 Ga0105238_10027715 Ga0105238_100277156 400
281 3300010375 Ga0105239_10298518 Ga0105239_102985181 400
282 3300013105 Ga0157369_10010356 Ga0157369_100103567 400
283 3300020075 Ga0206349_1519633 Ga0206349_15196332 400
284 3300025913 Ga0207695_10067413 Ga0207695_100674134 400
285 3300025915 Ga0207693_10150301 Ga0207693_101503011 400
286 3300025919 Ga0207657_10004757 Ga0207657_100047574 400
287 3300025919 Ga0207657_10038388 Ga0207657_100383882 400
288 3300025920 Ga0207649_10059798 Ga0207649_100597982 400
289 3300025944 Ga0207661_10004314 Ga0207661_100043146 400
290 3300031456 Ga0307513_10001441 Ga0307513_100014417 400
291 3300031995 Ga0307409_100044062 Ga0307409_1000440621 400
292 3300032002 Ga0307416_100197173 Ga0307416_1001971732 400
293 3300035083 Ga0373926_0000529 Ga0373926_0000529_7749_9104 400
294 3300035089 Ga0373944_0001519 Ga0373944_0001519_1532_2887 400
295 3300035113 Ga0373936_0004289 Ga0373936_0004289_1877_3232 400
296 3300035120 Ga0373957_0000506 Ga0373957_0000506_3012_4367 400
297 3300035171 Ga0373946_0004328 Ga0373946_0004328_3355_4710 400
298 3300035172 Ga0373955_0017668 Ga0373955_0017668_1821_3176 400
299 3300035410 Ga0373924_0000854 Ga0373924_0000854_2112_3467 400
300 3300035724 Ga0373933_0023399 Ga0373933_0023399_1938_3293 400
301 3300035725 Ga0373947_0002056 Ga0373947_0002056_3780_5135 400
302 3300039450 Ga0436363_1323463 Ga0436363_1323463_57_1397 400
303 3300046459 Ga0495629_0005204 Ga0495629_0005204_8245_9600 400
304 3300046461 Ga0495641_0001209 Ga0495641_0001209_16168_17523 400
305 3300046462 Ga0495651_0030748 Ga0495651_0030748_2258_3613 400
306 3300046473 Ga0495582_0001277 Ga0495582_0001277_9937_11292 400
307 3300046475 Ga0495639_0001779 Ga0495639_0001779_7294_8649 400
308 3300046476 Ga0495662_0000438 Ga0495662_0000438_8405_9760 400
309 3300046477 Ga0495664_0000703 Ga0495664_0000703_8913_10268 400
310 3300046511 Ga0495608_0017943 Ga0495608_0017943_2798_4153 400
311 3300046514 Ga0495618_0008253 Ga0495618_0008253_2798_4153 400
312 3300046516 Ga0495628_0015650 Ga0495628_0015650_1907_3262 400
313 3300046526 Ga0495666_0001008 Ga0495666_0001008_7294_8649 400
314 3300046529 Ga0495652_0035434 Ga0495652_0035434_1830_3185 400
315 3300046531 Ga0495665_0000615 Ga0495665_0000615_8133_9488 400
316 3300046535 Ga0495586_0008545 Ga0495586_0008545_3321_4676 400
317 3300046536 Ga0495587_0028459 Ga0495587_0028459_181_1536 400
318 3300046543 Ga0495645_0002116 Ga0495645_0002116_8878_10233 400
319 3300046642 Ga0495634_0008304 Ga0495634_0008304_4227_5582 400
320 3300046675 Ga0495657_0039820 Ga0495657_0039820_122_1477 400
321 3300046680 Ga0495646_0090545 Ga0495646_0090545_108_1463 400
322 3300046683 Ga0495658_0024747 Ga0495658_0024747_1341_2696 400
323 3300046689 Ga0495613_0001172 Ga0495613_0001172_8143_9498 400
324 3300046690 Ga0495624_0004182 Ga0495624_0004182_2576_3931 400
325 3300047315 Ga0495581_0001358 Ga0495581_0001358_836_2191 400
326 3300047321 Ga0495676_0006369 Ga0495676_0006369_2287_3642 400
327 3300047471 Ga0495684_0026389 Ga0495684_0026389_2156_3511 400
328 3300047673 Ga0495593_0028905 Ga0495593_0028905_1115_2470 400
329 3300048088 Ga0495602_0153212 Ga0495602_0153212_142_1497 400
330 3300048089 Ga0495614_0001493 Ga0495614_0001493_5817_7172 400
331 3300050507 nmdc:mga05p37_23596_c1 nmdc:mga05p37_23596_c1_2576_3901 400
332 3300050510 nmdc:mga06r32_227710_c1 nmdc:mga06r32_227710_c1_51_1376 400
333 3300050511 nmdc:mga08y16_337209_c1 nmdc:mga08y16_337209_c1_121_1446 400
334 3300050512 nmdc:mga0n895_128412_c1 nmdc:mga0n895_128412_c1_1216_2541 400
335 3300053078 Ga0495612_0000809 Ga0495612_0000809_2164_3519 400
336 3300053085 Ga0495619_0001138 Ga0495619_0001138_9909_11264 400
337 3300005339 Ga0070660_100041926 Ga0070660_1000419265 401
338 3300025919 Ga0207657_10046870 Ga0207657_100468704 401
339 3300046663 Ga0495635_0035731 Ga0495635_0035731_2054_3367 401
340 3300046689 Ga0495613_0118305 Ga0495613_0118305_269_1735 401
341 3300047471 Ga0495684_0074657 Ga0495684_0074657_983_2296 401
342 3300005329 Ga0070683_100217341 Ga0070683_1002173412 402
343 3300005347 Ga0070668_100019709 Ga0070668_1000197094 402
344 3300005434 Ga0070709_10021320 Ga0070709_100213204 402
345 3300005436 Ga0070713_100039282 Ga0070713_1000392823 402
346 3300005436 Ga0070713_100227509 Ga0070713_1002275092 402
347 3300005437 Ga0070710_10068809 Ga0070710_100688092 402
348 3300005445 Ga0070708_100002228 Ga0070708_1000022283 402
349 3300005458 Ga0070681_10178342 Ga0070681_101783422 402
350 3300005467 Ga0070706_100001026 Ga0070706_1000010262 402
351 3300005467 Ga0070706_100005186 Ga0070706_10000518610 402
352 3300005468 Ga0070707_100018776 Ga0070707_1000187767 402
353 3300005468 Ga0070707_100095675 Ga0070707_1000956752 402
354 3300005471 Ga0070698_100001605 Ga0070698_10000160523 402
355 3300005536 Ga0070697_100013273 Ga0070697_1000132733 402
356 3300005577 Ga0068857_100041694 Ga0068857_1000416943 402
357 3300005617 Ga0068859_100036163 Ga0068859_1000361632 402
358 3300005843 Ga0068860_100048994 Ga0068860_1000489942 402
359 3300006028 Ga0070717_10014005 Ga0070717_100140052 402
360 3300006028 Ga0070717_10035019 Ga0070717_100350192 402
361 3300006931 Ga0097620_100036163 Ga0097620_1000361632 402
362 3300025910 Ga0207684_10006176 Ga0207684_1000617610 402
363 3300025910 Ga0207684_10146707 Ga0207684_101467072 402
364 3300025910 Ga0207684_10174207 Ga0207684_101742072 402
365 3300025922 Ga0207646_10001035 Ga0207646_1000103529 402
366 3300025928 Ga0207700_10024357 Ga0207700_100243572 402
367 3300025928 Ga0207700_10089146 Ga0207700_100891462 402
368 3300025929 Ga0207664_10055475 Ga0207664_100554752 402
369 3300025931 Ga0207644_10071558 Ga0207644_100715582 402
370 3300026067 Ga0207678_10002186 Ga0207678_1000218613 402
371 3300026116 Ga0207674_10002613 Ga0207674_100026136 402
372 3300035172 Ga0373955_0005912 Ga0373955_0005912_265_1590 402
373 3300036401 Ga0373937_0017337 Ga0373937_0017337_4530_5855 402
374 3300037068 Ga0373925_0031553 Ga0373925_0031553_846_2171 402
375 3300046454 Ga0495592_0049643 Ga0495592_0049643_13_1371 402
376 3300046455 Ga0495603_0046360 Ga0495603_0046360_727_2067 402
377 3300046459 Ga0495629_0012726 Ga0495629_0012726_1153_2478 402
378 3300046459 Ga0495629_0032689 Ga0495629_0032689_2052_3392 402
379 3300046461 Ga0495641_0008684 Ga0495641_0008684_3689_5014 402
380 3300046473 Ga0495582_0132751 Ga0495582_0132751_47_1372 402
381 3300046475 Ga0495639_0006433 Ga0495639_0006433_3651_4976 402
382 3300046476 Ga0495662_0005432 Ga0495662_0005432_447_1772 402
383 3300046477 Ga0495664_0047186 Ga0495664_0047186_1120_2460 402
384 3300046511 Ga0495608_0020857 Ga0495608_0020857_1468_2793 402
385 3300046516 Ga0495628_0010850 Ga0495628_0010850_2349_3707 402
386 3300046526 Ga0495666_0036524 Ga0495666_0036524_312_1652 402
387 3300046531 Ga0495665_0009737 Ga0495665_0009737_3842_5167 402
388 3300046533 Ga0495640_0032737 Ga0495640_0032737_1014_2339 402
389 3300046533 Ga0495640_0083853 Ga0495640_0083853_617_1948 402
390 3300046536 Ga0495587_0028458 Ga0495587_0028458_606_1931 402
391 3300046536 Ga0495587_0075038 Ga0495587_0075038_538_1896 402
392 3300046543 Ga0495645_0026301 Ga0495645_0026301_1213_2571 402
393 3300046543 Ga0495645_0033262 Ga0495645_0033262_1709_3034 402
394 3300046559 Ga0495667_0046702 Ga0495667_0046702_50_1408 402
395 3300046559 Ga0495667_0070511 Ga0495667_0070511_296_1621 402
396 3300046642 Ga0495634_0030940 Ga0495634_0030940_1720_3045 402
397 3300046642 Ga0495634_0098070 Ga0495634_0098070_523_1881 402
398 3300046663 Ga0495635_0073701 Ga0495635_0073701_502_1824 402
399 3300046675 Ga0495657_0037737 Ga0495657_0037737_272_1630 402
400 3300046678 Ga0495599_0024317 Ga0495599_0024317_1142_2467 402
401 3300046680 Ga0495646_0035556 Ga0495646_0035556_623_1948 402
402 3300046689 Ga0495613_0031241 Ga0495613_0031241_784_2109 402
403 3300046690 Ga0495624_0013877 Ga0495624_0013877_3622_4947 402
404 3300046809 Ga0495600_0009958 Ga0495600_0009958_3096_4421 402
405 3300046809 Ga0495600_0074720 Ga0495600_0074720_426_1784 402
406 3300047317 Ga0495604_0145182 Ga0495604_0145182_331_1656 402
407 3300047319 Ga0495674_0222069 Ga0495674_0222069_65_1423 402
408 3300047322 Ga0495680_0054107 Ga0495680_0054107_1698_3056 402
409 3300047444 Ga0495675_0019430 Ga0495675_0019430_2723_4048 402
410 3300047471 Ga0495684_0059454 Ga0495684_0059454_684_2009 402
411 3300047673 Ga0495593_0009241 Ga0495593_0009241_1468_2793 402
412 3300048088 Ga0495602_0136076 Ga0495602_0136076_331_1656 402
413 3300048913 Ga0496110_0180945 Ga0496110_0180945_255_1550 402
414 3300053077 Ga0495601_0049207 Ga0495601_0049207_1238_2596 402
415 3300053078 Ga0495612_0033590 Ga0495612_0033590_652_1983 402
416 3300053085 Ga0495619_0000751 Ga0495619_0000751_11494_12819 402
417 3300005327 Ga0070658_10059259 Ga0070658_100592592 403
418 3300005435 Ga0070714_100060504 Ga0070714_1000605041 403
419 3300005435 Ga0070714_100209726 Ga0070714_1002097261 403
420 3300005439 Ga0070711_100043210 Ga0070711_1000432103 403
421 3300005467 Ga0070706_100043139 Ga0070706_1000431394 403
422 3300005983 Ga0081540_1029390 Ga0081540_10293902 403
423 3300006028 Ga0070717_10104595 Ga0070717_101045952 403
424 3300006175 Ga0070712_100029360 Ga0070712_1000293602 403
425 3300006237 Ga0097621_100068620 Ga0097621_1000686202 403
426 3300006871 Ga0075434_100327486 Ga0075434_1003274862 403
427 3300025906 Ga0207699_10005230 Ga0207699_100052304 403
428 3300025915 Ga0207693_10154552 Ga0207693_101545522 403
429 3300025916 Ga0207663_10003923 Ga0207663_100039232 403
430 3300025927 Ga0207687_10053797 Ga0207687_100537972 403
431 3300025929 Ga0207664_10034815 Ga0207664_100348153 403
432 3300025940 Ga0207691_10033815 Ga0207691_100338152 403
433 3300035111 Ga0373923_0079678 Ga0373923_0079678_37_1326 403
434 3300035724 Ga0373933_0071469 Ga0373933_0071469_628_1956 403
435 3300037068 Ga0373925_0042213 Ga0373925_0042213_571_1932 403
436 3300039450 Ga0436363_1444078 Ga0436363_1444078_4685_6037 403
437 3300045049 Ga0466959_0146228 Ga0466959_0146228_50_1360 403
438 3300045976 Ga0466967_0038241 Ga0466967_0038241_504_1799 403
439 3300046529 Ga0495652_0169816 Ga0495652_0169816_288_1619 403
440 3300048913 Ga0496110_0165457 Ga0496110_0165457_410_1747 403
441 3300005339 Ga0070660_100014588 Ga0070660_1000145885 404
442 3300005340 Ga0070689_100025487 Ga0070689_1000254874 404
443 3300005356 Ga0070674_100093404 Ga0070674_1000934042 404
444 3300005366 Ga0070659_100099997 Ga0070659_1000999972 404
445 3300005434 Ga0070709_10000482 Ga0070709_1000048218 404
446 3300005435 Ga0070714_100000563 Ga0070714_10000056314 404
447 3300005436 Ga0070713_100001453 Ga0070713_10000145312 404
448 3300005437 Ga0070710_10000452 Ga0070710_1000045219 404
449 3300005439 Ga0070711_100000259 Ga0070711_10000025912 404
450 3300005530 Ga0070679_100071526 Ga0070679_1000715263 404
451 3300005539 Ga0068853_100179514 Ga0068853_1001795142 404
452 3300005563 Ga0068855_100210296 Ga0068855_1002102962 404
453 3300005718 Ga0068866_10017860 Ga0068866_100178604 404
454 3300006028 Ga0070717_10000562 Ga0070717_1000056210 404
455 3300006173 Ga0070716_100000717 Ga0070716_1000007176 404
456 3300006175 Ga0070712_100001363 Ga0070712_1000013639 404
457 3300006358 Ga0068871_100052823 Ga0068871_1000528232 404
458 3300007076 Ga0075435_100205381 Ga0075435_1002053812 404
459 3300013297 Ga0157378_10089296 Ga0157378_100892963 404
460 3300014326 Ga0157380_10299082 Ga0157380_102990821 404
461 3300025885 Ga0207653_10008805 Ga0207653_100088053 404
462 3300025898 Ga0207692_10000260 Ga0207692_100002607 404
463 3300025906 Ga0207699_10000522 Ga0207699_100005226 404
464 3300025906 Ga0207699_10043224 Ga0207699_100432242 404
465 3300025915 Ga0207693_10003202 Ga0207693_1000320216 404
466 3300025916 Ga0207663_10001104 Ga0207663_100011042 404
467 3300025918 Ga0207662_10025474 Ga0207662_100254744 404
468 3300025919 Ga0207657_10012608 Ga0207657_100126082 404
469 3300025928 Ga0207700_10000211 Ga0207700_1000021119 404
470 3300025929 Ga0207664_10000122 Ga0207664_1000012224 404
471 3300025933 Ga0207706_10061391 Ga0207706_100613912 404
472 3300025936 Ga0207670_10093338 Ga0207670_100933382 404
473 3300025939 Ga0207665_10000052 Ga0207665_1000005221 404
474 3300025961 Ga0207712_10057516 Ga0207712_100575163 404
475 3300026075 Ga0207708_10060425 Ga0207708_100604252 404
476 3300026121 Ga0207683_10001474 Ga0207683_100014741 404
477 3300028556 Ga0265337_1001178 Ga0265337_10011785 404
478 3300028563 Ga0265319_1001961 Ga0265319_10019619 404
479 3300028573 Ga0265334_10001149 Ga0265334_100011498 404
480 3300028577 Ga0265318_10008285 Ga0265318_100082852 404
481 3300028653 Ga0265323_10021042 Ga0265323_100210422 404
482 3300028800 Ga0265338_10012278 Ga0265338_100122786 404
483 3300029957 Ga0265324_10005120 Ga0265324_100051206 404
484 3300031238 Ga0265332_10041967 Ga0265332_100419672 404
485 3300031240 Ga0265320_10007404 Ga0265320_100074047 404
486 3300031241 Ga0265325_10014637 Ga0265325_100146371 404
487 3300031247 Ga0265340_10004989 Ga0265340_100049896 404
488 3300031249 Ga0265339_10087784 Ga0265339_100877842 404
489 3300031344 Ga0265316_10003419 Ga0265316_1000341914 404
490 3300031595 Ga0265313_10002734 Ga0265313_100027344 404
491 3300031712 Ga0265342_10001585 Ga0265342_100015857 404
492 3300039450 Ga0436363_1531465 Ga0436363_1531465_271_1515 404
493 3300046516 Ga0495628_0059235 Ga0495628_0059235_47_1381 404
494 3300005467 Ga0070706_100016829 Ga0070706_1000168294 405
495 3300005467 Ga0070706_100030917 Ga0070706_1000309174 405
496 3300005468 Ga0070707_100000482 Ga0070707_10000048229 405
497 3300005471 Ga0070698_100001046 Ga0070698_1000010464 405
498 3300005471 Ga0070698_100019024 Ga0070698_1000190243 405
499 3300006028 Ga0070717_10058182 Ga0070717_100581823 405
500 3300007076 Ga0075435_100134596 Ga0075435_1001345962 405
501 3300013308 Ga0157375_10110205 Ga0157375_101102053 405
502 3300014968 Ga0157379_10030366 Ga0157379_100303663 405
503 3300021377 Ga0213874_10003263 Ga0213874_100032631 405
504 3300021377 Ga0213874_10012929 Ga0213874_100129292 405
505 3300021388 Ga0213875_10031229 Ga0213875_100312292 405
506 3300025910 Ga0207684_10014227 Ga0207684_100142274 405
507 3300025922 Ga0207646_10001177 Ga0207646_100011773 405
508 3300037853 Ga0436364_0437726 Ga0436364_0437726_3293_4615 405
509 3300037853 Ga0436364_0617202 Ga0436364_0617202_20589_21929 405
510 3300039437 Ga0436365_0408680 Ga0436365_0408680_50_1390 405
511 3300039450 Ga0436363_1607112 Ga0436363_1607112_2570_3916 405
512 3300045049 Ga0466959_0034822 Ga0466959_0034822_2328_3710 405
513 3300046462 Ga0495651_0008483 Ga0495651_0008483_3707_5038 405
514 3300046477 Ga0495664_0012160 Ga0495664_0012160_1372_2703 405
515 3300046675 Ga0495657_0009845 Ga0495657_0009845_5611_6942 405
516 3300046809 Ga0495600_0002631 Ga0495600_0002631_3614_4945 405
517 3300050513 nmdc:mga0rr50_158231_c1 nmdc:mga0rr50_158231_c1_40_1371 405
518 3300005343 Ga0070687_100026964 Ga0070687_1000269642 406
519 3300005441 Ga0070700_100133923 Ga0070700_1001339232 406
520 3300024225 Ga0224572_1005029 Ga0224572_10050292 406
521 3300035083 Ga0373926_0009754 Ga0373926_0009754_1704_3077 406
522 3300035089 Ga0373944_0001673 Ga0373944_0001673_3660_5033 406
523 3300035119 Ga0373956_0036431 Ga0373956_0036431_142_1497 406
524 3300035170 Ga0373943_0004681 Ga0373943_0004681_2740_4113 406
525 3300035171 Ga0373946_0002867 Ga0373946_0002867_4301_5662 406
526 3300035410 Ga0373924_0040858 Ga0373924_0040858_385_1758 406
527 3300035695 Ga0373927_0002586 Ga0373927_0002586_1806_3179 406
528 3300035725 Ga0373947_0006281 Ga0373947_0006281_3849_5222 406
529 3300039437 Ga0436365_1528513 Ga0436365_1528513_594_1931 406
530 3300039450 Ga0436363_1297689 Ga0436363_1297689_472_1812 406
531 3300046461 Ga0495641_0007724 Ga0495641_0007724_4034_5407 406
532 3300046477 Ga0495664_0002025 Ga0495664_0002025_1814_3187 406
533 3300046529 Ga0495652_0023905 Ga0495652_0023905_135_1508 406
534 3300046531 Ga0495665_0019745 Ga0495665_0019745_2157_3530 406
535 3300046559 Ga0495667_0011026 Ga0495667_0011026_4686_6059 406
536 3300046663 Ga0495635_0000969 Ga0495635_0000969_11898_13271 406
537 3300046675 Ga0495657_0011883 Ga0495657_0011883_4084_5457 406
538 3300046690 Ga0495624_0011390 Ga0495624_0011390_4164_5537 406
539 3300047315 Ga0495581_0012400 Ga0495581_0012400_159_1526 406
540 3300047319 Ga0495674_0002882 Ga0495674_0002882_12866_14239 406
541 3300047322 Ga0495680_0051860 Ga0495680_0051860_123_1496 406
542 3300005335 Ga0070666_10140574 Ga0070666_101405742 407
543 3300005364 Ga0070673_100116084 Ga0070673_1001160842 407
544 3300005406 Ga0070703_10011017 Ga0070703_100110172 407
545 3300005466 Ga0070685_10020592 Ga0070685_100205923 407
546 3300005468 Ga0070707_100008998 Ga0070707_1000089986 407
547 3300005518 Ga0070699_100002268 Ga0070699_10000226814 407
548 3300005546 Ga0070696_100011166 Ga0070696_1000111662 407
549 3300005615 Ga0070702_100011637 Ga0070702_1000116374 407
550 3300005840 Ga0068870_10006344 Ga0068870_100063442 407
551 3300005844 Ga0068862_100042995 Ga0068862_1000429953 407
552 3300006028 Ga0070717_10006820 Ga0070717_100068206 407
553 3300009011 Ga0105251_10022340 Ga0105251_100223402 407
554 3300013102 Ga0157371_10124723 Ga0157371_101247232 407
555 3300025906 Ga0207699_10004044 Ga0207699_100040446 407
556 3300025907 Ga0207645_10083271 Ga0207645_100832712 407
557 3300025910 Ga0207684_10107474 Ga0207684_101074742 407
558 3300025922 Ga0207646_10018595 Ga0207646_100185956 407
559 3300025926 Ga0207659_10115042 Ga0207659_101150421 407
560 3300025939 Ga0207665_10075106 Ga0207665_100751062 407
561 3300025939 Ga0207665_10085904 Ga0207665_100859042 407
562 3300025960 Ga0207651_10034699 Ga0207651_100346994 407
563 3300026023 Ga0207677_10108395 Ga0207677_101083952 407
564 3300026118 Ga0207675_100019776 Ga0207675_1000197761 407
565 3300032126 Ga0307415_100164427 Ga0307415_1001644272 407
566 3300035112 Ga0373932_0019114 Ga0373932_0019114_236_1597 407
567 3300035117 Ga0373953_0041693 Ga0373953_0041693_386_1717 407
568 3300037853 Ga0436364_0193728 Ga0436364_0193728_14892_16172 407
569 3300048914 Ga0496111_0128711 Ga0496111_0128711_294_1655 407
570 3300053085 Ga0495619_0023403 Ga0495619_0023403_1900_3231 407
571 3300021388 Ga0213875_10000501 Ga0213875_1000050131 408
572 3300037853 Ga0436364_0614465 Ga0436364_0614465_14553_15905 408
573 3300049578 Ga0501042_0006227 Ga0501042_0006227_3061_4365 408
574 3300005435 Ga0070714_100019218 Ga0070714_1000192183 409
575 3300025910 Ga0207684_10163904 Ga0207684_101639041 409
576 3300025915 Ga0207693_10020888 Ga0207693_100208884 409
577 3300025928 Ga0207700_10013181 Ga0207700_100131813 409
578 3300025929 Ga0207664_10008721 Ga0207664_100087213 409
579 3300028380 Ga0268265_10235363 Ga0268265_102353631 409
580 3300036401 Ga0373937_0106173 Ga0373937_0106173_135_1499 409
581 3300046454 Ga0495592_0174515 Ga0495592_0174515_65_1429 409
582 3300046463 Ga0495653_0054715 Ga0495653_0054715_950_2314 409
583 3300046559 Ga0495667_0030286 Ga0495667_0030286_1416_2780 409
584 3300046642 Ga0495634_0048603 Ga0495634_0048603_1335_2699 409
585 3300046663 Ga0495635_0013038 Ga0495635_0013038_2411_3775 409
586 3300047322 Ga0495680_0004337 Ga0495680_0004337_142_1506 409
587 3300005471 Ga0070698_100000318 Ga0070698_10000031830 410
588 3300046809 Ga0495600_0044844 Ga0495600_0044844_476_1831 411
589 3300021377 Ga0213874_10005763 Ga0213874_100057631 412
590 3300021384 Ga0213876_10013507 Ga0213876_100135074 412
591 3300037466 Ga0395898_0021754 Ga0395898_0021754_2824_4107 414
592 3300038443 Ga0395901_0022296 Ga0395901_0022296_3751_5034 414
593 3300044719 Ga0466971_0027887 Ga0466971_0027887_684_1958 414
594 3300044842 Ga0466957_0005052 Ga0466957_0005052_4998_6272 414
595 3300047317 Ga0495604_0000380 Ga0495604_0000380_51_1343 414
596 3300048907 Ga0496104_0000030 Ga0496104_0000030_190695_191987 414
597 3300048913 Ga0496110_0000690 Ga0496110_0000690_18732_20024 414
598 3300048914 Ga0496111_0003130 Ga0496111_0003130_6998_8290 414
599 3300020082 Ga0206353_10588212 Ga0206353_105882121 415
600 3300004800 Ga0058861_10034382 Ga0058861_100343822 416
601 3300005329 Ga0070683_100000449 Ga0070683_10000044917 416
602 3300005467 Ga0070706_100005590 Ga0070706_1000055907 416
603 3300005471 Ga0070698_100027120 Ga0070698_1000271206 416
604 3300005530 Ga0070679_100056758 Ga0070679_1000567582 416
605 3300005535 Ga0070684_100090325 Ga0070684_1000903252 416
606 3300013307 Ga0157372_10284699 Ga0157372_102846992 416
607 3300020069 Ga0197907_10358968 Ga0197907_103589682 416
608 3300020078 Ga0206352_10328706 Ga0206352_103287062 416
609 3300020080 Ga0206350_11336934 Ga0206350_113369342 416
610 3300020081 Ga0206354_10952510 Ga0206354_109525102 416
611 3300020082 Ga0206353_12019109 Ga0206353_120191092 416
612 3300022467 Ga0224712_10022674 Ga0224712_100226742 416
613 3300025910 Ga0207684_10000304 Ga0207684_1000030422 416
614 3300025917 Ga0207660_10009683 Ga0207660_100096832 416
615 3300025921 Ga0207652_10060600 Ga0207652_100606002 416
616 3300025944 Ga0207661_10037264 Ga0207661_100372643 416
617 3300030744 Ga0316181_1036461 Ga0316181_10364613 416
618 3300037312 Ga0395899_0060302 Ga0395899_0060302_1445_2737 416
619 3300037466 Ga0395898_0009496 Ga0395898_0009496_7669_8961 416
620 3300037471 Ga0395905_0006853 Ga0395905_0006853_6747_8039 416
621 3300038443 Ga0395901_0147178 Ga0395901_0147178_638_1930 416
622 3300005563 Ga0068855_100091673 Ga0068855_1000916732 417
623 3300026078 Ga0207702_10074304 Ga0207702_100743042 417
624 3300005536 Ga0070697_100000078 Ga0070697_10000007851 418
625 3300006028 Ga0070717_10111110 Ga0070717_101111102 418
626 3300025922 Ga0207646_10001555 Ga0207646_100015556 418
627 3300039437 Ga0436365_0838871 Ga0436365_0838871_1415_2773 419
628 iso_pu_bacteria 2773857762 2774394549 421
629 iso_pu_bacteria 2808606439 2809194595 421
630 iso_pu_bacteria 2811994878 2812349344 421
631 iso_pu_bacteria 2891968417 2891972952 421
632 iso_pu_bacteria 2891326441 2891326884 427
633 iso_pu_bacteria 8056060235 8056063639 432
634 3300003203 JGI25406J46586_10002973 JGI25406J46586_100029736 436
635 3300005356 Ga0070674_100018164 Ga0070674_1000181641 436
636 3300005985 Ga0081539_10000756 Ga0081539_1000075641 436
637 3300025937 Ga0207669_10013791 Ga0207669_100137911 436

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01094

ANF_receptor

Receptor family ligand binding region

97

277

0.87

PF13458

Peripla_BP_6

Periplasmic binding protein

75

431

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lop-assembly1.cif.gz_A crystal structure of substrate-binding periplasmic protein (pbp) from ralstonia solanacearum 0.8996 43 403
3lop-assembly1.cif.gz_A crystal structure of substrate-binding periplasmic protein (pbp) from ralstonia solanacearum 0.8948 43 403
4n03-assembly1.cif.gz_A fatty acid abc transporter substrate-binding protein from thermomonospora curvata 0.8771 38 412
4kv7-assembly1.cif.gz_A the crystal structure of a possible leucine/isoleucine/valine-binding protein from rhodopirellula baltica sh 1 0.8642 42 404
1qnl-assembly1.cif.gz_A amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with butyramide 0.8498 46 403
ID Description Score Start End Superfamily
1z15A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9153 43 140 3.40.50.2300
4n0qA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8631 164 302 3.40.50.2300
3ipcA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8618 164 302 3.40.50.2300
4kv7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8568 40 384 3.40.50.2300
3lkbB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8521 165 310 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3D5QC60-F1-model_v4 ABC transporter substrate-binding protein 0.9598 44 138
AF-A0A0R2P890-F1-model_v4 Leucine-binding protein domain-containing protein 0.9333 37 342
AF-A0A7X9JF04-F1-model_v4 ABC transporter substrate-binding protein 0.9313 43 149 GO:0006865
AF-A0A662CJH9-F1-model_v4 ABC transporter substrate-binding protein 0.93 43 144 GO:0006865
AF-A0A3D3S2J0-F1-model_v4 Urea ABC transporter substrate-binding protein 0.9287 43 140

Feature Viewer

pLDDT pTM Quality
90.74 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map