F471424
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 637 | 246 | 615 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10092723|Ga0157372_100927233 |
| Length | 338 |
| Sequence | MPMQLGSDGISGKRPARSEKDASTPHPRTIARMPGMPRPSFDPSLLAPRHWPAWLGVAVIWLIARLPYPLLMSLGRLLGTLIRHVPSRRRRIAEANIALCFPELDAQEQAALVDAHLTDIGLMLVEFALGWMGSDRAIARIHTRVEGLEHLEAARAQGQGVLLVGGHFSHLELCARLISRRIPIAGMYRRMDSPVFEWTVLRARLHYAAAMFEKDDIRGTVKYLRSGGTVWYAPDQDMRSKDSVFVPFFGVPAATITATHHLARMGQAQVIPFFHHRLAEGGYAMRLGAPLPMGGDAAADTAVVNASVEQMVRAAPAQYLWVHKRFKSRPPGAPEVYR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 2 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 3 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 4 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 5 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 6 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 7 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 8 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 9 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 10 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 11 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 12 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 13 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 14 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 15 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 16 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 17 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 18 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 19 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 20 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 21 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 22 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 23 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 28 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 29 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 30 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 31 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 32 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 35 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 36 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 92 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 148 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 153 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 155 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 156 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 157 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 158 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 159 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 160 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 161 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 162 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 163 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 164 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 165 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 166 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 167 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 168 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 172 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 173 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 207 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 208 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 209 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 210 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 213 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 214 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 215 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 216 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 217 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 242 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 243 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 244 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 245 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 246 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.82 |
| Metatranscriptomes | 1.73 |
| Isolates | 3.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.81 |
| Nodule | 0 |
| Rhizoplane | 1.88 |
| Rhizosphere | 71.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1008106 | 3300001915 | Bacteria | 1997 |
| 2 | JGI24740J21852_10000931 | 3300001979 | Bacteria | 13002 |
| 3 | JGI24739J22299_10043324 | 3300001989 | Bacteria | 1488 |
| 4 | JGI24737J22298_10000633 | 3300001990 | Bacteria | 12378 |
| 5 | JGI25156J39149_1003556 | 3300002705 | Bacteria | 5057 |
| 6 | JGI25156J39149_1004170 | 3300002705 | Bacteria | 4479 |
| 7 | JGI25162J39368_1000239 | 3300002737 | Bacteria | 54751 |
| 8 | JGI25162J39368_1000249 | 3300002737 | Bacteria | 53308 |
| 9 | JGI25162J39368_1002541 | 3300002737 | Bacteria | 6969 |
| 10 | JGI25162J39368_1007020 | 3300002737 | Bacteria | 1824 |
| 11 | JGI25157J39369_1000293 | 3300002741 | Bacteria | 36433 |
| 12 | JGI25157J39369_1001205 | 3300002741 | Bacteria | 10816 |
| 13 | JGI25157J39369_1001281 | 3300002741 | Bacteria | 10119 |
| 14 | JGI25157J39369_1002499 | 3300002741 | Bacteria | 4479 |
| 15 | JGI25163J39215_1000359 | 3300002771 | Bacteria | 14904 |
| 16 | JGI25164J39214_1000004 | 3300002772 | Bacteria | 350814 |
| 17 | JGI25164J39214_1000200 | 3300002772 | Bacteria | 50877 |
| 18 | JGI25164J39214_1001210 | 3300002772 | Bacteria | 6969 |
| 19 | JGI25164J39214_1001216 | 3300002772 | Bacteria | 6952 |
| 20 | JGI25165J46597_1000110 | 3300003214 | Bacteria | 148234 |
| 21 | JGI25165J46597_1000319 | 3300003214 | Bacteria | 57885 |
| 22 | JGI25165J46597_1002182 | 3300003214 | Bacteria | 6969 |
| 23 | JGI25165J46597_1003527 | 3300003214 | Bacteria | 3833 |
| 24 | JGI25153J46596_10026961 | 3300003215 | Bacteria | 2023 |
| 25 | rootH1_10080198 | 3300003316 | Bacteria | 4626 |
| 26 | Ga0006562J51391_1003480 | 3300003578 | Bacteria | 22000 |
| 27 | Ga0006562J51391_1003481 | 3300003578 | Bacteria | 13735 |
| 28 | Ga0006562J51391_1100886 | 3300003578 | Bacteria | 2920 |
| 29 | Ga0055538_1000686 | 3300003751 | Bacteria | 10403 |
| 30 | Ga0055533_1000886 | 3300003756 | Bacteria | 9024 |
| 31 | Ga0055533_1003563 | 3300003756 | Bacteria | 3086 |
| 32 | Ga0055527_1000060 | 3300003760 | Bacteria | 92147 |
| 33 | Ga0055527_1000158 | 3300003760 | Bacteria | 47794 |
| 34 | Ga0055535_1000242 | 3300003761 | Bacteria | 57885 |
| 35 | Ga0055535_1000331 | 3300003761 | Bacteria | 47776 |
| 36 | Ga0055535_1000407 | 3300003761 | Bacteria | 40501 |
| 37 | Ga0055535_1001855 | 3300003761 | Bacteria | 9031 |
| 38 | Ga0055535_1001873 | 3300003761 | Bacteria | 8918 |
| 39 | Ga0055542_1000171 | 3300003762 | Bacteria | 80629 |
| 40 | Ga0055542_1000283 | 3300003762 | Bacteria | 56912 |
| 41 | Ga0055542_1000298 | 3300003762 | Bacteria | 55290 |
| 42 | Ga0055542_1000358 | 3300003762 | Bacteria | 47776 |
| 43 | Ga0055542_1001762 | 3300003762 | Bacteria | 9124 |
| 44 | Ga0055542_1001772 | 3300003762 | Bacteria | 9051 |
| 45 | Ga0055529_1000384 | 3300003763 | Bacteria | 47776 |
| 46 | Ga0055529_1000437 | 3300003763 | Bacteria | 41881 |
| 47 | Ga0055529_1000450 | 3300003763 | Bacteria | 40600 |
| 48 | Ga0055529_1000471 | 3300003763 | Bacteria | 38707 |
| 49 | Ga0065165_1000887 | 3300005262 | Bacteria | 38644 |
| 50 | Ga0070658_10077157 | 3300005327 | Bacteria | 2733 |
| 51 | Ga0070658_10242299 | 3300005327 | Bacteria | 1528 |
| 52 | Ga0070666_10000099 | 3300005335 | Bacteria | 59763 |
| 53 | Ga0070680_100107682 | 3300005336 | Bacteria | 2318 |
| 54 | Ga0070682_100000784 | 3300005337 | Bacteria | 18659 |
| 55 | Ga0070682_100005233 | 3300005337 | Bacteria | 7218 |
| 56 | Ga0070660_100014288 | 3300005339 | Bacteria | 5718 |
| 57 | Ga0070660_100156530 | 3300005339 | Bacteria | 1834 |
| 58 | Ga0070689_100056467 | 3300005340 | Bacteria | 3044 |
| 59 | Ga0070661_100014581 | 3300005344 | Bacteria | 5540 |
| 60 | Ga0070661_100021235 | 3300005344 | Bacteria | 4635 |
| 61 | Ga0070661_100027314 | 3300005344 | Bacteria | 4108 |
| 62 | Ga0070692_10009726 | 3300005345 | Bacteria | 4350 |
| 63 | Ga0070692_10014711 | 3300005345 | Bacteria | 3683 |
| 64 | Ga0070688_100008301 | 3300005365 | Bacteria | 5633 |
| 65 | Ga0070659_100000789 | 3300005366 | Bacteria | 23091 |
| 66 | Ga0070659_100005989 | 3300005366 | Bacteria | 8766 |
| 67 | Ga0070659_100006429 | 3300005366 | Bacteria | 8482 |
| 68 | Ga0070659_100072464 | 3300005366 | Bacteria | 2741 |
| 69 | Ga0070659_100076267 | 3300005366 | Bacteria | 2673 |
| 70 | Ga0070659_100217428 | 3300005366 | Bacteria | 1576 |
| 71 | Ga0070667_100185108 | 3300005367 | Bacteria | 1843 |
| 72 | Ga0070714_100000392 | 3300005435 | Bacteria | 32581 |
| 73 | Ga0070714_100000930 | 3300005435 | Bacteria | 20799 |
| 74 | Ga0070714_100008963 | 3300005435 | Bacteria | 7832 |
| 75 | Ga0070713_100000391 | 3300005436 | Bacteria | 28122 |
| 76 | Ga0070663_100067146 | 3300005455 | Bacteria | 2600 |
| 77 | Ga0070663_100212204 | 3300005455 | Bacteria | 1516 |
| 78 | Ga0070662_100115484 | 3300005457 | Bacteria | 2050 |
| 79 | Ga0070662_100184699 | 3300005457 | Bacteria | 1646 |
| 80 | Ga0070681_10000500 | 3300005458 | Bacteria | 32052 |
| 81 | Ga0070681_10000680 | 3300005458 | Bacteria | 28135 |
| 82 | Ga0070681_10032143 | 3300005458 | Bacteria | 5267 |
| 83 | Ga0070681_10037437 | 3300005458 | Bacteria | 4868 |
| 84 | Ga0070681_10166203 | 3300005458 | Bacteria | 2129 |
| 85 | Ga0070681_10186772 | 3300005458 | Bacteria | 1993 |
| 86 | Ga0070681_10256017 | 3300005458 | Bacteria | 1662 |
| 87 | Ga0070685_10067640 | 3300005466 | Bacteria | 2108 |
| 88 | Ga0070679_100007899 | 3300005530 | Bacteria | 9982 |
| 89 | Ga0070679_100132542 | 3300005530 | Bacteria | 2473 |
| 90 | Ga0068853_100003442 | 3300005539 | Bacteria | 12106 |
| 91 | Ga0068853_100005385 | 3300005539 | Bacteria | 10018 |
| 92 | Ga0068853_100161317 | 3300005539 | Bacteria | 2023 |
| 93 | Ga0068853_100168819 | 3300005539 | Bacteria | 1978 |
| 94 | Ga0068853_100173192 | 3300005539 | Bacteria | 1953 |
| 95 | Ga0070696_100000357 | 3300005546 | Bacteria | 27875 |
| 96 | Ga0070696_100004863 | 3300005546 | Bacteria | 8978 |
| 97 | Ga0070696_100005209 | 3300005546 | Bacteria | 8692 |
| 98 | Ga0070696_100092988 | 3300005546 | Bacteria | 2150 |
| 99 | Ga0070693_100000882 | 3300005547 | Bacteria | 13346 |
| 100 | Ga0070693_100040722 | 3300005547 | Bacteria | 2610 |
| 101 | Ga0068855_100014533 | 3300005563 | Bacteria | 9482 |
| 102 | Ga0068855_100058198 | 3300005563 | Bacteria | 4527 |
| 103 | Ga0068855_100076161 | 3300005563 | Bacteria | 3894 |
| 104 | Ga0068855_100105254 | 3300005563 | Bacteria | 3244 |
| 105 | Ga0068855_100439241 | 3300005563 | Bacteria | 1425 |
| 106 | Ga0068855_100475087 | 3300005563 | Bacteria | 1361 |
| 107 | Ga0068857_100006695 | 3300005577 | Bacteria | 9906 |
| 108 | Ga0068857_100087956 | 3300005577 | Bacteria | 2779 |
| 109 | Ga0068857_100215524 | 3300005577 | Bacteria | 1753 |
| 110 | Ga0068854_100006992 | 3300005578 | Bacteria | 7196 |
| 111 | Ga0068854_100017143 | 3300005578 | Bacteria | 4842 |
| 112 | Ga0068854_100117109 | 3300005578 | Bacteria | 2017 |
| 113 | Ga0068856_100000088 | 3300005614 | Bacteria | 85931 |
| 114 | Ga0068856_100015285 | 3300005614 | Bacteria | 7416 |
| 115 | Ga0068856_100035641 | 3300005614 | Bacteria | 4877 |
| 116 | Ga0068856_100041344 | 3300005614 | Bacteria | 4530 |
| 117 | Ga0068856_100295055 | 3300005614 | Bacteria | 1638 |
| 118 | Ga0068856_100423367 | 3300005614 | Bacteria | 1351 |
| 119 | Ga0068852_100024221 | 3300005616 | Bacteria | 4902 |
| 120 | Ga0068852_100035332 | 3300005616 | Bacteria | 4168 |
| 121 | Ga0068852_100092362 | 3300005616 | Bacteria | 2710 |
| 122 | Ga0068852_100174291 | 3300005616 | Bacteria | 2018 |
| 123 | Ga0068863_100288849 | 3300005841 | Bacteria | 1590 |
| 124 | Ga0068858_100076676 | 3300005842 | Bacteria | 3105 |
| 125 | Ga0068860_100013356 | 3300005843 | Bacteria | 8051 |
| 126 | Ga0105240_10003419 | 3300009093 | Bacteria | 24663 |
| 127 | Ga0105240_10009031 | 3300009093 | Bacteria | 14155 |
| 128 | Ga0105240_10017579 | 3300009093 | Bacteria | 9635 |
| 129 | Ga0105240_10126228 | 3300009093 | Bacteria | 3074 |
| 130 | Ga0105240_10164886 | 3300009093 | Bacteria | 2629 |
| 131 | Ga0105240_10252329 | 3300009093 | Bacteria | 2040 |
| 132 | Ga0105240_10442638 | 3300009093 | Bacteria | 1456 |
| 133 | Ga0105247_10005430 | 3300009101 | Bacteria | 8029 |
| 134 | Ga0105241_10024312 | 3300009174 | Bacteria | 4499 |
| 135 | Ga0105237_10000058 | 3300009545 | Bacteria | 146943 |
| 136 | Ga0105237_10000777 | 3300009545 | Bacteria | 43669 |
| 137 | Ga0105237_10718797 | 3300009545 | Bacteria | 1005 |
| 138 | Ga0105238_10000428 | 3300009551 | Bacteria | 44396 |
| 139 | Ga0105238_10002416 | 3300009551 | Bacteria | 18737 |
| 140 | Ga0105238_10003804 | 3300009551 | Bacteria | 14993 |
| 141 | Ga0105238_10041722 | 3300009551 | Bacteria | 4647 |
| 142 | Ga0105238_10194465 | 3300009551 | Bacteria | 2004 |
| 143 | Ga0105238_10198106 | 3300009551 | Bacteria | 1984 |
| 144 | Ga0105238_10242002 | 3300009551 | Bacteria | 1782 |
| 145 | Ga0105249_10056528 | 3300009553 | Bacteria | 3592 |
| 146 | Ga0105147_100851 | 3300009982 | Bacteria | 2472 |
| 147 | Ga0105239_10005406 | 3300010375 | Bacteria | 14984 |
| 148 | Ga0105239_10021782 | 3300010375 | Bacteria | 7065 |
| 149 | Ga0105239_10026086 | 3300010375 | Bacteria | 6433 |
| 150 | Ga0105239_10110342 | 3300010375 | Bacteria | 3049 |
| 151 | Ga0157314_1000012 | 3300012500 | Bacteria | 17830 |
| 152 | Ga0157373_10000805 | 3300013100 | Bacteria | 24257 |
| 153 | Ga0157373_10084130 | 3300013100 | Bacteria | 2243 |
| 154 | Ga0157373_10124667 | 3300013100 | Bacteria | 1811 |
| 155 | Ga0157371_10003280 | 3300013102 | Bacteria | 14813 |
| 156 | Ga0157371_10020161 | 3300013102 | Bacteria | 4907 |
| 157 | Ga0157371_10059103 | 3300013102 | Bacteria | 2719 |
| 158 | Ga0157371_10147392 | 3300013102 | Bacteria | 1678 |
| 159 | Ga0157370_10001873 | 3300013104 | Bacteria | 25937 |
| 160 | Ga0157370_10003026 | 3300013104 | Bacteria | 19954 |
| 161 | Ga0157370_10011839 | 3300013104 | Bacteria | 9099 |
| 162 | Ga0157370_10017280 | 3300013104 | Bacteria | 7281 |
| 163 | Ga0157370_10031638 | 3300013104 | Bacteria | 5174 |
| 164 | Ga0157370_10077276 | 3300013104 | Bacteria | 3136 |
| 165 | Ga0157369_10001681 | 3300013105 | Bacteria | 27000 |
| 166 | Ga0157369_10041370 | 3300013105 | Bacteria | 5030 |
| 167 | Ga0157369_10100640 | 3300013105 | Bacteria | 3080 |
| 168 | Ga0157369_10225589 | 3300013105 | Bacteria | 1960 |
| 169 | Ga0157369_10490634 | 3300013105 | Bacteria | 1271 |
| 170 | Ga0163162_10000848 | 3300013306 | Bacteria | 28416 |
| 171 | Ga0157372_10002093 | 3300013307 | Bacteria | 21693 |
| 172 | Ga0157372_10092723 | 3300013307 | Bacteria | 3436 |
| 173 | Ga0157372_10134218 | 3300013307 | Bacteria | 2850 |
| 174 | Ga0157372_10208479 | 3300013307 | Bacteria | 2264 |
| 175 | Ga0157372_10274815 | 3300013307 | Bacteria | 1958 |
| 176 | Ga0157372_10428225 | 3300013307 | Bacteria | 1542 |
| 177 | Ga0182008_10003482 | 3300014497 | Bacteria | 9498 |
| 178 | Ga0182008_10021450 | 3300014497 | Bacteria | 3316 |
| 179 | Ga0182008_10027917 | 3300014497 | Bacteria | 2856 |
| 180 | Ga0182006_1000082 | 3300015261 | Bacteria | 119023 |
| 181 | Ga0182006_1000319 | 3300015261 | Bacteria | 42157 |
| 182 | Ga0182006_1007188 | 3300015261 | Bacteria | 5115 |
| 183 | Ga0182007_10012867 | 3300015262 | Bacteria | 3208 |
| 184 | Ga0182007_10019921 | 3300015262 | Bacteria | 2404 |
| 185 | Ga0182005_1000015 | 3300015265 | Bacteria | 387565 |
| 186 | Ga0182005_1007876 | 3300015265 | Bacteria | 3167 |
| 187 | Ga0183369_1011 | 3300015685 | Bacteria | 252490 |
| 188 | Ga0183368_1007 | 3300015687 | Bacteria | 405609 |
| 189 | Ga0206356_10344540 | 3300020070 | Bacteria | 3316 |
| 190 | Ga0206356_10813108 | 3300020070 | Bacteria | 7135 |
| 191 | Ga0206354_10058580 | 3300020081 | Bacteria | 7556 |
| 192 | Ga0206353_10313916 | 3300020082 | Bacteria | 1511 |
| 193 | Ga0206353_10367129 | 3300020082 | Bacteria | 6431 |
| 194 | Ga0206353_10641193 | 3300020082 | Bacteria | 2391 |
| 195 | Ga0206353_11510336 | 3300020082 | Bacteria | 2094 |
| 196 | Ga0154015_1113103 | 3300020610 | Bacteria | 3046 |
| 197 | Ga0209760_102767 | 3300025207 | Bacteria | 1609 |
| 198 | Ga0209784_100163 | 3300025224 | Bacteria | 57927 |
| 199 | Ga0209674_100037 | 3300025226 | Bacteria | 404339 |
| 200 | Ga0209674_100058 | 3300025226 | Bacteria | 286902 |
| 201 | Ga0209674_100874 | 3300025226 | Bacteria | 9813 |
| 202 | Ga0209674_100924 | 3300025226 | Bacteria | 9386 |
| 203 | Ga0209672_100043 | 3300025228 | Bacteria | 270302 |
| 204 | Ga0209672_100061 | 3300025228 | Bacteria | 206098 |
| 205 | Ga0209672_100077 | 3300025228 | Bacteria | 158067 |
| 206 | Ga0209672_102380 | 3300025228 | Bacteria | 4693 |
| 207 | Ga0209563_100062 | 3300025230 | Bacteria | 264769 |
| 208 | Ga0207427_100031 | 3300025231 | Bacteria | 350866 |
| 209 | Ga0207427_100196 | 3300025231 | Bacteria | 57937 |
| 210 | Ga0207427_100258 | 3300025231 | Bacteria | 41628 |
| 211 | Ga0207427_100275 | 3300025231 | Bacteria | 38754 |
| 212 | Ga0207427_104453 | 3300025231 | Bacteria | 2354 |
| 213 | Ga0209437_100061 | 3300025233 | Bacteria | 350866 |
| 214 | Ga0209437_100121 | 3300025233 | Bacteria | 202531 |
| 215 | Ga0209437_100132 | 3300025233 | Bacteria | 178495 |
| 216 | Ga0209437_100345 | 3300025233 | Bacteria | 54531 |
| 217 | Ga0209437_100385 | 3300025233 | Bacteria | 43317 |
| 218 | Ga0209437_100685 | 3300025233 | Bacteria | 18042 |
| 219 | Ga0209258_100054 | 3300025242 | Bacteria | 339063 |
| 220 | Ga0209258_100076 | 3300025242 | Bacteria | 270302 |
| 221 | Ga0209258_100097 | 3300025242 | Bacteria | 216963 |
| 222 | Ga0209258_100384 | 3300025242 | Bacteria | 56539 |
| 223 | Ga0209258_100514 | 3300025242 | Bacteria | 37294 |
| 224 | Ga0209258_100565 | 3300025242 | Bacteria | 31952 |
| 225 | Ga0209646_1000643 | 3300025246 | Bacteria | 13097 |
| 226 | Ga0209646_1001170 | 3300025246 | Bacteria | 7628 |
| 227 | Ga0209646_1002495 | 3300025246 | Bacteria | 4045 |
| 228 | Ga0209026_1000119 | 3300025250 | Bacteria | 130220 |
| 229 | Ga0209026_1000130 | 3300025250 | Bacteria | 120413 |
| 230 | Ga0209026_1000147 | 3300025250 | Bacteria | 111301 |
| 231 | Ga0209026_1000286 | 3300025250 | Bacteria | 57937 |
| 232 | Ga0209026_1000337 | 3300025250 | Bacteria | 45585 |
| 233 | Ga0209026_1001327 | 3300025250 | Bacteria | 11105 |
| 234 | Ga0209148_1000047 | 3300025254 | Bacteria | 434369 |
| 235 | Ga0209148_1000055 | 3300025254 | Bacteria | 367500 |
| 236 | Ga0209148_1000063 | 3300025254 | Bacteria | 346881 |
| 237 | Ga0209148_1000066 | 3300025254 | Bacteria | 339063 |
| 238 | Ga0209148_1000082 | 3300025254 | Bacteria | 270302 |
| 239 | Ga0209148_1000611 | 3300025254 | Bacteria | 31952 |
| 240 | Ga0209148_1001587 | 3300025254 | Bacteria | 10735 |
| 241 | Ga0209759_1000176 | 3300025256 | Bacteria | 105921 |
| 242 | Ga0209759_1000218 | 3300025256 | Bacteria | 88056 |
| 243 | Ga0209759_1000651 | 3300025256 | Bacteria | 32313 |
| 244 | Ga0209759_1001247 | 3300025256 | Bacteria | 15426 |
| 245 | Ga0209759_1002602 | 3300025256 | Bacteria | 7784 |
| 246 | Ga0209759_1013168 | 3300025256 | Bacteria | 2251 |
| 247 | Ga0209129_1000331 | 3300025258 | Bacteria | 41001 |
| 248 | Ga0209129_1011029 | 3300025258 | Bacteria | 2193 |
| 249 | Ga0209233_1000076 | 3300025261 | Bacteria | 350866 |
| 250 | Ga0209233_1000100 | 3300025261 | Bacteria | 293905 |
| 251 | Ga0209233_1000112 | 3300025261 | Bacteria | 258251 |
| 252 | Ga0209233_1000114 | 3300025261 | Bacteria | 246083 |
| 253 | Ga0209455_1000078 | 3300025272 | Bacteria | 270237 |
| 254 | Ga0209455_1000096 | 3300025272 | Bacteria | 217006 |
| 255 | Ga0209455_1000101 | 3300025272 | Bacteria | 206098 |
| 256 | Ga0209455_1000270 | 3300025272 | Bacteria | 57937 |
| 257 | Ga0209455_1000636 | 3300025272 | Bacteria | 21526 |
| 258 | Ga0209758_1002347 | 3300025297 | Bacteria | 19502 |
| 259 | Ga0209256_1014451 | 3300025299 | Bacteria | 2839 |
| 260 | Ga0207656_10016293 | 3300025321 | Bacteria | 2892 |
| 261 | Ga0207692_10019978 | 3300025898 | Bacteria | 3038 |
| 262 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 263 | Ga0207647_10000130 | 3300025904 | Bacteria | 58985 |
| 264 | Ga0207647_10001258 | 3300025904 | Bacteria | 19480 |
| 265 | Ga0207647_10001536 | 3300025904 | Bacteria | 17773 |
| 266 | Ga0207647_10022280 | 3300025904 | Bacteria | 4210 |
| 267 | Ga0207705_10001263 | 3300025909 | Bacteria | 20310 |
| 268 | Ga0207705_10011495 | 3300025909 | Bacteria | 6402 |
| 269 | Ga0207705_10015090 | 3300025909 | Bacteria | 5554 |
| 270 | Ga0207705_10105711 | 3300025909 | Bacteria | 2075 |
| 271 | Ga0207705_10113516 | 3300025909 | Bacteria | 2004 |
| 272 | Ga0207705_10114384 | 3300025909 | Bacteria | 1996 |
| 273 | Ga0207705_10326292 | 3300025909 | Bacteria | 1180 |
| 274 | Ga0207707_10000191 | 3300025912 | Bacteria | 64552 |
| 275 | Ga0207707_10000930 | 3300025912 | Bacteria | 28392 |
| 276 | Ga0207707_10001518 | 3300025912 | Bacteria | 21417 |
| 277 | Ga0207707_10003336 | 3300025912 | Bacteria | 14252 |
| 278 | Ga0207707_10036458 | 3300025912 | Bacteria | 4299 |
| 279 | Ga0207695_10000890 | 3300025913 | Bacteria | 54211 |
| 280 | Ga0207695_10001815 | 3300025913 | Bacteria | 33615 |
| 281 | Ga0207695_10001978 | 3300025913 | Bacteria | 31654 |
| 282 | Ga0207695_10003800 | 3300025913 | Bacteria | 20939 |
| 283 | Ga0207695_10004750 | 3300025913 | Bacteria | 18386 |
| 284 | Ga0207695_10004802 | 3300025913 | Bacteria | 18287 |
| 285 | Ga0207695_10010285 | 3300025913 | Bacteria | 11458 |
| 286 | Ga0207695_10011413 | 3300025913 | Bacteria | 10768 |
| 287 | Ga0207695_10038912 | 3300025913 | Bacteria | 5115 |
| 288 | Ga0207695_10159409 | 3300025913 | Bacteria | 2189 |
| 289 | Ga0207671_10000026 | 3300025914 | Bacteria | 268845 |
| 290 | Ga0207671_10000260 | 3300025914 | Bacteria | 79210 |
| 291 | Ga0207660_10001101 | 3300025917 | Bacteria | 18049 |
| 292 | Ga0207660_10003239 | 3300025917 | Bacteria | 10656 |
| 293 | Ga0207660_10007280 | 3300025917 | Bacteria | 7161 |
| 294 | Ga0207660_10018262 | 3300025917 | Bacteria | 4672 |
| 295 | Ga0207657_10017066 | 3300025919 | Bacteria | 6982 |
| 296 | Ga0207657_10026773 | 3300025919 | Bacteria | 5291 |
| 297 | Ga0207657_10070370 | 3300025919 | Bacteria | 2966 |
| 298 | Ga0207657_10083951 | 3300025919 | Bacteria | 2671 |
| 299 | Ga0207657_10138459 | 3300025919 | Bacteria | 1990 |
| 300 | Ga0207657_10147890 | 3300025919 | Bacteria | 1915 |
| 301 | Ga0207649_10000813 | 3300025920 | Bacteria | 20064 |
| 302 | Ga0207649_10054906 | 3300025920 | Bacteria | 2481 |
| 303 | Ga0207649_10057251 | 3300025920 | Bacteria | 2437 |
| 304 | Ga0207649_10136054 | 3300025920 | Bacteria | 1675 |
| 305 | Ga0207649_10140811 | 3300025920 | Bacteria | 1650 |
| 306 | Ga0207652_10000534 | 3300025921 | Bacteria | 38545 |
| 307 | Ga0207652_10000855 | 3300025921 | Bacteria | 28951 |
| 308 | Ga0207652_10011131 | 3300025921 | Bacteria | 7251 |
| 309 | Ga0207652_10158209 | 3300025921 | Bacteria | 2030 |
| 310 | Ga0207652_10169616 | 3300025921 | Bacteria | 1958 |
| 311 | Ga0207652_10209810 | 3300025921 | Bacteria | 1753 |
| 312 | Ga0207694_10000322 | 3300025924 | Bacteria | 45212 |
| 313 | Ga0207694_10006152 | 3300025924 | Bacteria | 9172 |
| 314 | Ga0207694_10006156 | 3300025924 | Bacteria | 9170 |
| 315 | Ga0207694_10017993 | 3300025924 | Bacteria | 5341 |
| 316 | Ga0207694_10046351 | 3300025924 | Bacteria | 3360 |
| 317 | Ga0207694_10064509 | 3300025924 | Bacteria | 2854 |
| 318 | Ga0207694_10146315 | 3300025924 | Bacteria | 1902 |
| 319 | Ga0207700_10118661 | 3300025928 | Bacteria | 2141 |
| 320 | Ga0207664_10000131 | 3300025929 | Bacteria | 65529 |
| 321 | Ga0207664_10000403 | 3300025929 | Bacteria | 30881 |
| 322 | Ga0207664_10184543 | 3300025929 | Bacteria | 1792 |
| 323 | Ga0207690_10001020 | 3300025932 | Bacteria | 17929 |
| 324 | Ga0207690_10001569 | 3300025932 | Bacteria | 14300 |
| 325 | Ga0207690_10011392 | 3300025932 | Bacteria | 5319 |
| 326 | Ga0207690_10012854 | 3300025932 | Bacteria | 5016 |
| 327 | Ga0207690_10073456 | 3300025932 | Bacteria | 2365 |
| 328 | Ga0207690_10110973 | 3300025932 | Bacteria | 1975 |
| 329 | Ga0207706_10151314 | 3300025933 | Bacteria | 2041 |
| 330 | Ga0207706_10217562 | 3300025933 | Bacteria | 1673 |
| 331 | Ga0207661_10001167 | 3300025944 | Bacteria | 17544 |
| 332 | Ga0207667_10000228 | 3300025949 | Bacteria | 78952 |
| 333 | Ga0207667_10000423 | 3300025949 | Bacteria | 57047 |
| 334 | Ga0207667_10002262 | 3300025949 | Bacteria | 24191 |
| 335 | Ga0207667_10004840 | 3300025949 | Bacteria | 16461 |
| 336 | Ga0207667_10007055 | 3300025949 | Bacteria | 13575 |
| 337 | Ga0207667_10018795 | 3300025949 | Bacteria | 7738 |
| 338 | Ga0207667_10054904 | 3300025949 | Bacteria | 4189 |
| 339 | Ga0207667_10085920 | 3300025949 | Bacteria | 3256 |
| 340 | Ga0207712_10025875 | 3300025961 | Bacteria | 3904 |
| 341 | Ga0207640_10001435 | 3300025981 | Bacteria | 12897 |
| 342 | Ga0207640_10002177 | 3300025981 | Bacteria | 10544 |
| 343 | Ga0207640_10004571 | 3300025981 | Bacteria | 7508 |
| 344 | Ga0207640_10006252 | 3300025981 | Bacteria | 6528 |
| 345 | Ga0207703_10008011 | 3300026035 | Bacteria | 8349 |
| 346 | Ga0207639_10001739 | 3300026041 | Bacteria | 14673 |
| 347 | Ga0207639_10002168 | 3300026041 | Bacteria | 13216 |
| 348 | Ga0207639_10007916 | 3300026041 | Bacteria | 7261 |
| 349 | Ga0207639_10015247 | 3300026041 | Bacteria | 5417 |
| 350 | Ga0207639_10017700 | 3300026041 | Bacteria | 5053 |
| 351 | Ga0207639_10032518 | 3300026041 | Bacteria | 3840 |
| 352 | Ga0207639_10146280 | 3300026041 | Bacteria | 1974 |
| 353 | Ga0207678_10003393 | 3300026067 | Bacteria | 14352 |
| 354 | Ga0207678_10024316 | 3300026067 | Bacteria | 5291 |
| 355 | Ga0207678_10083549 | 3300026067 | Bacteria | 2731 |
| 356 | Ga0207678_10153442 | 3300026067 | Bacteria | 1967 |
| 357 | Ga0207678_10263048 | 3300026067 | Bacteria | 1479 |
| 358 | Ga0207678_10346586 | 3300026067 | Bacteria | 1281 |
| 359 | Ga0207702_10000649 | 3300026078 | Bacteria | 37917 |
| 360 | Ga0207702_10001573 | 3300026078 | Bacteria | 22598 |
| 361 | Ga0207702_10003811 | 3300026078 | Bacteria | 13607 |
| 362 | Ga0207702_10120326 | 3300026078 | Bacteria | 2349 |
| 363 | Ga0207641_10191250 | 3300026088 | Bacteria | 1881 |
| 364 | Ga0207674_10000219 | 3300026116 | Bacteria | 71283 |
| 365 | Ga0207674_10008157 | 3300026116 | Bacteria | 12145 |
| 366 | Ga0207674_10069528 | 3300026116 | Bacteria | 3541 |
| 367 | Ga0207674_10130368 | 3300026116 | Bacteria | 2478 |
| 368 | Ga0207674_10230168 | 3300026116 | Bacteria | 1801 |
| 369 | Ga0207674_10267874 | 3300026116 | Bacteria | 1656 |
| 370 | Ga0207675_100034792 | 3300026118 | Bacteria | 4698 |
| 371 | Ga0207698_10001997 | 3300026142 | Bacteria | 12015 |
| 372 | Ga0207698_10039602 | 3300026142 | Bacteria | 3493 |
| 373 | Ga0207698_10055048 | 3300026142 | Bacteria | 3063 |
| 374 | Ga0268266_10000148 | 3300028379 | Bacteria | 135001 |
| 375 | Ga0268264_10075559 | 3300028381 | Bacteria | 2865 |
| 376 | Ga0307405_10291375 | 3300031731 | Bacteria | 1234 |
| 377 | Ga0307412_10001046 | 3300031911 | Bacteria | 15798 |
| 378 | Ga0307510_10000211 | 3300033180 | Bacteria | 51532 |
| 379 | Ga0307510_10241439 | 3300033180 | Bacteria | 1301 |
| 380 | Ga0395899_0000410 | 3300037312 | Bacteria | 50063 |
| 381 | Ga0395899_0005527 | 3300037312 | Bacteria | 9790 |
| 382 | Ga0395899_0026012 | 3300037312 | Bacteria | 4416 |
| 383 | Ga0395899_0030816 | 3300037312 | Bacteria | 4033 |
| 384 | Ga0395899_0043225 | 3300037312 | Bacteria | 3361 |
| 385 | Ga0395899_0057995 | 3300037312 | Bacteria | 2856 |
| 386 | Ga0395899_0069963 | 3300037312 | Bacteria | 2568 |
| 387 | Ga0395900_0000206 | 3300037418 | Bacteria | 92782 |
| 388 | Ga0395900_0000656 | 3300037418 | Bacteria | 46333 |
| 389 | Ga0395900_0001137 | 3300037418 | Bacteria | 33592 |
| 390 | Ga0395900_0004679 | 3300037418 | Bacteria | 14427 |
| 391 | Ga0395900_0015796 | 3300037418 | Bacteria | 7697 |
| 392 | Ga0395900_0039144 | 3300037418 | Bacteria | 4886 |
| 393 | Ga0395900_0055819 | 3300037418 | Bacteria | 4067 |
| 394 | Ga0395900_0056124 | 3300037418 | Bacteria | 4054 |
| 395 | Ga0395900_0165780 | 3300037418 | Bacteria | 2251 |
| 396 | Ga0395900_0170694 | 3300037418 | Bacteria | 2215 |
| 397 | Ga0395898_0000013 | 3300037466 | Bacteria | 458788 |
| 398 | Ga0395898_0000120 | 3300037466 | Bacteria | 209091 |
| 399 | Ga0395898_0093264 | 3300037466 | Bacteria | 2894 |
| 400 | Ga0395898_0161307 | 3300037466 | Bacteria | 2144 |
| 401 | Ga0395901_0000767 | 3300038443 | Bacteria | 35998 |
| 402 | Ga0395901_0006931 | 3300038443 | Bacteria | 11454 |
| 403 | Ga0395901_0009703 | 3300038443 | Bacteria | 9763 |
| 404 | Ga0395901_0063271 | 3300038443 | Bacteria | 3850 |
| 405 | Ga0395901_0221705 | 3300038443 | Bacteria | 1976 |
| 406 | Ga0395901_0236221 | 3300038443 | Bacteria | 1907 |
| 407 | Ga0439436_0000019 | 3300041404 | Bacteria | 70584 |
| 408 | Ga0451793_0808167 | 3300041452 | Bacteria | 10328 |
| 409 | Ga0451843_0901753 | 3300041509 | Bacteria | 1476 |
| 410 | Ga0451853_2586392 | 3300041512 | Bacteria | 1620 |
| 411 | Ga0439454_001532 | 3300042011 | Bacteria | 2248 |
| 412 | Ga0450908_000049 | 3300042184 | Bacteria | 23852 |
| 413 | Ga0439459_0008918 | 3300042438 | Bacteria | 1725 |
| 414 | Ga0466969_0008616 | 3300044656 | Bacteria | 5409 |
| 415 | Ga0466982_0000052 | 3300044672 | Bacteria | 31957 |
| 416 | Ga0466965_0000819 | 3300044683 | Bacteria | 11733 |
| 417 | Ga0466965_0165442 | 3300044683 | Bacteria | 1161 |
| 418 | Ga0466966_0002019 | 3300044684 | Bacteria | 13167 |
| 419 | Ga0466966_0002721 | 3300044684 | Bacteria | 11603 |
| 420 | Ga0466966_0153891 | 3300044684 | Bacteria | 1401 |
| 421 | Ga0466966_0201724 | 3300044684 | Bacteria | 1203 |
| 422 | Ga0466961_0000918 | 3300044693 | Bacteria | 18234 |
| 423 | Ga0466961_0004185 | 3300044693 | Bacteria | 9015 |
| 424 | Ga0466961_0014997 | 3300044693 | Bacteria | 4975 |
| 425 | Ga0466961_0026691 | 3300044693 | Bacteria | 3713 |
| 426 | Ga0466963_0036297 | 3300044694 | Bacteria | 3214 |
| 427 | Ga0466963_0066957 | 3300044694 | Bacteria | 2410 |
| 428 | Ga0466963_0093703 | 3300044694 | Bacteria | 2048 |
| 429 | Ga0466964_0006557 | 3300044706 | Bacteria | 4341 |
| 430 | Ga0466971_0002229 | 3300044719 | Bacteria | 8203 |
| 431 | Ga0466971_0011251 | 3300044719 | Bacteria | 3919 |
| 432 | Ga0466971_0021285 | 3300044719 | Bacteria | 2886 |
| 433 | Ga0466968_0012234 | 3300044735 | Bacteria | 3353 |
| 434 | Ga0466970_0001636 | 3300044765 | Bacteria | 10779 |
| 435 | Ga0466970_0014104 | 3300044765 | Bacteria | 4098 |
| 436 | Ga0466970_0087871 | 3300044765 | Bacteria | 1686 |
| 437 | Ga0466970_0156525 | 3300044765 | Bacteria | 1259 |
| 438 | Ga0466957_0028743 | 3300044842 | Bacteria | 3311 |
| 439 | Ga0466957_0180920 | 3300044842 | Bacteria | 1377 |
| 440 | Ga0466959_0000150 | 3300045049 | Bacteria | 45744 |
| 441 | Ga0466959_0003671 | 3300045049 | Bacteria | 10120 |
| 442 | Ga0466959_0040298 | 3300045049 | Bacteria | 3451 |
| 443 | Ga0466959_0079725 | 3300045049 | Bacteria | 2360 |
| 444 | Ga0466958_0003787 | 3300045836 | Bacteria | 7895 |
| 445 | Ga0466958_0017902 | 3300045836 | Bacteria | 4105 |
| 446 | Ga0466958_0068995 | 3300045836 | Bacteria | 2162 |
| 447 | Ga0466967_0148148 | 3300045976 | Bacteria | 2191 |
| 448 | Ga0495617_000448 | 3300046452 | Bacteria | 22211 |
| 449 | Ga0495590_0066795 | 3300046457 | Bacteria | 1260 |
| 450 | Ga0495638_0000090 | 3300046460 | Bacteria | 148040 |
| 451 | Ga0495638_0000252 | 3300046460 | Bacteria | 72913 |
| 452 | Ga0495638_0000361 | 3300046460 | Bacteria | 56377 |
| 453 | Ga0495638_0001484 | 3300046460 | Bacteria | 21202 |
| 454 | Ga0495638_0017975 | 3300046460 | Bacteria | 4705 |
| 455 | Ga0495650_0000092 | 3300046471 | Bacteria | 224681 |
| 456 | Ga0495650_0000218 | 3300046471 | Bacteria | 120583 |
| 457 | Ga0495650_0003523 | 3300046471 | Bacteria | 11340 |
| 458 | Ga0495650_0028891 | 3300046471 | Bacteria | 2535 |
| 459 | Ga0495584_0156912 | 3300046491 | Bacteria | 1156 |
| 460 | Ga0495585_0000024 | 3300046492 | Bacteria | 148384 |
| 461 | Ga0495585_0005782 | 3300046492 | Bacteria | 7756 |
| 462 | Ga0495607_0003628 | 3300046501 | Bacteria | 11719 |
| 463 | Ga0495606_0000849 | 3300046507 | Bacteria | 45936 |
| 464 | Ga0495606_0001041 | 3300046507 | Bacteria | 40103 |
| 465 | Ga0495606_0002605 | 3300046507 | Bacteria | 20633 |
| 466 | Ga0495606_0005569 | 3300046507 | Bacteria | 12007 |
| 467 | Ga0495606_0039287 | 3300046507 | Bacteria | 3192 |
| 468 | Ga0495606_0110348 | 3300046507 | Bacteria | 1660 |
| 469 | Ga0495610_0007613 | 3300046512 | Bacteria | 7171 |
| 470 | Ga0495610_0094600 | 3300046512 | Bacteria | 1348 |
| 471 | Ga0495616_0001751 | 3300046513 | Bacteria | 14774 |
| 472 | Ga0495616_0018489 | 3300046513 | Bacteria | 3824 |
| 473 | Ga0495620_0000425 | 3300046515 | Bacteria | 28075 |
| 474 | Ga0495631_0001411 | 3300046518 | Bacteria | 14605 |
| 475 | Ga0495631_0002167 | 3300046518 | Bacteria | 11340 |
| 476 | Ga0495632_0000005 | 3300046519 | Bacteria | 362872 |
| 477 | Ga0495632_0128063 | 3300046519 | Bacteria | 1183 |
| 478 | Ga0495637_0004441 | 3300046520 | Bacteria | 7271 |
| 479 | Ga0495648_0000485 | 3300046524 | Bacteria | 42709 |
| 480 | Ga0495648_0005027 | 3300046524 | Bacteria | 11112 |
| 481 | Ga0495622_0002354 | 3300046557 | Bacteria | 9194 |
| 482 | Ga0495668_0006807 | 3300046616 | Bacteria | 7423 |
| 483 | Ga0495668_0056694 | 3300046616 | Bacteria | 2162 |
| 484 | Ga0495611_0000005 | 3300046648 | Bacteria | 284271 |
| 485 | Ga0495611_0000819 | 3300046648 | Bacteria | 17191 |
| 486 | Ga0495625_0001159 | 3300046660 | Bacteria | 33975 |
| 487 | Ga0495625_0015957 | 3300046660 | Bacteria | 5924 |
| 488 | Ga0495625_0077431 | 3300046660 | Bacteria | 2323 |
| 489 | Ga0495625_0113941 | 3300046660 | Bacteria | 1846 |
| 490 | Ga0495661_0001221 | 3300046665 | Bacteria | 22306 |
| 491 | Ga0495670_0002168 | 3300046691 | Bacteria | 9711 |
| 492 | Ga0495670_0004383 | 3300046691 | Bacteria | 6921 |
| 493 | Ga0495670_0027584 | 3300046691 | Bacteria | 2814 |
| 494 | Ga0495589_0000389 | 3300046794 | Bacteria | 33643 |
| 495 | Ga0495660_0000237 | 3300046810 | Bacteria | 53903 |
| 496 | Ga0495660_0006009 | 3300046810 | Bacteria | 7218 |
| 497 | Ga0495683_0003205 | 3300047323 | Bacteria | 9563 |
| 498 | Ga0495679_000382 | 3300047446 | Bacteria | 33973 |
| 499 | Ga0495673_0000038 | 3300047469 | Bacteria | 303785 |
| 500 | Ga0495673_0000685 | 3300047469 | Bacteria | 33195 |
| 501 | Ga0495673_0002075 | 3300047469 | Bacteria | 14634 |
| 502 | Ga0495686_0000050 | 3300047472 | Bacteria | 269010 |
| 503 | Ga0495686_0001912 | 3300047472 | Bacteria | 20797 |
| 504 | Ga0495686_0035918 | 3300047472 | Bacteria | 3181 |
| 505 | Ga0496100_0001269 | 3300048903 | Bacteria | 12326 |
| 506 | Ga0496101_0004978 | 3300048904 | Bacteria | 8437 |
| 507 | Ga0496104_0030897 | 3300048907 | Bacteria | 4980 |
| 508 | Ga0496105_0004975 | 3300048908 | Bacteria | 10051 |
| 509 | Ga0496106_0000786 | 3300048909 | Bacteria | 22916 |
| 510 | Ga0496113_0003396 | 3300048916 | Bacteria | 9525 |
| 511 | Ga0496115_0000427 | 3300048918 | Bacteria | 34248 |
| 512 | Ga0496115_0000644 | 3300048918 | Bacteria | 26233 |
| 513 | Ga0496115_0006005 | 3300048918 | Bacteria | 8865 |
| 514 | Ga0496115_0019782 | 3300048918 | Bacteria | 5185 |
| 515 | Ga0496115_0023794 | 3300048918 | Bacteria | 4756 |
| 516 | Ga0496117_0007752 | 3300048920 | Bacteria | 10370 |
| 517 | Ga0496117_0009380 | 3300048920 | Bacteria | 9112 |
| 518 | Ga0496117_0020494 | 3300048920 | Bacteria | 5386 |
| 519 | Ga0496117_0024071 | 3300048920 | Bacteria | 4829 |
| 520 | Ga0496118_0004444 | 3300048921 | Bacteria | 16635 |
| 521 | Ga0496118_0004962 | 3300048921 | Bacteria | 15395 |
| 522 | Ga0496118_0005405 | 3300048921 | Bacteria | 14533 |
| 523 | Ga0496118_0010204 | 3300048921 | Bacteria | 9325 |
| 524 | Ga0496118_0169965 | 3300048921 | Bacteria | 1333 |
| 525 | Ga0496119_0000725 | 3300048922 | Bacteria | 44399 |
| 526 | Ga0496119_0011971 | 3300048922 | Bacteria | 7107 |
| 527 | Ga0496120_0000821 | 3300048923 | Bacteria | 44390 |
| 528 | Ga0496120_0001981 | 3300048923 | Bacteria | 22316 |
| 529 | Ga0496121_0001206 | 3300048924 | Bacteria | 45212 |
| 530 | Ga0496121_0005512 | 3300048924 | Bacteria | 16170 |
| 531 | Ga0496121_0012211 | 3300048924 | Bacteria | 9411 |
| 532 | Ga0496121_0015979 | 3300048924 | Bacteria | 7786 |
| 533 | Ga0496121_0108398 | 3300048924 | Bacteria | 2124 |
| 534 | Ga0496122_0008212 | 3300048925 | Bacteria | 11341 |
| 535 | Ga0496122_0011683 | 3300048925 | Bacteria | 8850 |
| 536 | Ga0496122_0043651 | 3300048925 | Bacteria | 3510 |
| 537 | Ga0496123_0009105 | 3300048926 | Bacteria | 8987 |
| 538 | Ga0496123_0009315 | 3300048926 | Bacteria | 8860 |
| 539 | Ga0496123_0181123 | 3300048926 | Bacteria | 1100 |
| 540 | Ga0496124_0001429 | 3300048927 | Bacteria | 35321 |
| 541 | Ga0496124_0055119 | 3300048927 | Bacteria | 3362 |
| 542 | Ga0496125_0002690 | 3300048928 | Bacteria | 22625 |
| 543 | Ga0496125_0250405 | 3300048928 | Bacteria | 1118 |
| 544 | Ga0496126_0005169 | 3300048929 | Bacteria | 15088 |
| 545 | Ga0496126_0006381 | 3300048929 | Bacteria | 13157 |
| 546 | Ga0496126_0011972 | 3300048929 | Bacteria | 8916 |
| 547 | Ga0496126_0047466 | 3300048929 | Bacteria | 3931 |
| 548 | Ga0496126_0047878 | 3300048929 | Bacteria | 3912 |
| 549 | Ga0496126_0205730 | 3300048929 | Bacteria | 1659 |
| 550 | Ga0495678_002592 | 3300049459 | Bacteria | 12088 |
| 551 | Ga0495678_033042 | 3300049459 | Bacteria | 2139 |
| 552 | Ga0495682_0005770 | 3300049460 | Bacteria | 5100 |
| 553 | Ga0495682_0039855 | 3300049460 | Bacteria | 1723 |
| 554 | Ga0501031_0181613 | 3300049568 | Bacteria | 1374 |
| 555 | Ga0501032_0000182 | 3300049569 | Bacteria | 51893 |
| 556 | Ga0501032_0012292 | 3300049569 | Bacteria | 6125 |
| 557 | Ga0501032_0020929 | 3300049569 | Bacteria | 4551 |
| 558 | Ga0501033_0055397 | 3300049570 | Bacteria | 2931 |
| 559 | Ga0501033_0118847 | 3300049570 | Bacteria | 1919 |
| 560 | Ga0501034_0002573 | 3300049571 | Bacteria | 21582 |
| 561 | Ga0501034_0007301 | 3300049571 | Bacteria | 11781 |
| 562 | Ga0501034_0049264 | 3300049571 | Bacteria | 4251 |
| 563 | Ga0501036_0020627 | 3300049572 | Bacteria | 5536 |
| 564 | Ga0501037_0002007 | 3300049573 | Bacteria | 14733 |
| 565 | Ga0501037_0015831 | 3300049573 | Bacteria | 5551 |
| 566 | Ga0501037_0028747 | 3300049573 | Bacteria | 4107 |
| 567 | Ga0501037_0162569 | 3300049573 | Bacteria | 1591 |
| 568 | Ga0501038_0000672 | 3300049574 | Bacteria | 30464 |
| 569 | Ga0501038_0080203 | 3300049574 | Bacteria | 2751 |
| 570 | Ga0501039_0056838 | 3300049575 | Bacteria | 3031 |
| 571 | Ga0501042_0125710 | 3300049578 | Bacteria | 1846 |
| 572 | Ga0501043_0005767 | 3300049579 | Bacteria | 9973 |
| 573 | Ga0501043_0017632 | 3300049579 | Bacteria | 5599 |
| 574 | Ga0501043_0026804 | 3300049579 | Bacteria | 4522 |
| 575 | Ga0501043_0072785 | 3300049579 | Bacteria | 2699 |
| 576 | Ga0501043_0550011 | 3300049579 | Bacteria | 857 |
| 577 | Ga0501046_0002020 | 3300049580 | Bacteria | 19263 |
| 578 | Ga0501046_0010346 | 3300049580 | Bacteria | 8018 |
| 579 | Ga0501046_0032789 | 3300049580 | Bacteria | 4202 |
| 580 | Ga0501047_0001223 | 3300049581 | Bacteria | 25482 |
| 581 | Ga0501047_0001404 | 3300049581 | Bacteria | 23604 |
| 582 | Ga0501047_0003195 | 3300049581 | Bacteria | 15539 |
| 583 | Ga0501047_0069157 | 3300049581 | Bacteria | 3400 |
| 584 | Ga0501048_0047634 | 3300049582 | Bacteria | 3058 |
| 585 | Ga0501069_0003670 | 3300049585 | Bacteria | 7901 |
| 586 | Ga0501069_0077664 | 3300049585 | Bacteria | 1867 |
| 587 | Ga0501070_0008982 | 3300049586 | Bacteria | 8454 |
| 588 | Ga0501070_0034926 | 3300049586 | Bacteria | 4202 |
| 589 | Ga0501070_0040778 | 3300049586 | Bacteria | 3871 |
| 590 | Ga0501070_0104097 | 3300049586 | Bacteria | 2347 |
| 591 | Ga0501071_0218503 | 3300049587 | Bacteria | 1434 |
| 592 | Ga0501073_0000312 | 3300049589 | Bacteria | 32213 |
| 593 | Ga0501073_0000426 | 3300049589 | Bacteria | 28851 |
| 594 | Ga0501074_0000594 | 3300049590 | Bacteria | 22480 |
| 595 | Ga0501079_0123705 | 3300049741 | Bacteria | 2012 |
| 596 | Ga0501080_0006171 | 3300049742 | Bacteria | 10755 |
| 597 | Ga0501080_0012648 | 3300049742 | Bacteria | 7740 |
| 598 | Ga0501080_0031157 | 3300049742 | Bacteria | 4969 |
| 599 | Ga0501035_0002325 | 3300049822 | Bacteria | 18738 |
| 600 | Ga0501035_0071715 | 3300049822 | Bacteria | 3066 |
| 601 | Ga0501035_0097206 | 3300049822 | Bacteria | 2586 |
| 602 | Ga0501035_0110059 | 3300049822 | Bacteria | 2414 |
| 603 | Ga0501044_0002778 | 3300049823 | Bacteria | 19937 |
| 604 | Ga0501044_0003174 | 3300049823 | Bacteria | 18560 |
| 605 | Ga0501044_0012333 | 3300049823 | Bacteria | 9252 |
| 606 | Ga0501044_0038344 | 3300049823 | Bacteria | 5004 |
| 607 | Ga0501044_0051333 | 3300049823 | Bacteria | 4252 |
| 608 | Ga0501044_0378752 | 3300049823 | Bacteria | 1330 |
| 609 | nmdc:mga0sz30_11551_c1 | 3300050516 | Bacteria | 3413 |
| 610 | Ga0500643_000378 | 3300053087 | Bacteria | 34748 |
| 611 | Ga0500651_0002524 | 3300053093 | Bacteria | 9698 |
| 612 | Ga0500555_000348 | 3300053103 | Bacteria | 19581 |
| 613 | Ga0500645_001206 | 3300053730 | Bacteria | 13727 |
| 614 | Ga0466962_0000743 | 3300061719 | Bacteria | 14631 |
| 615 | Ga0466962_0003083 | 3300061719 | Bacteria | 7932 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049586 | Ga0501070_0104097 | Ga0501070_0104097_1441_2280 | 266 |
| 2 | 3300013104 | Ga0157370_10003026 | Ga0157370_1000302613 | 274 |
| 3 | 3300049579 | Ga0501043_0550011 | Ga0501043_0550011_19_846 | 274 |
| 4 | 3300005841 | Ga0068863_100288849 | Ga0068863_1002888492 | 277 |
| 5 | 3300025924 | Ga0207694_10006156 | Ga0207694_100061565 | 277 |
| 6 | 3300026088 | Ga0207641_10191250 | Ga0207641_101912502 | 277 |
| 7 | 3300026118 | Ga0207675_100034792 | Ga0207675_1000347924 | 279 |
| 8 | 3300005614 | Ga0068856_100041344 | Ga0068856_1000413442 | 280 |
| 9 | 3300025228 | Ga0209672_100077 | Ga0209672_100077119 | 280 |
| 10 | 3300025231 | Ga0207427_100031 | Ga0207427_100031268 | 280 |
| 11 | 3300025233 | Ga0209437_100061 | Ga0209437_10006137 | 280 |
| 12 | 3300025242 | Ga0209258_100097 | Ga0209258_10009732 | 280 |
| 13 | 3300025242 | Ga0209258_100514 | Ga0209258_10051428 | 280 |
| 14 | 3300025246 | Ga0209646_1001170 | Ga0209646_10011703 | 280 |
| 15 | 3300025250 | Ga0209026_1000337 | Ga0209026_100033726 | 280 |
| 16 | 3300025254 | Ga0209148_1000063 | Ga0209148_100006332 | 280 |
| 17 | 3300025256 | Ga0209759_1000176 | Ga0209759_100017680 | 280 |
| 18 | 3300025261 | Ga0209233_1000076 | Ga0209233_1000076268 | 280 |
| 19 | 3300025272 | Ga0209455_1000096 | Ga0209455_100009632 | 280 |
| 20 | 3300026078 | Ga0207702_10001573 | Ga0207702_1000157319 | 280 |
| 21 | 3300037312 | Ga0395899_0000410 | Ga0395899_0000410_38296_39141 | 280 |
| 22 | 3300037312 | Ga0395899_0057995 | Ga0395899_0057995_1447_2292 | 280 |
| 23 | 3300037466 | Ga0395898_0000013 | Ga0395898_0000013_422856_423701 | 280 |
| 24 | 3300037466 | Ga0395898_0000120 | Ga0395898_0000120_169951_170796 | 280 |
| 25 | 3300044683 | Ga0466965_0000819 | Ga0466965_0000819_7104_7949 | 280 |
| 26 | 3300044683 | Ga0466965_0165442 | Ga0466965_0165442_273_1118 | 280 |
| 27 | 3300044684 | Ga0466966_0002019 | Ga0466966_0002019_6550_7395 | 280 |
| 28 | 3300044693 | Ga0466961_0004185 | Ga0466961_0004185_2827_3672 | 280 |
| 29 | 3300044693 | Ga0466961_0014997 | Ga0466961_0014997_2843_3688 | 280 |
| 30 | 3300044694 | Ga0466963_0093703 | Ga0466963_0093703_600_1445 | 280 |
| 31 | 3300044706 | Ga0466964_0006557 | Ga0466964_0006557_1121_1966 | 280 |
| 32 | 3300044719 | Ga0466971_0011251 | Ga0466971_0011251_203_1048 | 280 |
| 33 | 3300044719 | Ga0466971_0021285 | Ga0466971_0021285_336_1181 | 280 |
| 34 | 3300044765 | Ga0466970_0001636 | Ga0466970_0001636_7110_7955 | 280 |
| 35 | 3300044765 | Ga0466970_0014104 | Ga0466970_0014104_1356_2201 | 280 |
| 36 | 3300044842 | Ga0466957_0028743 | Ga0466957_0028743_2009_2854 | 280 |
| 37 | 3300045049 | Ga0466959_0000150 | Ga0466959_0000150_24558_25403 | 280 |
| 38 | 3300045049 | Ga0466959_0003671 | Ga0466959_0003671_5110_5955 | 280 |
| 39 | 3300045049 | Ga0466959_0079725 | Ga0466959_0079725_818_1663 | 280 |
| 40 | 3300045836 | Ga0466958_0003787 | Ga0466958_0003787_2566_3411 | 280 |
| 41 | 3300045976 | Ga0466967_0148148 | Ga0466967_0148148_1305_2150 | 280 |
| 42 | 3300061719 | Ga0466962_0003083 | Ga0466962_0003083_4647_5492 | 280 |
| 43 | 3300005843 | Ga0068860_100013356 | Ga0068860_1000133563 | 281 |
| 44 | 3300025231 | Ga0207427_104453 | Ga0207427_1044532 | 281 |
| 45 | 3300025233 | Ga0209437_100385 | Ga0209437_1003859 | 281 |
| 46 | 3300025254 | Ga0209148_1000055 | Ga0209148_1000055305 | 281 |
| 47 | 3300026116 | Ga0207674_10267874 | Ga0207674_102678742 | 281 |
| 48 | 3300028381 | Ga0268264_10075559 | Ga0268264_100755592 | 281 |
| 49 | 3300037312 | Ga0395899_0069963 | Ga0395899_0069963_1395_2246 | 282 |
| 50 | 3300037418 | Ga0395900_0001137 | Ga0395900_0001137_6812_7663 | 282 |
| 51 | 3300038443 | Ga0395901_0000767 | Ga0395901_0000767_17821_18672 | 282 |
| 52 | 3300049585 | Ga0501069_0077664 | Ga0501069_0077664_820_1776 | 282 |
| 53 | 3300049742 | Ga0501080_0012648 | Ga0501080_0012648_1212_2168 | 282 |
| 54 | 3300010375 | Ga0105239_10021782 | Ga0105239_100217822 | 283 |
| 55 | 3300025228 | Ga0209672_102380 | Ga0209672_1023803 | 283 |
| 56 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001751 | 283 |
| 57 | 3300025909 | Ga0207705_10113516 | Ga0207705_101135162 | 283 |
| 58 | 3300025920 | Ga0207649_10057251 | Ga0207649_100572511 | 283 |
| 59 | 3300025924 | Ga0207694_10000322 | Ga0207694_1000032218 | 283 |
| 60 | 3300028379 | Ga0268266_10000148 | Ga0268266_1000014851 | 283 |
| 61 | 3300045836 | Ga0466958_0068995 | Ga0466958_0068995_64_918 | 283 |
| 62 | 3300046460 | Ga0495638_0000361 | Ga0495638_0000361_32555_33481 | 283 |
| 63 | 3300046507 | Ga0495606_0000849 | Ga0495606_0000849_30756_31691 | 283 |
| 64 | 3300046507 | Ga0495606_0002605 | Ga0495606_0002605_8384_9238 | 283 |
| 65 | 3300046557 | Ga0495622_0002354 | Ga0495622_0002354_5207_6133 | 283 |
| 66 | 3300046660 | Ga0495625_0015957 | Ga0495625_0015957_3433_4359 | 283 |
| 67 | 3300046660 | Ga0495625_0113941 | Ga0495625_0113941_727_1662 | 283 |
| 68 | 3300047472 | Ga0495686_0035918 | Ga0495686_0035918_2283_3137 | 283 |
| 69 | 3300048918 | Ga0496115_0000644 | Ga0496115_0000644_22342_23277 | 283 |
| 70 | 3300048918 | Ga0496115_0023794 | Ga0496115_0023794_3802_4728 | 283 |
| 71 | 3300048929 | Ga0496126_0047466 | Ga0496126_0047466_2348_3283 | 283 |
| 72 | 3300048929 | Ga0496126_0205730 | Ga0496126_0205730_588_1523 | 283 |
| 73 | 3300049459 | Ga0495678_033042 | Ga0495678_033042_494_1429 | 283 |
| 74 | 3300049571 | Ga0501034_0049264 | Ga0501034_0049264_3215_4081 | 283 |
| 75 | 3300049578 | Ga0501042_0125710 | Ga0501042_0125710_402_1268 | 283 |
| 76 | 3300049579 | Ga0501043_0072785 | Ga0501043_0072785_973_1839 | 283 |
| 77 | 3300049580 | Ga0501046_0032789 | Ga0501046_0032789_3236_4102 | 283 |
| 78 | 3300049582 | Ga0501048_0047634 | Ga0501048_0047634_143_1009 | 283 |
| 79 | 3300049742 | Ga0501080_0031157 | Ga0501080_0031157_29_895 | 283 |
| 80 | 3300002737 | JGI25162J39368_1007020 | JGI25162J39368_10070202 | 284 |
| 81 | 3300003762 | Ga0055542_1000283 | Ga0055542_100028319 | 284 |
| 82 | 3300025250 | Ga0209026_1001327 | Ga0209026_10013275 | 284 |
| 83 | 3300002705 | JGI25156J39149_1003556 | JGI25156J39149_10035563 | 285 |
| 84 | 3300002737 | JGI25162J39368_1000239 | JGI25162J39368_100023930 | 285 |
| 85 | 3300002741 | JGI25157J39369_1000293 | JGI25157J39369_100029326 | 285 |
| 86 | 3300002771 | JGI25163J39215_1000359 | JGI25163J39215_10003596 | 285 |
| 87 | 3300002772 | JGI25164J39214_1000200 | JGI25164J39214_100020023 | 285 |
| 88 | 3300003214 | JGI25165J46597_1000319 | JGI25165J46597_100031930 | 285 |
| 89 | 3300003751 | Ga0055538_1000686 | Ga0055538_100068610 | 285 |
| 90 | 3300003761 | Ga0055535_1000242 | Ga0055535_100024230 | 285 |
| 91 | 3300003762 | Ga0055542_1000298 | Ga0055542_100029822 | 285 |
| 92 | 3300003763 | Ga0055529_1000437 | Ga0055529_100043730 | 285 |
| 93 | 3300025207 | Ga0209760_102767 | Ga0209760_1027672 | 285 |
| 94 | 3300025224 | Ga0209784_100163 | Ga0209784_10016325 | 285 |
| 95 | 3300025231 | Ga0207427_100196 | Ga0207427_10019625 | 285 |
| 96 | 3300025233 | Ga0209437_100345 | Ga0209437_10034527 | 285 |
| 97 | 3300025242 | Ga0209258_100384 | Ga0209258_10038430 | 285 |
| 98 | 3300025246 | Ga0209646_1000643 | Ga0209646_100064311 | 285 |
| 99 | 3300025250 | Ga0209026_1000286 | Ga0209026_100028625 | 285 |
| 100 | 3300025254 | Ga0209148_1000047 | Ga0209148_100004730 | 285 |
| 101 | 3300025256 | Ga0209759_1000651 | Ga0209759_100065122 | 285 |
| 102 | 3300025256 | Ga0209759_1001247 | Ga0209759_10012477 | 285 |
| 103 | 3300025261 | Ga0209233_1000100 | Ga0209233_1000100240 | 285 |
| 104 | 3300025272 | Ga0209455_1000270 | Ga0209455_100027025 | 285 |
| 105 | 3300013102 | Ga0157371_10003280 | Ga0157371_100032803 | 286 |
| 106 | 3300013105 | Ga0157369_10490634 | Ga0157369_104906341 | 286 |
| 107 | 3300025258 | Ga0209129_1000331 | Ga0209129_100033125 | 286 |
| 108 | 3300025912 | Ga0207707_10000191 | Ga0207707_1000019126 | 286 |
| 109 | 3300005458 | Ga0070681_10037437 | Ga0070681_100374372 | 288 |
| 110 | 3300005539 | Ga0068853_100003442 | Ga0068853_10000344211 | 288 |
| 111 | 3300005546 | Ga0070696_100004863 | Ga0070696_1000048638 | 288 |
| 112 | 3300005563 | Ga0068855_100105254 | Ga0068855_1001052542 | 288 |
| 113 | 3300005577 | Ga0068857_100215524 | Ga0068857_1002155242 | 288 |
| 114 | 3300010375 | Ga0105239_10026086 | Ga0105239_100260863 | 288 |
| 115 | 3300025912 | Ga0207707_10036458 | Ga0207707_100364584 | 288 |
| 116 | 3300025921 | Ga0207652_10209810 | Ga0207652_102098102 | 288 |
| 117 | 3300025949 | Ga0207667_10054904 | Ga0207667_100549043 | 288 |
| 118 | 3300026041 | Ga0207639_10001739 | Ga0207639_1000173912 | 288 |
| 119 | 3300026116 | Ga0207674_10230168 | Ga0207674_102301682 | 288 |
| 120 | 3300049569 | Ga0501032_0000182 | Ga0501032_0000182_6395_7402 | 288 |
| 121 | 3300049570 | Ga0501033_0118847 | Ga0501033_0118847_326_1333 | 288 |
| 122 | 3300049571 | Ga0501034_0002573 | Ga0501034_0002573_19262_20269 | 288 |
| 123 | 3300049573 | Ga0501037_0002007 | Ga0501037_0002007_9013_10020 | 288 |
| 124 | 3300049574 | Ga0501038_0000672 | Ga0501038_0000672_12692_13699 | 288 |
| 125 | 3300049575 | Ga0501039_0056838 | Ga0501039_0056838_601_1608 | 288 |
| 126 | 3300049579 | Ga0501043_0005767 | Ga0501043_0005767_326_1333 | 288 |
| 127 | 3300049580 | Ga0501046_0002020 | Ga0501046_0002020_8908_9915 | 288 |
| 128 | 3300049581 | Ga0501047_0003195 | Ga0501047_0003195_746_1753 | 288 |
| 129 | 3300049589 | Ga0501073_0000426 | Ga0501073_0000426_496_1503 | 288 |
| 130 | 3300049822 | Ga0501035_0002325 | Ga0501035_0002325_6395_7402 | 288 |
| 131 | 3300049823 | Ga0501044_0003174 | Ga0501044_0003174_4613_5620 | 288 |
| 132 | 3300005337 | Ga0070682_100005233 | Ga0070682_1000052334 | 289 |
| 133 | 3300005366 | Ga0070659_100006429 | Ga0070659_1000064296 | 289 |
| 134 | 3300005366 | Ga0070659_100072464 | Ga0070659_1000724642 | 289 |
| 135 | 3300005539 | Ga0068853_100005385 | Ga0068853_1000053857 | 289 |
| 136 | 3300005539 | Ga0068853_100168819 | Ga0068853_1001688192 | 289 |
| 137 | 3300005563 | Ga0068855_100014533 | Ga0068855_1000145333 | 289 |
| 138 | 3300005563 | Ga0068855_100439241 | Ga0068855_1004392411 | 289 |
| 139 | 3300005577 | Ga0068857_100087956 | Ga0068857_1000879562 | 289 |
| 140 | 3300005614 | Ga0068856_100423367 | Ga0068856_1004233672 | 289 |
| 141 | 3300009551 | Ga0105238_10002416 | Ga0105238_1000241612 | 289 |
| 142 | 3300013100 | Ga0157373_10000805 | Ga0157373_1000080510 | 289 |
| 143 | 3300013307 | Ga0157372_10002093 | Ga0157372_1000209312 | 289 |
| 144 | 3300025226 | Ga0209674_100924 | Ga0209674_1009245 | 289 |
| 145 | 3300025909 | Ga0207705_10105711 | Ga0207705_101057112 | 289 |
| 146 | 3300025909 | Ga0207705_10326292 | Ga0207705_103262921 | 289 |
| 147 | 3300025913 | Ga0207695_10038912 | Ga0207695_100389124 | 289 |
| 148 | 3300025919 | Ga0207657_10138459 | Ga0207657_101384592 | 289 |
| 149 | 3300025920 | Ga0207649_10140811 | Ga0207649_101408111 | 289 |
| 150 | 3300025924 | Ga0207694_10017993 | Ga0207694_100179932 | 289 |
| 151 | 3300025932 | Ga0207690_10073456 | Ga0207690_100734562 | 289 |
| 152 | 3300025949 | Ga0207667_10007055 | Ga0207667_100070553 | 289 |
| 153 | 3300026041 | Ga0207639_10015247 | Ga0207639_100152474 | 289 |
| 154 | 3300026041 | Ga0207639_10017700 | Ga0207639_100177002 | 289 |
| 155 | 3300026041 | Ga0207639_10032518 | Ga0207639_100325183 | 289 |
| 156 | 3300026116 | Ga0207674_10130368 | Ga0207674_101303682 | 289 |
| 157 | 3300005339 | Ga0070660_100014288 | Ga0070660_1000142882 | 290 |
| 158 | 3300005366 | Ga0070659_100076267 | Ga0070659_1000762673 | 290 |
| 159 | 3300005435 | Ga0070714_100000930 | Ga0070714_10000093014 | 290 |
| 160 | 3300005458 | Ga0070681_10032143 | Ga0070681_100321432 | 290 |
| 161 | 3300005546 | Ga0070696_100000357 | Ga0070696_10000035714 | 290 |
| 162 | 3300013100 | Ga0157373_10084130 | Ga0157373_100841302 | 290 |
| 163 | 3300015261 | Ga0182006_1007188 | Ga0182006_10071884 | 290 |
| 164 | 3300015262 | Ga0182007_10012867 | Ga0182007_100128672 | 290 |
| 165 | 3300025898 | Ga0207692_10019978 | Ga0207692_100199782 | 290 |
| 166 | 3300025912 | Ga0207707_10003336 | Ga0207707_100033362 | 290 |
| 167 | 3300025917 | Ga0207660_10018262 | Ga0207660_100182623 | 290 |
| 168 | 3300025929 | Ga0207664_10000403 | Ga0207664_1000040314 | 290 |
| 169 | 3300025932 | Ga0207690_10011392 | Ga0207690_100113923 | 290 |
| 170 | 3300026116 | Ga0207674_10069528 | Ga0207674_100695281 | 290 |
| 171 | 3300009545 | Ga0105237_10718797 | Ga0105237_107187971 | 291 |
| 172 | 3300013100 | Ga0157373_10124667 | Ga0157373_101246672 | 291 |
| 173 | 3300005345 | Ga0070692_10014711 | Ga0070692_100147114 | 292 |
| 174 | 3300005614 | Ga0068856_100295055 | Ga0068856_1002950551 | 292 |
| 175 | 3300005616 | Ga0068852_100024221 | Ga0068852_1000242215 | 292 |
| 176 | 3300013102 | Ga0157371_10020161 | Ga0157371_100201615 | 292 |
| 177 | 3300020082 | Ga0206353_10313916 | Ga0206353_103139162 | 292 |
| 178 | 3300025909 | Ga0207705_10011495 | Ga0207705_100114956 | 292 |
| 179 | 3300025913 | Ga0207695_10010285 | Ga0207695_100102855 | 292 |
| 180 | 3300025917 | Ga0207660_10007280 | Ga0207660_100072806 | 292 |
| 181 | 3300025919 | Ga0207657_10070370 | Ga0207657_100703702 | 292 |
| 182 | 3300025921 | Ga0207652_10011131 | Ga0207652_100111317 | 292 |
| 183 | 3300025949 | Ga0207667_10002262 | Ga0207667_1000226213 | 292 |
| 184 | 3300026041 | Ga0207639_10007916 | Ga0207639_100079167 | 292 |
| 185 | 3300026067 | Ga0207678_10263048 | Ga0207678_102630481 | 292 |
| 186 | 3300046519 | Ga0495632_0000005 | Ga0495632_0000005_332794_333678 | 293 |
| 187 | 3300048918 | Ga0496115_0019782 | Ga0496115_0019782_117_1043 | 294 |
| 188 | 3300048928 | Ga0496125_0250405 | Ga0496125_0250405_148_1074 | 294 |
| 189 | 3300049569 | Ga0501032_0020929 | Ga0501032_0020929_2319_3206 | 294 |
| 190 | 3300037418 | Ga0395900_0000206 | Ga0395900_0000206_53296_54186 | 295 |
| 191 | 3300005365 | Ga0070688_100008301 | Ga0070688_1000083012 | 296 |
| 192 | 3300005466 | Ga0070685_10067640 | Ga0070685_100676402 | 296 |
| 193 | 3300037418 | Ga0395900_0039144 | Ga0395900_0039144_2113_3030 | 297 |
| 194 | 3300038443 | Ga0395901_0221705 | Ga0395901_0221705_607_1524 | 297 |
| 195 | 3300005340 | Ga0070689_100056467 | Ga0070689_1000564672 | 298 |
| 196 | 3300005344 | Ga0070661_100014581 | Ga0070661_1000145814 | 298 |
| 197 | 3300005455 | Ga0070663_100067146 | Ga0070663_1000671463 | 298 |
| 198 | 3300025920 | Ga0207649_10054906 | Ga0207649_100549061 | 298 |
| 199 | 3300026067 | Ga0207678_10083549 | Ga0207678_100835492 | 298 |
| 200 | 3300046460 | Ga0495638_0001484 | Ga0495638_0001484_1569_2504 | 298 |
| 201 | 3300046471 | Ga0495650_0000092 | Ga0495650_0000092_3348_4283 | 298 |
| 202 | 3300005337 | Ga0070682_100000784 | Ga0070682_1000007844 | 299 |
| 203 | 3300005458 | Ga0070681_10166203 | Ga0070681_101662032 | 299 |
| 204 | 3300005457 | Ga0070662_100184699 | Ga0070662_1001846992 | 300 |
| 205 | 3300009093 | Ga0105240_10126228 | Ga0105240_101262282 | 300 |
| 206 | 3300025933 | Ga0207706_10217562 | Ga0207706_102175622 | 300 |
| 207 | 3300049589 | Ga0501073_0000312 | Ga0501073_0000312_2001_2960 | 300 |
| 208 | iso_pu_bacteria | 2687453130 | 2687581677 | 300 |
| 209 | iso_pu_bacteria | 2818991440 | 2819565098 | 300 |
| 210 | iso_pu_bacteria | 2842914999 | 2842917010 | 300 |
| 211 | iso_pu_bacteria | 2884338543 | 2884342240 | 300 |
| 212 | iso_pu_bacteria | 2884411467 | 2884411809 | 300 |
| 213 | iso_pu_bacteria | 2895395659 | 2895398341 | 300 |
| 214 | iso_pu_bacteria | 2904463128 | 2904465375 | 300 |
| 215 | iso_pu_bacteria | 2919085039 | 2919087912 | 300 |
| 216 | iso_pu_bacteria | 2928963466 | 2928966657 | 300 |
| 217 | 3300005336 | Ga0070680_100107682 | Ga0070680_1001076822 | 301 |
| 218 | 3300005458 | Ga0070681_10256017 | Ga0070681_102560172 | 301 |
| 219 | 3300005530 | Ga0070679_100132542 | Ga0070679_1001325422 | 301 |
| 220 | 3300005546 | Ga0070696_100092988 | Ga0070696_1000929882 | 301 |
| 221 | 3300013104 | Ga0157370_10017280 | Ga0157370_100172802 | 301 |
| 222 | 3300013307 | Ga0157372_10208479 | Ga0157372_102084792 | 301 |
| 223 | 3300025921 | Ga0207652_10158209 | Ga0207652_101582092 | 301 |
| 224 | 3300037418 | Ga0395900_0015796 | Ga0395900_0015796_821_1735 | 301 |
| 225 | iso_pu_bacteria | 2643221577 | 2643896360 | 301 |
| 226 | iso_pu_bacteria | 2643221685 | 2644478879 | 301 |
| 227 | iso_pu_bacteria | 2739367700 | 2739733676 | 301 |
| 228 | 3300001989 | JGI24739J22299_10043324 | JGI24739J22299_100433242 | 302 |
| 229 | 3300013307 | Ga0157372_10092723 | Ga0157372_100927233 | 302 |
| 230 | 3300015685 | Ga0183369_1011 | Ga0183369_101133 | 302 |
| 231 | 3300015687 | Ga0183368_1007 | Ga0183368_100737 | 302 |
| 232 | 3300025226 | Ga0209674_100037 | Ga0209674_100037325 | 302 |
| 233 | 3300025904 | Ga0207647_10001536 | Ga0207647_1000153615 | 302 |
| 234 | 3300037312 | Ga0395899_0026012 | Ga0395899_0026012_593_1513 | 302 |
| 235 | 3300037312 | Ga0395899_0043225 | Ga0395899_0043225_240_1157 | 302 |
| 236 | 3300037418 | Ga0395900_0004679 | Ga0395900_0004679_12237_13154 | 302 |
| 237 | 3300037418 | Ga0395900_0165780 | Ga0395900_0165780_1016_1933 | 302 |
| 238 | 3300037418 | Ga0395900_0170694 | Ga0395900_0170694_601_1530 | 302 |
| 239 | 3300037466 | Ga0395898_0161307 | Ga0395898_0161307_173_1090 | 302 |
| 240 | 3300038443 | Ga0395901_0009703 | Ga0395901_0009703_1332_2261 | 302 |
| 241 | 3300038443 | Ga0395901_0236221 | Ga0395901_0236221_537_1454 | 302 |
| 242 | 3300044694 | Ga0466963_0036297 | Ga0466963_0036297_171_1091 | 302 |
| 243 | 3300048916 | Ga0496113_0003396 | Ga0496113_0003396_5472_6389 | 302 |
| 244 | 3300048918 | Ga0496115_0000427 | Ga0496115_0000427_4964_5881 | 302 |
| 245 | 3300049569 | Ga0501032_0012292 | Ga0501032_0012292_70_990 | 302 |
| 246 | 3300049570 | Ga0501033_0055397 | Ga0501033_0055397_230_1150 | 302 |
| 247 | 3300049572 | Ga0501036_0020627 | Ga0501036_0020627_3708_4628 | 302 |
| 248 | 3300049573 | Ga0501037_0162569 | Ga0501037_0162569_247_1167 | 302 |
| 249 | 3300049574 | Ga0501038_0080203 | Ga0501038_0080203_1723_2652 | 302 |
| 250 | 3300049579 | Ga0501043_0017632 | Ga0501043_0017632_346_1266 | 302 |
| 251 | 3300049581 | Ga0501047_0001223 | Ga0501047_0001223_11611_12531 | 302 |
| 252 | 3300049581 | Ga0501047_0069157 | Ga0501047_0069157_1736_2665 | 302 |
| 253 | 3300049586 | Ga0501070_0034926 | Ga0501070_0034926_191_1111 | 302 |
| 254 | 3300049822 | Ga0501035_0097206 | Ga0501035_0097206_445_1365 | 302 |
| 255 | 3300049823 | Ga0501044_0051333 | Ga0501044_0051333_2312_3232 | 302 |
| 256 | 3300049823 | Ga0501044_0378752 | Ga0501044_0378752_244_1167 | 302 |
| 257 | iso_pu_bacteria | 2593339238 | 2595448992 | 302 |
| 258 | iso_pu_bacteria | 2593339239 | 2595452850 | 302 |
| 259 | iso_pu_bacteria | 2718218334 | 2721029056 | 302 |
| 260 | iso_pu_bacteria | 2734482264 | 2735835364 | 302 |
| 261 | iso_pu_bacteria | 2738543009 | 2739229522 | 302 |
| 262 | iso_pu_bacteria | 2842918807 | 2842922519 | 302 |
| 263 | iso_pu_bacteria | 2919404418 | 2919407883 | 302 |
| 264 | iso_pu_bacteria | 2941471342 | 2941474701 | 302 |
| 265 | iso_pu_bacteria | 2953994433 | 2953996978 | 302 |
| 266 | 3300003578 | Ga0006562J51391_1100886 | Ga0006562J51391_11008862 | 303 |
| 267 | 3300005262 | Ga0065165_1000887 | Ga0065165_100088714 | 303 |
| 268 | 3300005344 | Ga0070661_100021235 | Ga0070661_1000212353 | 303 |
| 269 | 3300005458 | Ga0070681_10000680 | Ga0070681_100006809 | 303 |
| 270 | 3300005530 | Ga0070679_100007899 | Ga0070679_1000078999 | 303 |
| 271 | 3300009101 | Ga0105247_10005430 | Ga0105247_100054306 | 303 |
| 272 | 3300009551 | Ga0105238_10041722 | Ga0105238_100417225 | 303 |
| 273 | 3300013104 | Ga0157370_10011839 | Ga0157370_100118395 | 303 |
| 274 | 3300013105 | Ga0157369_10001681 | Ga0157369_1000168112 | 303 |
| 275 | 3300014497 | Ga0182008_10003482 | Ga0182008_100034827 | 303 |
| 276 | 3300014497 | Ga0182008_10027917 | Ga0182008_100279172 | 303 |
| 277 | 3300015261 | Ga0182006_1000082 | Ga0182006_10000822 | 303 |
| 278 | 3300015261 | Ga0182006_1000319 | Ga0182006_100031913 | 303 |
| 279 | 3300015265 | Ga0182005_1000015 | Ga0182005_100001519 | 303 |
| 280 | 3300015265 | Ga0182005_1007876 | Ga0182005_10078763 | 303 |
| 281 | 3300025233 | Ga0209437_100685 | Ga0209437_10068511 | 303 |
| 282 | 3300025254 | Ga0209148_1001587 | Ga0209148_10015873 | 303 |
| 283 | 3300025299 | Ga0209256_1014451 | Ga0209256_10144512 | 303 |
| 284 | 3300025904 | Ga0207647_10000130 | Ga0207647_1000013041 | 303 |
| 285 | 3300025912 | Ga0207707_10000930 | Ga0207707_1000093015 | 303 |
| 286 | 3300025917 | Ga0207660_10003239 | Ga0207660_1000323910 | 303 |
| 287 | 3300025921 | Ga0207652_10000855 | Ga0207652_1000085515 | 303 |
| 288 | 3300025924 | Ga0207694_10046351 | Ga0207694_100463514 | 303 |
| 289 | 3300031731 | Ga0307405_10291375 | Ga0307405_102913751 | 303 |
| 290 | 3300031911 | Ga0307412_10001046 | Ga0307412_1000104613 | 303 |
| 291 | 3300041404 | Ga0439436_0000019 | Ga0439436_0000019_29795_30712 | 303 |
| 292 | 3300041452 | Ga0451793_0808167 | Ga0451793_0808167_605_1519 | 303 |
| 293 | 3300041512 | Ga0451853_2586392 | Ga0451853_2586392_230_1147 | 303 |
| 294 | 3300042011 | Ga0439454_001532 | Ga0439454_001532_547_1464 | 303 |
| 295 | 3300042184 | Ga0450908_000049 | Ga0450908_000049_20471_21388 | 303 |
| 296 | 3300042438 | Ga0439459_0008918 | Ga0439459_0008918_27_941 | 303 |
| 297 | 3300044672 | Ga0466982_0000052 | Ga0466982_0000052_8377_9294 | 303 |
| 298 | 3300044842 | Ga0466957_0180920 | Ga0466957_0180920_276_1193 | 303 |
| 299 | 3300046452 | Ga0495617_000448 | Ga0495617_000448_9252_10169 | 303 |
| 300 | 3300046457 | Ga0495590_0066795 | Ga0495590_0066795_83_1000 | 303 |
| 301 | 3300046460 | Ga0495638_0000090 | Ga0495638_0000090_6126_7040 | 303 |
| 302 | 3300046460 | Ga0495638_0000252 | Ga0495638_0000252_27990_28907 | 303 |
| 303 | 3300046460 | Ga0495638_0017975 | Ga0495638_0017975_1532_2449 | 303 |
| 304 | 3300046471 | Ga0495650_0003523 | Ga0495650_0003523_4679_5596 | 303 |
| 305 | 3300046471 | Ga0495650_0028891 | Ga0495650_0028891_931_1848 | 303 |
| 306 | 3300046491 | Ga0495584_0156912 | Ga0495584_0156912_191_1108 | 303 |
| 307 | 3300046492 | Ga0495585_0000024 | Ga0495585_0000024_118946_119863 | 303 |
| 308 | 3300046492 | Ga0495585_0005782 | Ga0495585_0005782_1591_2508 | 303 |
| 309 | 3300046501 | Ga0495607_0003628 | Ga0495607_0003628_6066_6983 | 303 |
| 310 | 3300046507 | Ga0495606_0001041 | Ga0495606_0001041_150_1067 | 303 |
| 311 | 3300046507 | Ga0495606_0005569 | Ga0495606_0005569_3891_4808 | 303 |
| 312 | 3300046507 | Ga0495606_0110348 | Ga0495606_0110348_627_1544 | 303 |
| 313 | 3300046512 | Ga0495610_0007613 | Ga0495610_0007613_3827_4744 | 303 |
| 314 | 3300046512 | Ga0495610_0094600 | Ga0495610_0094600_394_1311 | 303 |
| 315 | 3300046513 | Ga0495616_0001751 | Ga0495616_0001751_1550_2467 | 303 |
| 316 | 3300046513 | Ga0495616_0018489 | Ga0495616_0018489_1128_2045 | 303 |
| 317 | 3300046515 | Ga0495620_0000425 | Ga0495620_0000425_8916_9833 | 303 |
| 318 | 3300046518 | Ga0495631_0001411 | Ga0495631_0001411_1440_2357 | 303 |
| 319 | 3300046518 | Ga0495631_0002167 | Ga0495631_0002167_4572_5489 | 303 |
| 320 | 3300046519 | Ga0495632_0128063 | Ga0495632_0128063_185_1102 | 303 |
| 321 | 3300046520 | Ga0495637_0004441 | Ga0495637_0004441_163_1080 | 303 |
| 322 | 3300046524 | Ga0495648_0000485 | Ga0495648_0000485_28410_29327 | 303 |
| 323 | 3300046524 | Ga0495648_0005027 | Ga0495648_0005027_4688_5605 | 303 |
| 324 | 3300046616 | Ga0495668_0006807 | Ga0495668_0006807_4793_5710 | 303 |
| 325 | 3300046616 | Ga0495668_0056694 | Ga0495668_0056694_133_1050 | 303 |
| 326 | 3300046648 | Ga0495611_0000005 | Ga0495611_0000005_255279_256196 | 303 |
| 327 | 3300046648 | Ga0495611_0000819 | Ga0495611_0000819_14208_15125 | 303 |
| 328 | 3300046660 | Ga0495625_0001159 | Ga0495625_0001159_27990_28907 | 303 |
| 329 | 3300046660 | Ga0495625_0077431 | Ga0495625_0077431_978_1895 | 303 |
| 330 | 3300046665 | Ga0495661_0001221 | Ga0495661_0001221_19664_20581 | 303 |
| 331 | 3300046691 | Ga0495670_0002168 | Ga0495670_0002168_2327_3244 | 303 |
| 332 | 3300046691 | Ga0495670_0004383 | Ga0495670_0004383_1408_2325 | 303 |
| 333 | 3300046691 | Ga0495670_0027584 | Ga0495670_0027584_160_1077 | 303 |
| 334 | 3300046794 | Ga0495589_0000389 | Ga0495589_0000389_27990_28907 | 303 |
| 335 | 3300046810 | Ga0495660_0000237 | Ga0495660_0000237_50746_51663 | 303 |
| 336 | 3300046810 | Ga0495660_0006009 | Ga0495660_0006009_4748_5665 | 303 |
| 337 | 3300047323 | Ga0495683_0003205 | Ga0495683_0003205_6894_7811 | 303 |
| 338 | 3300047446 | Ga0495679_000382 | Ga0495679_000382_5067_5984 | 303 |
| 339 | 3300047469 | Ga0495673_0000038 | Ga0495673_0000038_33895_34812 | 303 |
| 340 | 3300047469 | Ga0495673_0000685 | Ga0495673_0000685_4116_5033 | 303 |
| 341 | 3300047469 | Ga0495673_0002075 | Ga0495673_0002075_8981_9898 | 303 |
| 342 | 3300047472 | Ga0495686_0000050 | Ga0495686_0000050_31006_31923 | 303 |
| 343 | 3300047472 | Ga0495686_0001912 | Ga0495686_0001912_11001_11918 | 303 |
| 344 | 3300048903 | Ga0496100_0001269 | Ga0496100_0001269_3012_3929 | 303 |
| 345 | 3300048904 | Ga0496101_0004978 | Ga0496101_0004978_1904_2821 | 303 |
| 346 | 3300048909 | Ga0496106_0000786 | Ga0496106_0000786_8328_9245 | 303 |
| 347 | 3300048920 | Ga0496117_0007752 | Ga0496117_0007752_9188_10105 | 303 |
| 348 | 3300048920 | Ga0496117_0024071 | Ga0496117_0024071_1818_2735 | 303 |
| 349 | 3300048921 | Ga0496118_0004444 | Ga0496118_0004444_13494_14411 | 303 |
| 350 | 3300048921 | Ga0496118_0004962 | Ga0496118_0004962_10170_11087 | 303 |
| 351 | 3300048921 | Ga0496118_0169965 | Ga0496118_0169965_353_1270 | 303 |
| 352 | 3300048922 | Ga0496119_0011971 | Ga0496119_0011971_2455_3372 | 303 |
| 353 | 3300048924 | Ga0496121_0001206 | Ga0496121_0001206_13367_14284 | 303 |
| 354 | 3300048924 | Ga0496121_0005512 | Ga0496121_0005512_12313_13230 | 303 |
| 355 | 3300048924 | Ga0496121_0012211 | Ga0496121_0012211_1506_2423 | 303 |
| 356 | 3300048925 | Ga0496122_0008212 | Ga0496122_0008212_6903_7820 | 303 |
| 357 | 3300048925 | Ga0496122_0011683 | Ga0496122_0011683_198_1115 | 303 |
| 358 | 3300048925 | Ga0496122_0043651 | Ga0496122_0043651_1723_2640 | 303 |
| 359 | 3300048926 | Ga0496123_0009105 | Ga0496123_0009105_4900_5817 | 303 |
| 360 | 3300048926 | Ga0496123_0009315 | Ga0496123_0009315_2455_3372 | 303 |
| 361 | 3300048926 | Ga0496123_0181123 | Ga0496123_0181123_160_1077 | 303 |
| 362 | 3300048927 | Ga0496124_0001429 | Ga0496124_0001429_21958_22875 | 303 |
| 363 | 3300048927 | Ga0496124_0055119 | Ga0496124_0055119_2390_3316 | 303 |
| 364 | 3300048929 | Ga0496126_0011972 | Ga0496126_0011972_3723_4640 | 303 |
| 365 | 3300049459 | Ga0495678_002592 | Ga0495678_002592_6099_7016 | 303 |
| 366 | 3300049460 | Ga0495682_0005770 | Ga0495682_0005770_48_965 | 303 |
| 367 | 3300049460 | Ga0495682_0039855 | Ga0495682_0039855_759_1676 | 303 |
| 368 | 3300050516 | nmdc:mga0sz30_11551_c1 | nmdc:mga0sz30_11551_c1_1550_2467 | 303 |
| 369 | 3300053087 | Ga0500643_000378 | Ga0500643_000378_28464_29381 | 303 |
| 370 | 3300053103 | Ga0500555_000348 | Ga0500555_000348_14054_14971 | 303 |
| 371 | 3300053730 | Ga0500645_001206 | Ga0500645_001206_6774_7691 | 303 |
| 372 | 3300009553 | Ga0105249_10056528 | Ga0105249_100565282 | 304 |
| 373 | 3300025961 | Ga0207712_10025875 | Ga0207712_100258752 | 304 |
| 374 | 3300001915 | JGI24741J21665_1008106 | JGI24741J21665_10081062 | 305 |
| 375 | 3300001979 | JGI24740J21852_10000931 | JGI24740J21852_100009318 | 305 |
| 376 | 3300001990 | JGI24737J22298_10000633 | JGI24737J22298_100006335 | 305 |
| 377 | 3300002705 | JGI25156J39149_1004170 | JGI25156J39149_10041702 | 305 |
| 378 | 3300002737 | JGI25162J39368_1000249 | JGI25162J39368_100024932 | 305 |
| 379 | 3300002737 | JGI25162J39368_1002541 | JGI25162J39368_10025417 | 305 |
| 380 | 3300002741 | JGI25157J39369_1001205 | JGI25157J39369_10012059 | 305 |
| 381 | 3300002741 | JGI25157J39369_1001281 | JGI25157J39369_10012817 | 305 |
| 382 | 3300002741 | JGI25157J39369_1002499 | JGI25157J39369_10024994 | 305 |
| 383 | 3300002772 | JGI25164J39214_1000004 | JGI25164J39214_100000437 | 305 |
| 384 | 3300002772 | JGI25164J39214_1001210 | JGI25164J39214_10012107 | 305 |
| 385 | 3300002772 | JGI25164J39214_1001216 | JGI25164J39214_10012168 | 305 |
| 386 | 3300003214 | JGI25165J46597_1000110 | JGI25165J46597_1000110116 | 305 |
| 387 | 3300003214 | JGI25165J46597_1002182 | JGI25165J46597_10021827 | 305 |
| 388 | 3300003214 | JGI25165J46597_1003527 | JGI25165J46597_10035273 | 305 |
| 389 | 3300003215 | JGI25153J46596_10026961 | JGI25153J46596_100269612 | 305 |
| 390 | 3300003316 | rootH1_10080198 | rootH1_100801984 | 305 |
| 391 | 3300003578 | Ga0006562J51391_1003480 | Ga0006562J51391_10034809 | 305 |
| 392 | 3300003578 | Ga0006562J51391_1003481 | Ga0006562J51391_10034816 | 305 |
| 393 | 3300003756 | Ga0055533_1000886 | Ga0055533_10008869 | 305 |
| 394 | 3300003756 | Ga0055533_1003563 | Ga0055533_10035633 | 305 |
| 395 | 3300003760 | Ga0055527_1000060 | Ga0055527_100006016 | 305 |
| 396 | 3300003760 | Ga0055527_1000158 | Ga0055527_10001583 | 305 |
| 397 | 3300003761 | Ga0055535_1000331 | Ga0055535_10003313 | 305 |
| 398 | 3300003761 | Ga0055535_1000407 | Ga0055535_10004073 | 305 |
| 399 | 3300003761 | Ga0055535_1001855 | Ga0055535_10018553 | 305 |
| 400 | 3300003761 | Ga0055535_1001873 | Ga0055535_10018733 | 305 |
| 401 | 3300003762 | Ga0055542_1000171 | Ga0055542_10001713 | 305 |
| 402 | 3300003762 | Ga0055542_1000358 | Ga0055542_100035842 | 305 |
| 403 | 3300003762 | Ga0055542_1001762 | Ga0055542_10017626 | 305 |
| 404 | 3300003762 | Ga0055542_1001772 | Ga0055542_10017726 | 305 |
| 405 | 3300003763 | Ga0055529_1000384 | Ga0055529_100038442 | 305 |
| 406 | 3300003763 | Ga0055529_1000450 | Ga0055529_100045033 | 305 |
| 407 | 3300003763 | Ga0055529_1000471 | Ga0055529_100047136 | 305 |
| 408 | 3300005327 | Ga0070658_10077157 | Ga0070658_100771572 | 305 |
| 409 | 3300005327 | Ga0070658_10242299 | Ga0070658_102422991 | 305 |
| 410 | 3300005335 | Ga0070666_10000099 | Ga0070666_1000009942 | 305 |
| 411 | 3300005339 | Ga0070660_100156530 | Ga0070660_1001565302 | 305 |
| 412 | 3300005344 | Ga0070661_100027314 | Ga0070661_1000273143 | 305 |
| 413 | 3300005345 | Ga0070692_10009726 | Ga0070692_100097261 | 305 |
| 414 | 3300005366 | Ga0070659_100000789 | Ga0070659_1000007898 | 305 |
| 415 | 3300005366 | Ga0070659_100005989 | Ga0070659_1000059898 | 305 |
| 416 | 3300005366 | Ga0070659_100217428 | Ga0070659_1002174282 | 305 |
| 417 | 3300005367 | Ga0070667_100185108 | Ga0070667_1001851082 | 305 |
| 418 | 3300005435 | Ga0070714_100000392 | Ga0070714_10000039211 | 305 |
| 419 | 3300005435 | Ga0070714_100008963 | Ga0070714_1000089636 | 305 |
| 420 | 3300005436 | Ga0070713_100000391 | Ga0070713_1000003913 | 305 |
| 421 | 3300005455 | Ga0070663_100212204 | Ga0070663_1002122042 | 305 |
| 422 | 3300005457 | Ga0070662_100115484 | Ga0070662_1001154842 | 305 |
| 423 | 3300005458 | Ga0070681_10000500 | Ga0070681_100005002 | 305 |
| 424 | 3300005458 | Ga0070681_10186772 | Ga0070681_101867722 | 305 |
| 425 | 3300005539 | Ga0068853_100161317 | Ga0068853_1001613172 | 305 |
| 426 | 3300005539 | Ga0068853_100173192 | Ga0068853_1001731922 | 305 |
| 427 | 3300005546 | Ga0070696_100005209 | Ga0070696_1000052096 | 305 |
| 428 | 3300005547 | Ga0070693_100000882 | Ga0070693_10000088210 | 305 |
| 429 | 3300005547 | Ga0070693_100040722 | Ga0070693_1000407222 | 305 |
| 430 | 3300005563 | Ga0068855_100058198 | Ga0068855_1000581982 | 305 |
| 431 | 3300005563 | Ga0068855_100076161 | Ga0068855_1000761612 | 305 |
| 432 | 3300005563 | Ga0068855_100475087 | Ga0068855_1004750871 | 305 |
| 433 | 3300005577 | Ga0068857_100006695 | Ga0068857_1000066954 | 305 |
| 434 | 3300005578 | Ga0068854_100006992 | Ga0068854_1000069922 | 305 |
| 435 | 3300005578 | Ga0068854_100017143 | Ga0068854_1000171432 | 305 |
| 436 | 3300005578 | Ga0068854_100117109 | Ga0068854_1001171092 | 305 |
| 437 | 3300005614 | Ga0068856_100000088 | Ga0068856_10000008825 | 305 |
| 438 | 3300005614 | Ga0068856_100015285 | Ga0068856_1000152853 | 305 |
| 439 | 3300005614 | Ga0068856_100035641 | Ga0068856_1000356412 | 305 |
| 440 | 3300005616 | Ga0068852_100035332 | Ga0068852_1000353322 | 305 |
| 441 | 3300005616 | Ga0068852_100092362 | Ga0068852_1000923622 | 305 |
| 442 | 3300005616 | Ga0068852_100174291 | Ga0068852_1001742912 | 305 |
| 443 | 3300005842 | Ga0068858_100076676 | Ga0068858_1000766763 | 305 |
| 444 | 3300009093 | Ga0105240_10003419 | Ga0105240_100034194 | 305 |
| 445 | 3300009093 | Ga0105240_10009031 | Ga0105240_100090316 | 305 |
| 446 | 3300009093 | Ga0105240_10017579 | Ga0105240_100175798 | 305 |
| 447 | 3300009093 | Ga0105240_10164886 | Ga0105240_101648862 | 305 |
| 448 | 3300009093 | Ga0105240_10252329 | Ga0105240_102523292 | 305 |
| 449 | 3300009093 | Ga0105240_10442638 | Ga0105240_104426381 | 305 |
| 450 | 3300009174 | Ga0105241_10024312 | Ga0105241_100243124 | 305 |
| 451 | 3300009545 | Ga0105237_10000058 | Ga0105237_1000005848 | 305 |
| 452 | 3300009545 | Ga0105237_10000777 | Ga0105237_1000077718 | 305 |
| 453 | 3300009551 | Ga0105238_10000428 | Ga0105238_1000042810 | 305 |
| 454 | 3300009551 | Ga0105238_10003804 | Ga0105238_100038048 | 305 |
| 455 | 3300009551 | Ga0105238_10194465 | Ga0105238_101944651 | 305 |
| 456 | 3300009551 | Ga0105238_10198106 | Ga0105238_101981062 | 305 |
| 457 | 3300009551 | Ga0105238_10242002 | Ga0105238_102420022 | 305 |
| 458 | 3300009982 | Ga0105147_100851 | Ga0105147_1008512 | 305 |
| 459 | 3300010375 | Ga0105239_10005406 | Ga0105239_100054064 | 305 |
| 460 | 3300010375 | Ga0105239_10110342 | Ga0105239_101103422 | 305 |
| 461 | 3300012500 | Ga0157314_1000012 | Ga0157314_100001214 | 305 |
| 462 | 3300013102 | Ga0157371_10059103 | Ga0157371_100591032 | 305 |
| 463 | 3300013102 | Ga0157371_10147392 | Ga0157371_101473922 | 305 |
| 464 | 3300013104 | Ga0157370_10001873 | Ga0157370_1000187315 | 305 |
| 465 | 3300013104 | Ga0157370_10031638 | Ga0157370_100316384 | 305 |
| 466 | 3300013104 | Ga0157370_10077276 | Ga0157370_100772762 | 305 |
| 467 | 3300013105 | Ga0157369_10041370 | Ga0157369_100413702 | 305 |
| 468 | 3300013105 | Ga0157369_10100640 | Ga0157369_101006403 | 305 |
| 469 | 3300013105 | Ga0157369_10225589 | Ga0157369_102255892 | 305 |
| 470 | 3300013306 | Ga0163162_10000848 | Ga0163162_1000084815 | 305 |
| 471 | 3300013307 | Ga0157372_10134218 | Ga0157372_101342182 | 305 |
| 472 | 3300013307 | Ga0157372_10274815 | Ga0157372_102748151 | 305 |
| 473 | 3300013307 | Ga0157372_10428225 | Ga0157372_104282252 | 305 |
| 474 | 3300014497 | Ga0182008_10021450 | Ga0182008_100214503 | 305 |
| 475 | 3300015262 | Ga0182007_10019921 | Ga0182007_100199212 | 305 |
| 476 | 3300020070 | Ga0206356_10344540 | Ga0206356_103445403 | 305 |
| 477 | 3300020070 | Ga0206356_10813108 | Ga0206356_108131083 | 305 |
| 478 | 3300020081 | Ga0206354_10058580 | Ga0206354_100585804 | 305 |
| 479 | 3300020082 | Ga0206353_10367129 | Ga0206353_103671294 | 305 |
| 480 | 3300020082 | Ga0206353_10641193 | Ga0206353_106411932 | 305 |
| 481 | 3300020082 | Ga0206353_11510336 | Ga0206353_115103362 | 305 |
| 482 | 3300020610 | Ga0154015_1113103 | Ga0154015_11131032 | 305 |
| 483 | 3300025226 | Ga0209674_100058 | Ga0209674_10005836 | 305 |
| 484 | 3300025226 | Ga0209674_100874 | Ga0209674_10087410 | 305 |
| 485 | 3300025228 | Ga0209672_100043 | Ga0209672_100043200 | 305 |
| 486 | 3300025228 | Ga0209672_100061 | Ga0209672_10006136 | 305 |
| 487 | 3300025230 | Ga0209563_100062 | Ga0209563_100062191 | 305 |
| 488 | 3300025231 | Ga0207427_100258 | Ga0207427_10025840 | 305 |
| 489 | 3300025231 | Ga0207427_100275 | Ga0207427_1002752 | 305 |
| 490 | 3300025233 | Ga0209437_100121 | Ga0209437_10012130 | 305 |
| 491 | 3300025233 | Ga0209437_100132 | Ga0209437_100132122 | 305 |
| 492 | 3300025242 | Ga0209258_100054 | Ga0209258_10005436 | 305 |
| 493 | 3300025242 | Ga0209258_100076 | Ga0209258_100076200 | 305 |
| 494 | 3300025242 | Ga0209258_100565 | Ga0209258_10056521 | 305 |
| 495 | 3300025246 | Ga0209646_1002495 | Ga0209646_10024955 | 305 |
| 496 | 3300025250 | Ga0209026_1000119 | Ga0209026_100011939 | 305 |
| 497 | 3300025250 | Ga0209026_1000130 | Ga0209026_100013014 | 305 |
| 498 | 3300025250 | Ga0209026_1000147 | Ga0209026_100014774 | 305 |
| 499 | 3300025254 | Ga0209148_1000066 | Ga0209148_100006636 | 305 |
| 500 | 3300025254 | Ga0209148_1000082 | Ga0209148_1000082200 | 305 |
| 501 | 3300025254 | Ga0209148_1000611 | Ga0209148_100061121 | 305 |
| 502 | 3300025256 | Ga0209759_1000218 | Ga0209759_100021816 | 305 |
| 503 | 3300025256 | Ga0209759_1002602 | Ga0209759_10026022 | 305 |
| 504 | 3300025256 | Ga0209759_1013168 | Ga0209759_10131683 | 305 |
| 505 | 3300025258 | Ga0209129_1011029 | Ga0209129_10110292 | 305 |
| 506 | 3300025261 | Ga0209233_1000112 | Ga0209233_100011234 | 305 |
| 507 | 3300025261 | Ga0209233_1000114 | Ga0209233_1000114175 | 305 |
| 508 | 3300025272 | Ga0209455_1000078 | Ga0209455_1000078200 | 305 |
| 509 | 3300025272 | Ga0209455_1000101 | Ga0209455_100010136 | 305 |
| 510 | 3300025272 | Ga0209455_1000636 | Ga0209455_100063618 | 305 |
| 511 | 3300025297 | Ga0209758_1002347 | Ga0209758_10023473 | 305 |
| 512 | 3300025321 | Ga0207656_10016293 | Ga0207656_100162932 | 305 |
| 513 | 3300025904 | Ga0207647_10001258 | Ga0207647_1000125811 | 305 |
| 514 | 3300025904 | Ga0207647_10022280 | Ga0207647_100222804 | 305 |
| 515 | 3300025909 | Ga0207705_10001263 | Ga0207705_1000126312 | 305 |
| 516 | 3300025909 | Ga0207705_10015090 | Ga0207705_100150905 | 305 |
| 517 | 3300025909 | Ga0207705_10114384 | Ga0207705_101143842 | 305 |
| 518 | 3300025912 | Ga0207707_10001518 | Ga0207707_1000151814 | 305 |
| 519 | 3300025913 | Ga0207695_10000890 | Ga0207695_100008905 | 305 |
| 520 | 3300025913 | Ga0207695_10001815 | Ga0207695_1000181527 | 305 |
| 521 | 3300025913 | Ga0207695_10001978 | Ga0207695_1000197818 | 305 |
| 522 | 3300025913 | Ga0207695_10003800 | Ga0207695_1000380012 | 305 |
| 523 | 3300025913 | Ga0207695_10004750 | Ga0207695_1000475018 | 305 |
| 524 | 3300025913 | Ga0207695_10004802 | Ga0207695_1000480214 | 305 |
| 525 | 3300025913 | Ga0207695_10011413 | Ga0207695_100114134 | 305 |
| 526 | 3300025913 | Ga0207695_10159409 | Ga0207695_101594092 | 305 |
| 527 | 3300025914 | Ga0207671_10000026 | Ga0207671_10000026202 | 305 |
| 528 | 3300025914 | Ga0207671_10000260 | Ga0207671_1000026042 | 305 |
| 529 | 3300025917 | Ga0207660_10001101 | Ga0207660_1000110110 | 305 |
| 530 | 3300025919 | Ga0207657_10017066 | Ga0207657_100170664 | 305 |
| 531 | 3300025919 | Ga0207657_10026773 | Ga0207657_100267732 | 305 |
| 532 | 3300025919 | Ga0207657_10083951 | Ga0207657_100839513 | 305 |
| 533 | 3300025919 | Ga0207657_10147890 | Ga0207657_101478902 | 305 |
| 534 | 3300025920 | Ga0207649_10000813 | Ga0207649_1000081312 | 305 |
| 535 | 3300025920 | Ga0207649_10136054 | Ga0207649_101360541 | 305 |
| 536 | 3300025921 | Ga0207652_10000534 | Ga0207652_1000053426 | 305 |
| 537 | 3300025921 | Ga0207652_10169616 | Ga0207652_101696161 | 305 |
| 538 | 3300025924 | Ga0207694_10006152 | Ga0207694_100061524 | 305 |
| 539 | 3300025924 | Ga0207694_10064509 | Ga0207694_100645093 | 305 |
| 540 | 3300025924 | Ga0207694_10146315 | Ga0207694_101463152 | 305 |
| 541 | 3300025928 | Ga0207700_10118661 | Ga0207700_101186612 | 305 |
| 542 | 3300025929 | Ga0207664_10000131 | Ga0207664_1000013132 | 305 |
| 543 | 3300025929 | Ga0207664_10184543 | Ga0207664_101845432 | 305 |
| 544 | 3300025932 | Ga0207690_10001020 | Ga0207690_1000102012 | 305 |
| 545 | 3300025932 | Ga0207690_10001569 | Ga0207690_100015693 | 305 |
| 546 | 3300025932 | Ga0207690_10012854 | Ga0207690_100128542 | 305 |
| 547 | 3300025932 | Ga0207690_10110973 | Ga0207690_101109732 | 305 |
| 548 | 3300025933 | Ga0207706_10151314 | Ga0207706_101513141 | 305 |
| 549 | 3300025944 | Ga0207661_10001167 | Ga0207661_100011677 | 305 |
| 550 | 3300025949 | Ga0207667_10000228 | Ga0207667_1000022814 | 305 |
| 551 | 3300025949 | Ga0207667_10000423 | Ga0207667_100004238 | 305 |
| 552 | 3300025949 | Ga0207667_10004840 | Ga0207667_1000484011 | 305 |
| 553 | 3300025949 | Ga0207667_10018795 | Ga0207667_100187955 | 305 |
| 554 | 3300025949 | Ga0207667_10085920 | Ga0207667_100859202 | 305 |
| 555 | 3300025981 | Ga0207640_10001435 | Ga0207640_100014358 | 305 |
| 556 | 3300025981 | Ga0207640_10002177 | Ga0207640_100021773 | 305 |
| 557 | 3300025981 | Ga0207640_10004571 | Ga0207640_100045715 | 305 |
| 558 | 3300025981 | Ga0207640_10006252 | Ga0207640_100062524 | 305 |
| 559 | 3300026035 | Ga0207703_10008011 | Ga0207703_100080112 | 305 |
| 560 | 3300026041 | Ga0207639_10002168 | Ga0207639_100021682 | 305 |
| 561 | 3300026041 | Ga0207639_10146280 | Ga0207639_101462802 | 305 |
| 562 | 3300026067 | Ga0207678_10003393 | Ga0207678_100033932 | 305 |
| 563 | 3300026067 | Ga0207678_10024316 | Ga0207678_100243162 | 305 |
| 564 | 3300026067 | Ga0207678_10153442 | Ga0207678_101534421 | 305 |
| 565 | 3300026067 | Ga0207678_10346586 | Ga0207678_103465862 | 305 |
| 566 | 3300026078 | Ga0207702_10000649 | Ga0207702_1000064931 | 305 |
| 567 | 3300026078 | Ga0207702_10003811 | Ga0207702_100038113 | 305 |
| 568 | 3300026078 | Ga0207702_10120326 | Ga0207702_101203263 | 305 |
| 569 | 3300026116 | Ga0207674_10000219 | Ga0207674_1000021948 | 305 |
| 570 | 3300026116 | Ga0207674_10008157 | Ga0207674_100081576 | 305 |
| 571 | 3300026142 | Ga0207698_10001997 | Ga0207698_100019972 | 305 |
| 572 | 3300026142 | Ga0207698_10039602 | Ga0207698_100396023 | 305 |
| 573 | 3300026142 | Ga0207698_10055048 | Ga0207698_100550482 | 305 |
| 574 | 3300033180 | Ga0307510_10000211 | Ga0307510_100002115 | 305 |
| 575 | 3300033180 | Ga0307510_10241439 | Ga0307510_102414392 | 305 |
| 576 | 3300037312 | Ga0395899_0005527 | Ga0395899_0005527_4506_5423 | 305 |
| 577 | 3300037312 | Ga0395899_0030816 | Ga0395899_0030816_2775_3710 | 305 |
| 578 | 3300037418 | Ga0395900_0000656 | Ga0395900_0000656_27747_28676 | 305 |
| 579 | 3300037418 | Ga0395900_0055819 | Ga0395900_0055819_2072_3007 | 305 |
| 580 | 3300037418 | Ga0395900_0056124 | Ga0395900_0056124_694_1611 | 305 |
| 581 | 3300037466 | Ga0395898_0093264 | Ga0395898_0093264_1089_2006 | 305 |
| 582 | 3300038443 | Ga0395901_0006931 | Ga0395901_0006931_8192_9127 | 305 |
| 583 | 3300038443 | Ga0395901_0063271 | Ga0395901_0063271_1653_2570 | 305 |
| 584 | 3300041509 | Ga0451843_0901753 | Ga0451843_0901753_335_1261 | 305 |
| 585 | 3300044656 | Ga0466969_0008616 | Ga0466969_0008616_3002_3928 | 305 |
| 586 | 3300044684 | Ga0466966_0002721 | Ga0466966_0002721_4621_5547 | 305 |
| 587 | 3300044684 | Ga0466966_0153891 | Ga0466966_0153891_195_1121 | 305 |
| 588 | 3300044684 | Ga0466966_0201724 | Ga0466966_0201724_83_1009 | 305 |
| 589 | 3300044693 | Ga0466961_0000918 | Ga0466961_0000918_14547_15473 | 305 |
| 590 | 3300044693 | Ga0466961_0026691 | Ga0466961_0026691_373_1299 | 305 |
| 591 | 3300044694 | Ga0466963_0066957 | Ga0466963_0066957_1034_1960 | 305 |
| 592 | 3300044719 | Ga0466971_0002229 | Ga0466971_0002229_904_1830 | 305 |
| 593 | 3300044735 | Ga0466968_0012234 | Ga0466968_0012234_297_1223 | 305 |
| 594 | 3300044765 | Ga0466970_0087871 | Ga0466970_0087871_655_1581 | 305 |
| 595 | 3300044765 | Ga0466970_0156525 | Ga0466970_0156525_303_1229 | 305 |
| 596 | 3300045049 | Ga0466959_0040298 | Ga0466959_0040298_1754_2680 | 305 |
| 597 | 3300045836 | Ga0466958_0017902 | Ga0466958_0017902_2772_3698 | 305 |
| 598 | 3300046471 | Ga0495650_0000218 | Ga0495650_0000218_115219_116145 | 305 |
| 599 | 3300046507 | Ga0495606_0039287 | Ga0495606_0039287_1302_2228 | 305 |
| 600 | 3300048907 | Ga0496104_0030897 | Ga0496104_0030897_3247_4173 | 305 |
| 601 | 3300048908 | Ga0496105_0004975 | Ga0496105_0004975_148_1074 | 305 |
| 602 | 3300048918 | Ga0496115_0006005 | Ga0496115_0006005_3328_4254 | 305 |
| 603 | 3300048920 | Ga0496117_0009380 | Ga0496117_0009380_3603_4529 | 305 |
| 604 | 3300048920 | Ga0496117_0020494 | Ga0496117_0020494_3787_4713 | 305 |
| 605 | 3300048921 | Ga0496118_0005405 | Ga0496118_0005405_7322_8248 | 305 |
| 606 | 3300048921 | Ga0496118_0010204 | Ga0496118_0010204_4837_5763 | 305 |
| 607 | 3300048922 | Ga0496119_0000725 | Ga0496119_0000725_4014_4940 | 305 |
| 608 | 3300048923 | Ga0496120_0000821 | Ga0496120_0000821_4005_4931 | 305 |
| 609 | 3300048923 | Ga0496120_0001981 | Ga0496120_0001981_19570_20496 | 305 |
| 610 | 3300048924 | Ga0496121_0015979 | Ga0496121_0015979_5716_6642 | 305 |
| 611 | 3300048924 | Ga0496121_0108398 | Ga0496121_0108398_113_1039 | 305 |
| 612 | 3300048928 | Ga0496125_0002690 | Ga0496125_0002690_15439_16365 | 305 |
| 613 | 3300048929 | Ga0496126_0005169 | Ga0496126_0005169_10566_11492 | 305 |
| 614 | 3300048929 | Ga0496126_0006381 | Ga0496126_0006381_235_1161 | 305 |
| 615 | 3300048929 | Ga0496126_0047878 | Ga0496126_0047878_66_992 | 305 |
| 616 | 3300049568 | Ga0501031_0181613 | Ga0501031_0181613_84_1007 | 305 |
| 617 | 3300049571 | Ga0501034_0007301 | Ga0501034_0007301_4608_5543 | 305 |
| 618 | 3300049573 | Ga0501037_0015831 | Ga0501037_0015831_4290_5264 | 305 |
| 619 | 3300049573 | Ga0501037_0028747 | Ga0501037_0028747_844_1779 | 305 |
| 620 | 3300049579 | Ga0501043_0026804 | Ga0501043_0026804_597_1523 | 305 |
| 621 | 3300049580 | Ga0501046_0010346 | Ga0501046_0010346_5419_6345 | 305 |
| 622 | 3300049581 | Ga0501047_0001404 | Ga0501047_0001404_16280_17239 | 305 |
| 623 | 3300049585 | Ga0501069_0003670 | Ga0501069_0003670_6746_7705 | 305 |
| 624 | 3300049586 | Ga0501070_0008982 | Ga0501070_0008982_5991_6950 | 305 |
| 625 | 3300049586 | Ga0501070_0040778 | Ga0501070_0040778_1137_2072 | 305 |
| 626 | 3300049587 | Ga0501071_0218503 | Ga0501071_0218503_69_1028 | 305 |
| 627 | 3300049590 | Ga0501074_0000594 | Ga0501074_0000594_5087_6046 | 305 |
| 628 | 3300049741 | Ga0501079_0123705 | Ga0501079_0123705_939_1898 | 305 |
| 629 | 3300049742 | Ga0501080_0006171 | Ga0501080_0006171_1902_2861 | 305 |
| 630 | 3300049822 | Ga0501035_0071715 | Ga0501035_0071715_1179_2114 | 305 |
| 631 | 3300049822 | Ga0501035_0110059 | Ga0501035_0110059_1408_2367 | 305 |
| 632 | 3300049823 | Ga0501044_0002778 | Ga0501044_0002778_5514_6449 | 305 |
| 633 | 3300049823 | Ga0501044_0012333 | Ga0501044_0012333_1687_2646 | 305 |
| 634 | 3300049823 | Ga0501044_0038344 | Ga0501044_0038344_390_1325 | 305 |
| 635 | 3300053093 | Ga0500651_0002524 | Ga0500651_0002524_7028_7954 | 305 |
| 636 | 3300061719 | Ga0466962_0000743 | Ga0466962_0000743_13685_14611 | 305 |
| 637 | iso_pu_bacteria | 2939611941 | 2939614023 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5f34-assembly1.cif.gz_A | crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group | 0.8467 | 59 | 294 |
| 5kn7-assembly1.cif.gz_B-2 | lipid a secondary acyltransferase lpxm from acinetobacter baumannii | 0.8379 | 32 | 295 |
| 5f34-assembly1.cif.gz_A | crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group | 0.7912 | 59 | 294 |
| 5knk-assembly1.cif.gz_B-2 | lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) | 0.7814 | 6 | 298 |
| 5knk-assembly1.cif.gz_B-2 | lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) | 0.7315 | 6 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A2BGR3_377_681_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.626 | 114 | 200 | 3.40.50.300 |
| af_Q9VYJ4_80_210_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.62 | 112 | 238 | 3.40.50.620 |
| af_Q9UNY4_836_1160_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.5956 | 114 | 199 | 3.40.50.300 |
| af_Q7KTI0_75_205_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.5895 | 113 | 238 | 3.40.50.620 |
| af_Q9VYJ4_80_210_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.5842 | 112 | 238 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M4XP05-F1-model_v4 | KDO2-lipid IV(A) lauroyltransferase | 0.9619 | 28 | 300 |
GO:0005886
GO:0009103 GO:0009245 GO:0016746 |
| AF-A0A1T4QHI8-F1-model_v4 | KDO2-lipid IV(A) lauroyltransferase | 0.9615 | 28 | 305 |
GO:0005886
GO:0009103 GO:0009245 GO:0016746 |
| AF-A0A562BXF6-F1-model_v4 | Lipid A biosynthesis acyltransferase (EC 2.3.1.241) (Kdo(2)-lipid IV(A) acyltransferase) | 0.9528 | 2 | 304 |
GO:0005886
GO:0008913 GO:0009103 GO:0009245 GO:0036104 |
| AF-A0A3N1P219-F1-model_v4 | Lipid A biosynthesis acyltransferase (EC 2.3.1.241) (Kdo(2)-lipid IV(A) acyltransferase) | 0.9486 | 5 | 305 |
GO:0005886
GO:0008913 GO:0009103 GO:0009245 GO:0036104 |
| AF-A0A2N9D5K8-F1-model_v4 | deleted | 0.9485 | 20 | 304 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar