F471424

General Info

Members Datasets Scaffolds Average Seq Length
637 246 615 302

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10092723|Ga0157372_100927233
Length 338
Sequence MPMQLGSDGISGKRPARSEKDASTPHPRTIARMPGMPRPSFDPSLLAPRHWPAWLGVAVIWLIARLPYPLLMSLGRLLGTLIRHVPSRRRRIAEANIALCFPELDAQEQAALVDAHLTDIGLMLVEFALGWMGSDRAIARIHTRVEGLEHLEAARAQGQGVLLVGGHFSHLELCARLISRRIPIAGMYRRMDSPVFEWTVLRARLHYAAAMFEKDDIRGTVKYLRSGGTVWYAPDQDMRSKDSVFVPFFGVPAATITATHHLARMGQAQVIPFFHHRLAEGGYAMRLGAPLPMGGDAAADTAVVNASVEQMVRAAPAQYLWVHKRFKSRPPGAPEVYR

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
3 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
4 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
5 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
6 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
7 2734482264 Dyella sp. AD052 Isolate Unclassified
8 2738543009 Luteibacter sp. OK325 Isolate Unclassified
9 2739367700 Dyella sp. YR388 Isolate Unclassified
10 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
11 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
12 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
13 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
14 2884411467 Dyella sp. AD56 Isolate Rhizosphere
15 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
16 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
17 2919085039 Luteibacter sp. 1214 Isolate Unclassified
18 2919404418 Luteibacter sp. 3190 Isolate Unclassified
19 2928963466 Dyella japonica 1073 Isolate Unclassified
20 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
21 2941471342 Luteibacter sp. 621 Isolate Unclassified
22 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
23 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
28 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
29 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
30 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
31 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
32 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
36 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
37 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
38 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
92 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
157 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
158 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
244 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.82
Metatranscriptomes 1.73
Isolates 3.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.81
Nodule 0
Rhizoplane 1.88
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 12.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1008106 3300001915 Bacteria 1997
2 JGI24740J21852_10000931 3300001979 Bacteria 13002
3 JGI24739J22299_10043324 3300001989 Bacteria 1488
4 JGI24737J22298_10000633 3300001990 Bacteria 12378
5 JGI25156J39149_1003556 3300002705 Bacteria 5057
6 JGI25156J39149_1004170 3300002705 Bacteria 4479
7 JGI25162J39368_1000239 3300002737 Bacteria 54751
8 JGI25162J39368_1000249 3300002737 Bacteria 53308
9 JGI25162J39368_1002541 3300002737 Bacteria 6969
10 JGI25162J39368_1007020 3300002737 Bacteria 1824
11 JGI25157J39369_1000293 3300002741 Bacteria 36433
12 JGI25157J39369_1001205 3300002741 Bacteria 10816
13 JGI25157J39369_1001281 3300002741 Bacteria 10119
14 JGI25157J39369_1002499 3300002741 Bacteria 4479
15 JGI25163J39215_1000359 3300002771 Bacteria 14904
16 JGI25164J39214_1000004 3300002772 Bacteria 350814
17 JGI25164J39214_1000200 3300002772 Bacteria 50877
18 JGI25164J39214_1001210 3300002772 Bacteria 6969
19 JGI25164J39214_1001216 3300002772 Bacteria 6952
20 JGI25165J46597_1000110 3300003214 Bacteria 148234
21 JGI25165J46597_1000319 3300003214 Bacteria 57885
22 JGI25165J46597_1002182 3300003214 Bacteria 6969
23 JGI25165J46597_1003527 3300003214 Bacteria 3833
24 JGI25153J46596_10026961 3300003215 Bacteria 2023
25 rootH1_10080198 3300003316 Bacteria 4626
26 Ga0006562J51391_1003480 3300003578 Bacteria 22000
27 Ga0006562J51391_1003481 3300003578 Bacteria 13735
28 Ga0006562J51391_1100886 3300003578 Bacteria 2920
29 Ga0055538_1000686 3300003751 Bacteria 10403
30 Ga0055533_1000886 3300003756 Bacteria 9024
31 Ga0055533_1003563 3300003756 Bacteria 3086
32 Ga0055527_1000060 3300003760 Bacteria 92147
33 Ga0055527_1000158 3300003760 Bacteria 47794
34 Ga0055535_1000242 3300003761 Bacteria 57885
35 Ga0055535_1000331 3300003761 Bacteria 47776
36 Ga0055535_1000407 3300003761 Bacteria 40501
37 Ga0055535_1001855 3300003761 Bacteria 9031
38 Ga0055535_1001873 3300003761 Bacteria 8918
39 Ga0055542_1000171 3300003762 Bacteria 80629
40 Ga0055542_1000283 3300003762 Bacteria 56912
41 Ga0055542_1000298 3300003762 Bacteria 55290
42 Ga0055542_1000358 3300003762 Bacteria 47776
43 Ga0055542_1001762 3300003762 Bacteria 9124
44 Ga0055542_1001772 3300003762 Bacteria 9051
45 Ga0055529_1000384 3300003763 Bacteria 47776
46 Ga0055529_1000437 3300003763 Bacteria 41881
47 Ga0055529_1000450 3300003763 Bacteria 40600
48 Ga0055529_1000471 3300003763 Bacteria 38707
49 Ga0065165_1000887 3300005262 Bacteria 38644
50 Ga0070658_10077157 3300005327 Bacteria 2733
51 Ga0070658_10242299 3300005327 Bacteria 1528
52 Ga0070666_10000099 3300005335 Bacteria 59763
53 Ga0070680_100107682 3300005336 Bacteria 2318
54 Ga0070682_100000784 3300005337 Bacteria 18659
55 Ga0070682_100005233 3300005337 Bacteria 7218
56 Ga0070660_100014288 3300005339 Bacteria 5718
57 Ga0070660_100156530 3300005339 Bacteria 1834
58 Ga0070689_100056467 3300005340 Bacteria 3044
59 Ga0070661_100014581 3300005344 Bacteria 5540
60 Ga0070661_100021235 3300005344 Bacteria 4635
61 Ga0070661_100027314 3300005344 Bacteria 4108
62 Ga0070692_10009726 3300005345 Bacteria 4350
63 Ga0070692_10014711 3300005345 Bacteria 3683
64 Ga0070688_100008301 3300005365 Bacteria 5633
65 Ga0070659_100000789 3300005366 Bacteria 23091
66 Ga0070659_100005989 3300005366 Bacteria 8766
67 Ga0070659_100006429 3300005366 Bacteria 8482
68 Ga0070659_100072464 3300005366 Bacteria 2741
69 Ga0070659_100076267 3300005366 Bacteria 2673
70 Ga0070659_100217428 3300005366 Bacteria 1576
71 Ga0070667_100185108 3300005367 Bacteria 1843
72 Ga0070714_100000392 3300005435 Bacteria 32581
73 Ga0070714_100000930 3300005435 Bacteria 20799
74 Ga0070714_100008963 3300005435 Bacteria 7832
75 Ga0070713_100000391 3300005436 Bacteria 28122
76 Ga0070663_100067146 3300005455 Bacteria 2600
77 Ga0070663_100212204 3300005455 Bacteria 1516
78 Ga0070662_100115484 3300005457 Bacteria 2050
79 Ga0070662_100184699 3300005457 Bacteria 1646
80 Ga0070681_10000500 3300005458 Bacteria 32052
81 Ga0070681_10000680 3300005458 Bacteria 28135
82 Ga0070681_10032143 3300005458 Bacteria 5267
83 Ga0070681_10037437 3300005458 Bacteria 4868
84 Ga0070681_10166203 3300005458 Bacteria 2129
85 Ga0070681_10186772 3300005458 Bacteria 1993
86 Ga0070681_10256017 3300005458 Bacteria 1662
87 Ga0070685_10067640 3300005466 Bacteria 2108
88 Ga0070679_100007899 3300005530 Bacteria 9982
89 Ga0070679_100132542 3300005530 Bacteria 2473
90 Ga0068853_100003442 3300005539 Bacteria 12106
91 Ga0068853_100005385 3300005539 Bacteria 10018
92 Ga0068853_100161317 3300005539 Bacteria 2023
93 Ga0068853_100168819 3300005539 Bacteria 1978
94 Ga0068853_100173192 3300005539 Bacteria 1953
95 Ga0070696_100000357 3300005546 Bacteria 27875
96 Ga0070696_100004863 3300005546 Bacteria 8978
97 Ga0070696_100005209 3300005546 Bacteria 8692
98 Ga0070696_100092988 3300005546 Bacteria 2150
99 Ga0070693_100000882 3300005547 Bacteria 13346
100 Ga0070693_100040722 3300005547 Bacteria 2610
101 Ga0068855_100014533 3300005563 Bacteria 9482
102 Ga0068855_100058198 3300005563 Bacteria 4527
103 Ga0068855_100076161 3300005563 Bacteria 3894
104 Ga0068855_100105254 3300005563 Bacteria 3244
105 Ga0068855_100439241 3300005563 Bacteria 1425
106 Ga0068855_100475087 3300005563 Bacteria 1361
107 Ga0068857_100006695 3300005577 Bacteria 9906
108 Ga0068857_100087956 3300005577 Bacteria 2779
109 Ga0068857_100215524 3300005577 Bacteria 1753
110 Ga0068854_100006992 3300005578 Bacteria 7196
111 Ga0068854_100017143 3300005578 Bacteria 4842
112 Ga0068854_100117109 3300005578 Bacteria 2017
113 Ga0068856_100000088 3300005614 Bacteria 85931
114 Ga0068856_100015285 3300005614 Bacteria 7416
115 Ga0068856_100035641 3300005614 Bacteria 4877
116 Ga0068856_100041344 3300005614 Bacteria 4530
117 Ga0068856_100295055 3300005614 Bacteria 1638
118 Ga0068856_100423367 3300005614 Bacteria 1351
119 Ga0068852_100024221 3300005616 Bacteria 4902
120 Ga0068852_100035332 3300005616 Bacteria 4168
121 Ga0068852_100092362 3300005616 Bacteria 2710
122 Ga0068852_100174291 3300005616 Bacteria 2018
123 Ga0068863_100288849 3300005841 Bacteria 1590
124 Ga0068858_100076676 3300005842 Bacteria 3105
125 Ga0068860_100013356 3300005843 Bacteria 8051
126 Ga0105240_10003419 3300009093 Bacteria 24663
127 Ga0105240_10009031 3300009093 Bacteria 14155
128 Ga0105240_10017579 3300009093 Bacteria 9635
129 Ga0105240_10126228 3300009093 Bacteria 3074
130 Ga0105240_10164886 3300009093 Bacteria 2629
131 Ga0105240_10252329 3300009093 Bacteria 2040
132 Ga0105240_10442638 3300009093 Bacteria 1456
133 Ga0105247_10005430 3300009101 Bacteria 8029
134 Ga0105241_10024312 3300009174 Bacteria 4499
135 Ga0105237_10000058 3300009545 Bacteria 146943
136 Ga0105237_10000777 3300009545 Bacteria 43669
137 Ga0105237_10718797 3300009545 Bacteria 1005
138 Ga0105238_10000428 3300009551 Bacteria 44396
139 Ga0105238_10002416 3300009551 Bacteria 18737
140 Ga0105238_10003804 3300009551 Bacteria 14993
141 Ga0105238_10041722 3300009551 Bacteria 4647
142 Ga0105238_10194465 3300009551 Bacteria 2004
143 Ga0105238_10198106 3300009551 Bacteria 1984
144 Ga0105238_10242002 3300009551 Bacteria 1782
145 Ga0105249_10056528 3300009553 Bacteria 3592
146 Ga0105147_100851 3300009982 Bacteria 2472
147 Ga0105239_10005406 3300010375 Bacteria 14984
148 Ga0105239_10021782 3300010375 Bacteria 7065
149 Ga0105239_10026086 3300010375 Bacteria 6433
150 Ga0105239_10110342 3300010375 Bacteria 3049
151 Ga0157314_1000012 3300012500 Bacteria 17830
152 Ga0157373_10000805 3300013100 Bacteria 24257
153 Ga0157373_10084130 3300013100 Bacteria 2243
154 Ga0157373_10124667 3300013100 Bacteria 1811
155 Ga0157371_10003280 3300013102 Bacteria 14813
156 Ga0157371_10020161 3300013102 Bacteria 4907
157 Ga0157371_10059103 3300013102 Bacteria 2719
158 Ga0157371_10147392 3300013102 Bacteria 1678
159 Ga0157370_10001873 3300013104 Bacteria 25937
160 Ga0157370_10003026 3300013104 Bacteria 19954
161 Ga0157370_10011839 3300013104 Bacteria 9099
162 Ga0157370_10017280 3300013104 Bacteria 7281
163 Ga0157370_10031638 3300013104 Bacteria 5174
164 Ga0157370_10077276 3300013104 Bacteria 3136
165 Ga0157369_10001681 3300013105 Bacteria 27000
166 Ga0157369_10041370 3300013105 Bacteria 5030
167 Ga0157369_10100640 3300013105 Bacteria 3080
168 Ga0157369_10225589 3300013105 Bacteria 1960
169 Ga0157369_10490634 3300013105 Bacteria 1271
170 Ga0163162_10000848 3300013306 Bacteria 28416
171 Ga0157372_10002093 3300013307 Bacteria 21693
172 Ga0157372_10092723 3300013307 Bacteria 3436
173 Ga0157372_10134218 3300013307 Bacteria 2850
174 Ga0157372_10208479 3300013307 Bacteria 2264
175 Ga0157372_10274815 3300013307 Bacteria 1958
176 Ga0157372_10428225 3300013307 Bacteria 1542
177 Ga0182008_10003482 3300014497 Bacteria 9498
178 Ga0182008_10021450 3300014497 Bacteria 3316
179 Ga0182008_10027917 3300014497 Bacteria 2856
180 Ga0182006_1000082 3300015261 Bacteria 119023
181 Ga0182006_1000319 3300015261 Bacteria 42157
182 Ga0182006_1007188 3300015261 Bacteria 5115
183 Ga0182007_10012867 3300015262 Bacteria 3208
184 Ga0182007_10019921 3300015262 Bacteria 2404
185 Ga0182005_1000015 3300015265 Bacteria 387565
186 Ga0182005_1007876 3300015265 Bacteria 3167
187 Ga0183369_1011 3300015685 Bacteria 252490
188 Ga0183368_1007 3300015687 Bacteria 405609
189 Ga0206356_10344540 3300020070 Bacteria 3316
190 Ga0206356_10813108 3300020070 Bacteria 7135
191 Ga0206354_10058580 3300020081 Bacteria 7556
192 Ga0206353_10313916 3300020082 Bacteria 1511
193 Ga0206353_10367129 3300020082 Bacteria 6431
194 Ga0206353_10641193 3300020082 Bacteria 2391
195 Ga0206353_11510336 3300020082 Bacteria 2094
196 Ga0154015_1113103 3300020610 Bacteria 3046
197 Ga0209760_102767 3300025207 Bacteria 1609
198 Ga0209784_100163 3300025224 Bacteria 57927
199 Ga0209674_100037 3300025226 Bacteria 404339
200 Ga0209674_100058 3300025226 Bacteria 286902
201 Ga0209674_100874 3300025226 Bacteria 9813
202 Ga0209674_100924 3300025226 Bacteria 9386
203 Ga0209672_100043 3300025228 Bacteria 270302
204 Ga0209672_100061 3300025228 Bacteria 206098
205 Ga0209672_100077 3300025228 Bacteria 158067
206 Ga0209672_102380 3300025228 Bacteria 4693
207 Ga0209563_100062 3300025230 Bacteria 264769
208 Ga0207427_100031 3300025231 Bacteria 350866
209 Ga0207427_100196 3300025231 Bacteria 57937
210 Ga0207427_100258 3300025231 Bacteria 41628
211 Ga0207427_100275 3300025231 Bacteria 38754
212 Ga0207427_104453 3300025231 Bacteria 2354
213 Ga0209437_100061 3300025233 Bacteria 350866
214 Ga0209437_100121 3300025233 Bacteria 202531
215 Ga0209437_100132 3300025233 Bacteria 178495
216 Ga0209437_100345 3300025233 Bacteria 54531
217 Ga0209437_100385 3300025233 Bacteria 43317
218 Ga0209437_100685 3300025233 Bacteria 18042
219 Ga0209258_100054 3300025242 Bacteria 339063
220 Ga0209258_100076 3300025242 Bacteria 270302
221 Ga0209258_100097 3300025242 Bacteria 216963
222 Ga0209258_100384 3300025242 Bacteria 56539
223 Ga0209258_100514 3300025242 Bacteria 37294
224 Ga0209258_100565 3300025242 Bacteria 31952
225 Ga0209646_1000643 3300025246 Bacteria 13097
226 Ga0209646_1001170 3300025246 Bacteria 7628
227 Ga0209646_1002495 3300025246 Bacteria 4045
228 Ga0209026_1000119 3300025250 Bacteria 130220
229 Ga0209026_1000130 3300025250 Bacteria 120413
230 Ga0209026_1000147 3300025250 Bacteria 111301
231 Ga0209026_1000286 3300025250 Bacteria 57937
232 Ga0209026_1000337 3300025250 Bacteria 45585
233 Ga0209026_1001327 3300025250 Bacteria 11105
234 Ga0209148_1000047 3300025254 Bacteria 434369
235 Ga0209148_1000055 3300025254 Bacteria 367500
236 Ga0209148_1000063 3300025254 Bacteria 346881
237 Ga0209148_1000066 3300025254 Bacteria 339063
238 Ga0209148_1000082 3300025254 Bacteria 270302
239 Ga0209148_1000611 3300025254 Bacteria 31952
240 Ga0209148_1001587 3300025254 Bacteria 10735
241 Ga0209759_1000176 3300025256 Bacteria 105921
242 Ga0209759_1000218 3300025256 Bacteria 88056
243 Ga0209759_1000651 3300025256 Bacteria 32313
244 Ga0209759_1001247 3300025256 Bacteria 15426
245 Ga0209759_1002602 3300025256 Bacteria 7784
246 Ga0209759_1013168 3300025256 Bacteria 2251
247 Ga0209129_1000331 3300025258 Bacteria 41001
248 Ga0209129_1011029 3300025258 Bacteria 2193
249 Ga0209233_1000076 3300025261 Bacteria 350866
250 Ga0209233_1000100 3300025261 Bacteria 293905
251 Ga0209233_1000112 3300025261 Bacteria 258251
252 Ga0209233_1000114 3300025261 Bacteria 246083
253 Ga0209455_1000078 3300025272 Bacteria 270237
254 Ga0209455_1000096 3300025272 Bacteria 217006
255 Ga0209455_1000101 3300025272 Bacteria 206098
256 Ga0209455_1000270 3300025272 Bacteria 57937
257 Ga0209455_1000636 3300025272 Bacteria 21526
258 Ga0209758_1002347 3300025297 Bacteria 19502
259 Ga0209256_1014451 3300025299 Bacteria 2839
260 Ga0207656_10016293 3300025321 Bacteria 2892
261 Ga0207692_10019978 3300025898 Bacteria 3038
262 Ga0207680_10000001 3300025903 Bacteria 1091453
263 Ga0207647_10000130 3300025904 Bacteria 58985
264 Ga0207647_10001258 3300025904 Bacteria 19480
265 Ga0207647_10001536 3300025904 Bacteria 17773
266 Ga0207647_10022280 3300025904 Bacteria 4210
267 Ga0207705_10001263 3300025909 Bacteria 20310
268 Ga0207705_10011495 3300025909 Bacteria 6402
269 Ga0207705_10015090 3300025909 Bacteria 5554
270 Ga0207705_10105711 3300025909 Bacteria 2075
271 Ga0207705_10113516 3300025909 Bacteria 2004
272 Ga0207705_10114384 3300025909 Bacteria 1996
273 Ga0207705_10326292 3300025909 Bacteria 1180
274 Ga0207707_10000191 3300025912 Bacteria 64552
275 Ga0207707_10000930 3300025912 Bacteria 28392
276 Ga0207707_10001518 3300025912 Bacteria 21417
277 Ga0207707_10003336 3300025912 Bacteria 14252
278 Ga0207707_10036458 3300025912 Bacteria 4299
279 Ga0207695_10000890 3300025913 Bacteria 54211
280 Ga0207695_10001815 3300025913 Bacteria 33615
281 Ga0207695_10001978 3300025913 Bacteria 31654
282 Ga0207695_10003800 3300025913 Bacteria 20939
283 Ga0207695_10004750 3300025913 Bacteria 18386
284 Ga0207695_10004802 3300025913 Bacteria 18287
285 Ga0207695_10010285 3300025913 Bacteria 11458
286 Ga0207695_10011413 3300025913 Bacteria 10768
287 Ga0207695_10038912 3300025913 Bacteria 5115
288 Ga0207695_10159409 3300025913 Bacteria 2189
289 Ga0207671_10000026 3300025914 Bacteria 268845
290 Ga0207671_10000260 3300025914 Bacteria 79210
291 Ga0207660_10001101 3300025917 Bacteria 18049
292 Ga0207660_10003239 3300025917 Bacteria 10656
293 Ga0207660_10007280 3300025917 Bacteria 7161
294 Ga0207660_10018262 3300025917 Bacteria 4672
295 Ga0207657_10017066 3300025919 Bacteria 6982
296 Ga0207657_10026773 3300025919 Bacteria 5291
297 Ga0207657_10070370 3300025919 Bacteria 2966
298 Ga0207657_10083951 3300025919 Bacteria 2671
299 Ga0207657_10138459 3300025919 Bacteria 1990
300 Ga0207657_10147890 3300025919 Bacteria 1915
301 Ga0207649_10000813 3300025920 Bacteria 20064
302 Ga0207649_10054906 3300025920 Bacteria 2481
303 Ga0207649_10057251 3300025920 Bacteria 2437
304 Ga0207649_10136054 3300025920 Bacteria 1675
305 Ga0207649_10140811 3300025920 Bacteria 1650
306 Ga0207652_10000534 3300025921 Bacteria 38545
307 Ga0207652_10000855 3300025921 Bacteria 28951
308 Ga0207652_10011131 3300025921 Bacteria 7251
309 Ga0207652_10158209 3300025921 Bacteria 2030
310 Ga0207652_10169616 3300025921 Bacteria 1958
311 Ga0207652_10209810 3300025921 Bacteria 1753
312 Ga0207694_10000322 3300025924 Bacteria 45212
313 Ga0207694_10006152 3300025924 Bacteria 9172
314 Ga0207694_10006156 3300025924 Bacteria 9170
315 Ga0207694_10017993 3300025924 Bacteria 5341
316 Ga0207694_10046351 3300025924 Bacteria 3360
317 Ga0207694_10064509 3300025924 Bacteria 2854
318 Ga0207694_10146315 3300025924 Bacteria 1902
319 Ga0207700_10118661 3300025928 Bacteria 2141
320 Ga0207664_10000131 3300025929 Bacteria 65529
321 Ga0207664_10000403 3300025929 Bacteria 30881
322 Ga0207664_10184543 3300025929 Bacteria 1792
323 Ga0207690_10001020 3300025932 Bacteria 17929
324 Ga0207690_10001569 3300025932 Bacteria 14300
325 Ga0207690_10011392 3300025932 Bacteria 5319
326 Ga0207690_10012854 3300025932 Bacteria 5016
327 Ga0207690_10073456 3300025932 Bacteria 2365
328 Ga0207690_10110973 3300025932 Bacteria 1975
329 Ga0207706_10151314 3300025933 Bacteria 2041
330 Ga0207706_10217562 3300025933 Bacteria 1673
331 Ga0207661_10001167 3300025944 Bacteria 17544
332 Ga0207667_10000228 3300025949 Bacteria 78952
333 Ga0207667_10000423 3300025949 Bacteria 57047
334 Ga0207667_10002262 3300025949 Bacteria 24191
335 Ga0207667_10004840 3300025949 Bacteria 16461
336 Ga0207667_10007055 3300025949 Bacteria 13575
337 Ga0207667_10018795 3300025949 Bacteria 7738
338 Ga0207667_10054904 3300025949 Bacteria 4189
339 Ga0207667_10085920 3300025949 Bacteria 3256
340 Ga0207712_10025875 3300025961 Bacteria 3904
341 Ga0207640_10001435 3300025981 Bacteria 12897
342 Ga0207640_10002177 3300025981 Bacteria 10544
343 Ga0207640_10004571 3300025981 Bacteria 7508
344 Ga0207640_10006252 3300025981 Bacteria 6528
345 Ga0207703_10008011 3300026035 Bacteria 8349
346 Ga0207639_10001739 3300026041 Bacteria 14673
347 Ga0207639_10002168 3300026041 Bacteria 13216
348 Ga0207639_10007916 3300026041 Bacteria 7261
349 Ga0207639_10015247 3300026041 Bacteria 5417
350 Ga0207639_10017700 3300026041 Bacteria 5053
351 Ga0207639_10032518 3300026041 Bacteria 3840
352 Ga0207639_10146280 3300026041 Bacteria 1974
353 Ga0207678_10003393 3300026067 Bacteria 14352
354 Ga0207678_10024316 3300026067 Bacteria 5291
355 Ga0207678_10083549 3300026067 Bacteria 2731
356 Ga0207678_10153442 3300026067 Bacteria 1967
357 Ga0207678_10263048 3300026067 Bacteria 1479
358 Ga0207678_10346586 3300026067 Bacteria 1281
359 Ga0207702_10000649 3300026078 Bacteria 37917
360 Ga0207702_10001573 3300026078 Bacteria 22598
361 Ga0207702_10003811 3300026078 Bacteria 13607
362 Ga0207702_10120326 3300026078 Bacteria 2349
363 Ga0207641_10191250 3300026088 Bacteria 1881
364 Ga0207674_10000219 3300026116 Bacteria 71283
365 Ga0207674_10008157 3300026116 Bacteria 12145
366 Ga0207674_10069528 3300026116 Bacteria 3541
367 Ga0207674_10130368 3300026116 Bacteria 2478
368 Ga0207674_10230168 3300026116 Bacteria 1801
369 Ga0207674_10267874 3300026116 Bacteria 1656
370 Ga0207675_100034792 3300026118 Bacteria 4698
371 Ga0207698_10001997 3300026142 Bacteria 12015
372 Ga0207698_10039602 3300026142 Bacteria 3493
373 Ga0207698_10055048 3300026142 Bacteria 3063
374 Ga0268266_10000148 3300028379 Bacteria 135001
375 Ga0268264_10075559 3300028381 Bacteria 2865
376 Ga0307405_10291375 3300031731 Bacteria 1234
377 Ga0307412_10001046 3300031911 Bacteria 15798
378 Ga0307510_10000211 3300033180 Bacteria 51532
379 Ga0307510_10241439 3300033180 Bacteria 1301
380 Ga0395899_0000410 3300037312 Bacteria 50063
381 Ga0395899_0005527 3300037312 Bacteria 9790
382 Ga0395899_0026012 3300037312 Bacteria 4416
383 Ga0395899_0030816 3300037312 Bacteria 4033
384 Ga0395899_0043225 3300037312 Bacteria 3361
385 Ga0395899_0057995 3300037312 Bacteria 2856
386 Ga0395899_0069963 3300037312 Bacteria 2568
387 Ga0395900_0000206 3300037418 Bacteria 92782
388 Ga0395900_0000656 3300037418 Bacteria 46333
389 Ga0395900_0001137 3300037418 Bacteria 33592
390 Ga0395900_0004679 3300037418 Bacteria 14427
391 Ga0395900_0015796 3300037418 Bacteria 7697
392 Ga0395900_0039144 3300037418 Bacteria 4886
393 Ga0395900_0055819 3300037418 Bacteria 4067
394 Ga0395900_0056124 3300037418 Bacteria 4054
395 Ga0395900_0165780 3300037418 Bacteria 2251
396 Ga0395900_0170694 3300037418 Bacteria 2215
397 Ga0395898_0000013 3300037466 Bacteria 458788
398 Ga0395898_0000120 3300037466 Bacteria 209091
399 Ga0395898_0093264 3300037466 Bacteria 2894
400 Ga0395898_0161307 3300037466 Bacteria 2144
401 Ga0395901_0000767 3300038443 Bacteria 35998
402 Ga0395901_0006931 3300038443 Bacteria 11454
403 Ga0395901_0009703 3300038443 Bacteria 9763
404 Ga0395901_0063271 3300038443 Bacteria 3850
405 Ga0395901_0221705 3300038443 Bacteria 1976
406 Ga0395901_0236221 3300038443 Bacteria 1907
407 Ga0439436_0000019 3300041404 Bacteria 70584
408 Ga0451793_0808167 3300041452 Bacteria 10328
409 Ga0451843_0901753 3300041509 Bacteria 1476
410 Ga0451853_2586392 3300041512 Bacteria 1620
411 Ga0439454_001532 3300042011 Bacteria 2248
412 Ga0450908_000049 3300042184 Bacteria 23852
413 Ga0439459_0008918 3300042438 Bacteria 1725
414 Ga0466969_0008616 3300044656 Bacteria 5409
415 Ga0466982_0000052 3300044672 Bacteria 31957
416 Ga0466965_0000819 3300044683 Bacteria 11733
417 Ga0466965_0165442 3300044683 Bacteria 1161
418 Ga0466966_0002019 3300044684 Bacteria 13167
419 Ga0466966_0002721 3300044684 Bacteria 11603
420 Ga0466966_0153891 3300044684 Bacteria 1401
421 Ga0466966_0201724 3300044684 Bacteria 1203
422 Ga0466961_0000918 3300044693 Bacteria 18234
423 Ga0466961_0004185 3300044693 Bacteria 9015
424 Ga0466961_0014997 3300044693 Bacteria 4975
425 Ga0466961_0026691 3300044693 Bacteria 3713
426 Ga0466963_0036297 3300044694 Bacteria 3214
427 Ga0466963_0066957 3300044694 Bacteria 2410
428 Ga0466963_0093703 3300044694 Bacteria 2048
429 Ga0466964_0006557 3300044706 Bacteria 4341
430 Ga0466971_0002229 3300044719 Bacteria 8203
431 Ga0466971_0011251 3300044719 Bacteria 3919
432 Ga0466971_0021285 3300044719 Bacteria 2886
433 Ga0466968_0012234 3300044735 Bacteria 3353
434 Ga0466970_0001636 3300044765 Bacteria 10779
435 Ga0466970_0014104 3300044765 Bacteria 4098
436 Ga0466970_0087871 3300044765 Bacteria 1686
437 Ga0466970_0156525 3300044765 Bacteria 1259
438 Ga0466957_0028743 3300044842 Bacteria 3311
439 Ga0466957_0180920 3300044842 Bacteria 1377
440 Ga0466959_0000150 3300045049 Bacteria 45744
441 Ga0466959_0003671 3300045049 Bacteria 10120
442 Ga0466959_0040298 3300045049 Bacteria 3451
443 Ga0466959_0079725 3300045049 Bacteria 2360
444 Ga0466958_0003787 3300045836 Bacteria 7895
445 Ga0466958_0017902 3300045836 Bacteria 4105
446 Ga0466958_0068995 3300045836 Bacteria 2162
447 Ga0466967_0148148 3300045976 Bacteria 2191
448 Ga0495617_000448 3300046452 Bacteria 22211
449 Ga0495590_0066795 3300046457 Bacteria 1260
450 Ga0495638_0000090 3300046460 Bacteria 148040
451 Ga0495638_0000252 3300046460 Bacteria 72913
452 Ga0495638_0000361 3300046460 Bacteria 56377
453 Ga0495638_0001484 3300046460 Bacteria 21202
454 Ga0495638_0017975 3300046460 Bacteria 4705
455 Ga0495650_0000092 3300046471 Bacteria 224681
456 Ga0495650_0000218 3300046471 Bacteria 120583
457 Ga0495650_0003523 3300046471 Bacteria 11340
458 Ga0495650_0028891 3300046471 Bacteria 2535
459 Ga0495584_0156912 3300046491 Bacteria 1156
460 Ga0495585_0000024 3300046492 Bacteria 148384
461 Ga0495585_0005782 3300046492 Bacteria 7756
462 Ga0495607_0003628 3300046501 Bacteria 11719
463 Ga0495606_0000849 3300046507 Bacteria 45936
464 Ga0495606_0001041 3300046507 Bacteria 40103
465 Ga0495606_0002605 3300046507 Bacteria 20633
466 Ga0495606_0005569 3300046507 Bacteria 12007
467 Ga0495606_0039287 3300046507 Bacteria 3192
468 Ga0495606_0110348 3300046507 Bacteria 1660
469 Ga0495610_0007613 3300046512 Bacteria 7171
470 Ga0495610_0094600 3300046512 Bacteria 1348
471 Ga0495616_0001751 3300046513 Bacteria 14774
472 Ga0495616_0018489 3300046513 Bacteria 3824
473 Ga0495620_0000425 3300046515 Bacteria 28075
474 Ga0495631_0001411 3300046518 Bacteria 14605
475 Ga0495631_0002167 3300046518 Bacteria 11340
476 Ga0495632_0000005 3300046519 Bacteria 362872
477 Ga0495632_0128063 3300046519 Bacteria 1183
478 Ga0495637_0004441 3300046520 Bacteria 7271
479 Ga0495648_0000485 3300046524 Bacteria 42709
480 Ga0495648_0005027 3300046524 Bacteria 11112
481 Ga0495622_0002354 3300046557 Bacteria 9194
482 Ga0495668_0006807 3300046616 Bacteria 7423
483 Ga0495668_0056694 3300046616 Bacteria 2162
484 Ga0495611_0000005 3300046648 Bacteria 284271
485 Ga0495611_0000819 3300046648 Bacteria 17191
486 Ga0495625_0001159 3300046660 Bacteria 33975
487 Ga0495625_0015957 3300046660 Bacteria 5924
488 Ga0495625_0077431 3300046660 Bacteria 2323
489 Ga0495625_0113941 3300046660 Bacteria 1846
490 Ga0495661_0001221 3300046665 Bacteria 22306
491 Ga0495670_0002168 3300046691 Bacteria 9711
492 Ga0495670_0004383 3300046691 Bacteria 6921
493 Ga0495670_0027584 3300046691 Bacteria 2814
494 Ga0495589_0000389 3300046794 Bacteria 33643
495 Ga0495660_0000237 3300046810 Bacteria 53903
496 Ga0495660_0006009 3300046810 Bacteria 7218
497 Ga0495683_0003205 3300047323 Bacteria 9563
498 Ga0495679_000382 3300047446 Bacteria 33973
499 Ga0495673_0000038 3300047469 Bacteria 303785
500 Ga0495673_0000685 3300047469 Bacteria 33195
501 Ga0495673_0002075 3300047469 Bacteria 14634
502 Ga0495686_0000050 3300047472 Bacteria 269010
503 Ga0495686_0001912 3300047472 Bacteria 20797
504 Ga0495686_0035918 3300047472 Bacteria 3181
505 Ga0496100_0001269 3300048903 Bacteria 12326
506 Ga0496101_0004978 3300048904 Bacteria 8437
507 Ga0496104_0030897 3300048907 Bacteria 4980
508 Ga0496105_0004975 3300048908 Bacteria 10051
509 Ga0496106_0000786 3300048909 Bacteria 22916
510 Ga0496113_0003396 3300048916 Bacteria 9525
511 Ga0496115_0000427 3300048918 Bacteria 34248
512 Ga0496115_0000644 3300048918 Bacteria 26233
513 Ga0496115_0006005 3300048918 Bacteria 8865
514 Ga0496115_0019782 3300048918 Bacteria 5185
515 Ga0496115_0023794 3300048918 Bacteria 4756
516 Ga0496117_0007752 3300048920 Bacteria 10370
517 Ga0496117_0009380 3300048920 Bacteria 9112
518 Ga0496117_0020494 3300048920 Bacteria 5386
519 Ga0496117_0024071 3300048920 Bacteria 4829
520 Ga0496118_0004444 3300048921 Bacteria 16635
521 Ga0496118_0004962 3300048921 Bacteria 15395
522 Ga0496118_0005405 3300048921 Bacteria 14533
523 Ga0496118_0010204 3300048921 Bacteria 9325
524 Ga0496118_0169965 3300048921 Bacteria 1333
525 Ga0496119_0000725 3300048922 Bacteria 44399
526 Ga0496119_0011971 3300048922 Bacteria 7107
527 Ga0496120_0000821 3300048923 Bacteria 44390
528 Ga0496120_0001981 3300048923 Bacteria 22316
529 Ga0496121_0001206 3300048924 Bacteria 45212
530 Ga0496121_0005512 3300048924 Bacteria 16170
531 Ga0496121_0012211 3300048924 Bacteria 9411
532 Ga0496121_0015979 3300048924 Bacteria 7786
533 Ga0496121_0108398 3300048924 Bacteria 2124
534 Ga0496122_0008212 3300048925 Bacteria 11341
535 Ga0496122_0011683 3300048925 Bacteria 8850
536 Ga0496122_0043651 3300048925 Bacteria 3510
537 Ga0496123_0009105 3300048926 Bacteria 8987
538 Ga0496123_0009315 3300048926 Bacteria 8860
539 Ga0496123_0181123 3300048926 Bacteria 1100
540 Ga0496124_0001429 3300048927 Bacteria 35321
541 Ga0496124_0055119 3300048927 Bacteria 3362
542 Ga0496125_0002690 3300048928 Bacteria 22625
543 Ga0496125_0250405 3300048928 Bacteria 1118
544 Ga0496126_0005169 3300048929 Bacteria 15088
545 Ga0496126_0006381 3300048929 Bacteria 13157
546 Ga0496126_0011972 3300048929 Bacteria 8916
547 Ga0496126_0047466 3300048929 Bacteria 3931
548 Ga0496126_0047878 3300048929 Bacteria 3912
549 Ga0496126_0205730 3300048929 Bacteria 1659
550 Ga0495678_002592 3300049459 Bacteria 12088
551 Ga0495678_033042 3300049459 Bacteria 2139
552 Ga0495682_0005770 3300049460 Bacteria 5100
553 Ga0495682_0039855 3300049460 Bacteria 1723
554 Ga0501031_0181613 3300049568 Bacteria 1374
555 Ga0501032_0000182 3300049569 Bacteria 51893
556 Ga0501032_0012292 3300049569 Bacteria 6125
557 Ga0501032_0020929 3300049569 Bacteria 4551
558 Ga0501033_0055397 3300049570 Bacteria 2931
559 Ga0501033_0118847 3300049570 Bacteria 1919
560 Ga0501034_0002573 3300049571 Bacteria 21582
561 Ga0501034_0007301 3300049571 Bacteria 11781
562 Ga0501034_0049264 3300049571 Bacteria 4251
563 Ga0501036_0020627 3300049572 Bacteria 5536
564 Ga0501037_0002007 3300049573 Bacteria 14733
565 Ga0501037_0015831 3300049573 Bacteria 5551
566 Ga0501037_0028747 3300049573 Bacteria 4107
567 Ga0501037_0162569 3300049573 Bacteria 1591
568 Ga0501038_0000672 3300049574 Bacteria 30464
569 Ga0501038_0080203 3300049574 Bacteria 2751
570 Ga0501039_0056838 3300049575 Bacteria 3031
571 Ga0501042_0125710 3300049578 Bacteria 1846
572 Ga0501043_0005767 3300049579 Bacteria 9973
573 Ga0501043_0017632 3300049579 Bacteria 5599
574 Ga0501043_0026804 3300049579 Bacteria 4522
575 Ga0501043_0072785 3300049579 Bacteria 2699
576 Ga0501043_0550011 3300049579 Bacteria 857
577 Ga0501046_0002020 3300049580 Bacteria 19263
578 Ga0501046_0010346 3300049580 Bacteria 8018
579 Ga0501046_0032789 3300049580 Bacteria 4202
580 Ga0501047_0001223 3300049581 Bacteria 25482
581 Ga0501047_0001404 3300049581 Bacteria 23604
582 Ga0501047_0003195 3300049581 Bacteria 15539
583 Ga0501047_0069157 3300049581 Bacteria 3400
584 Ga0501048_0047634 3300049582 Bacteria 3058
585 Ga0501069_0003670 3300049585 Bacteria 7901
586 Ga0501069_0077664 3300049585 Bacteria 1867
587 Ga0501070_0008982 3300049586 Bacteria 8454
588 Ga0501070_0034926 3300049586 Bacteria 4202
589 Ga0501070_0040778 3300049586 Bacteria 3871
590 Ga0501070_0104097 3300049586 Bacteria 2347
591 Ga0501071_0218503 3300049587 Bacteria 1434
592 Ga0501073_0000312 3300049589 Bacteria 32213
593 Ga0501073_0000426 3300049589 Bacteria 28851
594 Ga0501074_0000594 3300049590 Bacteria 22480
595 Ga0501079_0123705 3300049741 Bacteria 2012
596 Ga0501080_0006171 3300049742 Bacteria 10755
597 Ga0501080_0012648 3300049742 Bacteria 7740
598 Ga0501080_0031157 3300049742 Bacteria 4969
599 Ga0501035_0002325 3300049822 Bacteria 18738
600 Ga0501035_0071715 3300049822 Bacteria 3066
601 Ga0501035_0097206 3300049822 Bacteria 2586
602 Ga0501035_0110059 3300049822 Bacteria 2414
603 Ga0501044_0002778 3300049823 Bacteria 19937
604 Ga0501044_0003174 3300049823 Bacteria 18560
605 Ga0501044_0012333 3300049823 Bacteria 9252
606 Ga0501044_0038344 3300049823 Bacteria 5004
607 Ga0501044_0051333 3300049823 Bacteria 4252
608 Ga0501044_0378752 3300049823 Bacteria 1330
609 nmdc:mga0sz30_11551_c1 3300050516 Bacteria 3413
610 Ga0500643_000378 3300053087 Bacteria 34748
611 Ga0500651_0002524 3300053093 Bacteria 9698
612 Ga0500555_000348 3300053103 Bacteria 19581
613 Ga0500645_001206 3300053730 Bacteria 13727
614 Ga0466962_0000743 3300061719 Bacteria 14631
615 Ga0466962_0003083 3300061719 Bacteria 7932

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0104097 Ga0501070_0104097_1441_2280 266
2 3300013104 Ga0157370_10003026 Ga0157370_1000302613 274
3 3300049579 Ga0501043_0550011 Ga0501043_0550011_19_846 274
4 3300005841 Ga0068863_100288849 Ga0068863_1002888492 277
5 3300025924 Ga0207694_10006156 Ga0207694_100061565 277
6 3300026088 Ga0207641_10191250 Ga0207641_101912502 277
7 3300026118 Ga0207675_100034792 Ga0207675_1000347924 279
8 3300005614 Ga0068856_100041344 Ga0068856_1000413442 280
9 3300025228 Ga0209672_100077 Ga0209672_100077119 280
10 3300025231 Ga0207427_100031 Ga0207427_100031268 280
11 3300025233 Ga0209437_100061 Ga0209437_10006137 280
12 3300025242 Ga0209258_100097 Ga0209258_10009732 280
13 3300025242 Ga0209258_100514 Ga0209258_10051428 280
14 3300025246 Ga0209646_1001170 Ga0209646_10011703 280
15 3300025250 Ga0209026_1000337 Ga0209026_100033726 280
16 3300025254 Ga0209148_1000063 Ga0209148_100006332 280
17 3300025256 Ga0209759_1000176 Ga0209759_100017680 280
18 3300025261 Ga0209233_1000076 Ga0209233_1000076268 280
19 3300025272 Ga0209455_1000096 Ga0209455_100009632 280
20 3300026078 Ga0207702_10001573 Ga0207702_1000157319 280
21 3300037312 Ga0395899_0000410 Ga0395899_0000410_38296_39141 280
22 3300037312 Ga0395899_0057995 Ga0395899_0057995_1447_2292 280
23 3300037466 Ga0395898_0000013 Ga0395898_0000013_422856_423701 280
24 3300037466 Ga0395898_0000120 Ga0395898_0000120_169951_170796 280
25 3300044683 Ga0466965_0000819 Ga0466965_0000819_7104_7949 280
26 3300044683 Ga0466965_0165442 Ga0466965_0165442_273_1118 280
27 3300044684 Ga0466966_0002019 Ga0466966_0002019_6550_7395 280
28 3300044693 Ga0466961_0004185 Ga0466961_0004185_2827_3672 280
29 3300044693 Ga0466961_0014997 Ga0466961_0014997_2843_3688 280
30 3300044694 Ga0466963_0093703 Ga0466963_0093703_600_1445 280
31 3300044706 Ga0466964_0006557 Ga0466964_0006557_1121_1966 280
32 3300044719 Ga0466971_0011251 Ga0466971_0011251_203_1048 280
33 3300044719 Ga0466971_0021285 Ga0466971_0021285_336_1181 280
34 3300044765 Ga0466970_0001636 Ga0466970_0001636_7110_7955 280
35 3300044765 Ga0466970_0014104 Ga0466970_0014104_1356_2201 280
36 3300044842 Ga0466957_0028743 Ga0466957_0028743_2009_2854 280
37 3300045049 Ga0466959_0000150 Ga0466959_0000150_24558_25403 280
38 3300045049 Ga0466959_0003671 Ga0466959_0003671_5110_5955 280
39 3300045049 Ga0466959_0079725 Ga0466959_0079725_818_1663 280
40 3300045836 Ga0466958_0003787 Ga0466958_0003787_2566_3411 280
41 3300045976 Ga0466967_0148148 Ga0466967_0148148_1305_2150 280
42 3300061719 Ga0466962_0003083 Ga0466962_0003083_4647_5492 280
43 3300005843 Ga0068860_100013356 Ga0068860_1000133563 281
44 3300025231 Ga0207427_104453 Ga0207427_1044532 281
45 3300025233 Ga0209437_100385 Ga0209437_1003859 281
46 3300025254 Ga0209148_1000055 Ga0209148_1000055305 281
47 3300026116 Ga0207674_10267874 Ga0207674_102678742 281
48 3300028381 Ga0268264_10075559 Ga0268264_100755592 281
49 3300037312 Ga0395899_0069963 Ga0395899_0069963_1395_2246 282
50 3300037418 Ga0395900_0001137 Ga0395900_0001137_6812_7663 282
51 3300038443 Ga0395901_0000767 Ga0395901_0000767_17821_18672 282
52 3300049585 Ga0501069_0077664 Ga0501069_0077664_820_1776 282
53 3300049742 Ga0501080_0012648 Ga0501080_0012648_1212_2168 282
54 3300010375 Ga0105239_10021782 Ga0105239_100217822 283
55 3300025228 Ga0209672_102380 Ga0209672_1023803 283
56 3300025903 Ga0207680_10000001 Ga0207680_10000001751 283
57 3300025909 Ga0207705_10113516 Ga0207705_101135162 283
58 3300025920 Ga0207649_10057251 Ga0207649_100572511 283
59 3300025924 Ga0207694_10000322 Ga0207694_1000032218 283
60 3300028379 Ga0268266_10000148 Ga0268266_1000014851 283
61 3300045836 Ga0466958_0068995 Ga0466958_0068995_64_918 283
62 3300046460 Ga0495638_0000361 Ga0495638_0000361_32555_33481 283
63 3300046507 Ga0495606_0000849 Ga0495606_0000849_30756_31691 283
64 3300046507 Ga0495606_0002605 Ga0495606_0002605_8384_9238 283
65 3300046557 Ga0495622_0002354 Ga0495622_0002354_5207_6133 283
66 3300046660 Ga0495625_0015957 Ga0495625_0015957_3433_4359 283
67 3300046660 Ga0495625_0113941 Ga0495625_0113941_727_1662 283
68 3300047472 Ga0495686_0035918 Ga0495686_0035918_2283_3137 283
69 3300048918 Ga0496115_0000644 Ga0496115_0000644_22342_23277 283
70 3300048918 Ga0496115_0023794 Ga0496115_0023794_3802_4728 283
71 3300048929 Ga0496126_0047466 Ga0496126_0047466_2348_3283 283
72 3300048929 Ga0496126_0205730 Ga0496126_0205730_588_1523 283
73 3300049459 Ga0495678_033042 Ga0495678_033042_494_1429 283
74 3300049571 Ga0501034_0049264 Ga0501034_0049264_3215_4081 283
75 3300049578 Ga0501042_0125710 Ga0501042_0125710_402_1268 283
76 3300049579 Ga0501043_0072785 Ga0501043_0072785_973_1839 283
77 3300049580 Ga0501046_0032789 Ga0501046_0032789_3236_4102 283
78 3300049582 Ga0501048_0047634 Ga0501048_0047634_143_1009 283
79 3300049742 Ga0501080_0031157 Ga0501080_0031157_29_895 283
80 3300002737 JGI25162J39368_1007020 JGI25162J39368_10070202 284
81 3300003762 Ga0055542_1000283 Ga0055542_100028319 284
82 3300025250 Ga0209026_1001327 Ga0209026_10013275 284
83 3300002705 JGI25156J39149_1003556 JGI25156J39149_10035563 285
84 3300002737 JGI25162J39368_1000239 JGI25162J39368_100023930 285
85 3300002741 JGI25157J39369_1000293 JGI25157J39369_100029326 285
86 3300002771 JGI25163J39215_1000359 JGI25163J39215_10003596 285
87 3300002772 JGI25164J39214_1000200 JGI25164J39214_100020023 285
88 3300003214 JGI25165J46597_1000319 JGI25165J46597_100031930 285
89 3300003751 Ga0055538_1000686 Ga0055538_100068610 285
90 3300003761 Ga0055535_1000242 Ga0055535_100024230 285
91 3300003762 Ga0055542_1000298 Ga0055542_100029822 285
92 3300003763 Ga0055529_1000437 Ga0055529_100043730 285
93 3300025207 Ga0209760_102767 Ga0209760_1027672 285
94 3300025224 Ga0209784_100163 Ga0209784_10016325 285
95 3300025231 Ga0207427_100196 Ga0207427_10019625 285
96 3300025233 Ga0209437_100345 Ga0209437_10034527 285
97 3300025242 Ga0209258_100384 Ga0209258_10038430 285
98 3300025246 Ga0209646_1000643 Ga0209646_100064311 285
99 3300025250 Ga0209026_1000286 Ga0209026_100028625 285
100 3300025254 Ga0209148_1000047 Ga0209148_100004730 285
101 3300025256 Ga0209759_1000651 Ga0209759_100065122 285
102 3300025256 Ga0209759_1001247 Ga0209759_10012477 285
103 3300025261 Ga0209233_1000100 Ga0209233_1000100240 285
104 3300025272 Ga0209455_1000270 Ga0209455_100027025 285
105 3300013102 Ga0157371_10003280 Ga0157371_100032803 286
106 3300013105 Ga0157369_10490634 Ga0157369_104906341 286
107 3300025258 Ga0209129_1000331 Ga0209129_100033125 286
108 3300025912 Ga0207707_10000191 Ga0207707_1000019126 286
109 3300005458 Ga0070681_10037437 Ga0070681_100374372 288
110 3300005539 Ga0068853_100003442 Ga0068853_10000344211 288
111 3300005546 Ga0070696_100004863 Ga0070696_1000048638 288
112 3300005563 Ga0068855_100105254 Ga0068855_1001052542 288
113 3300005577 Ga0068857_100215524 Ga0068857_1002155242 288
114 3300010375 Ga0105239_10026086 Ga0105239_100260863 288
115 3300025912 Ga0207707_10036458 Ga0207707_100364584 288
116 3300025921 Ga0207652_10209810 Ga0207652_102098102 288
117 3300025949 Ga0207667_10054904 Ga0207667_100549043 288
118 3300026041 Ga0207639_10001739 Ga0207639_1000173912 288
119 3300026116 Ga0207674_10230168 Ga0207674_102301682 288
120 3300049569 Ga0501032_0000182 Ga0501032_0000182_6395_7402 288
121 3300049570 Ga0501033_0118847 Ga0501033_0118847_326_1333 288
122 3300049571 Ga0501034_0002573 Ga0501034_0002573_19262_20269 288
123 3300049573 Ga0501037_0002007 Ga0501037_0002007_9013_10020 288
124 3300049574 Ga0501038_0000672 Ga0501038_0000672_12692_13699 288
125 3300049575 Ga0501039_0056838 Ga0501039_0056838_601_1608 288
126 3300049579 Ga0501043_0005767 Ga0501043_0005767_326_1333 288
127 3300049580 Ga0501046_0002020 Ga0501046_0002020_8908_9915 288
128 3300049581 Ga0501047_0003195 Ga0501047_0003195_746_1753 288
129 3300049589 Ga0501073_0000426 Ga0501073_0000426_496_1503 288
130 3300049822 Ga0501035_0002325 Ga0501035_0002325_6395_7402 288
131 3300049823 Ga0501044_0003174 Ga0501044_0003174_4613_5620 288
132 3300005337 Ga0070682_100005233 Ga0070682_1000052334 289
133 3300005366 Ga0070659_100006429 Ga0070659_1000064296 289
134 3300005366 Ga0070659_100072464 Ga0070659_1000724642 289
135 3300005539 Ga0068853_100005385 Ga0068853_1000053857 289
136 3300005539 Ga0068853_100168819 Ga0068853_1001688192 289
137 3300005563 Ga0068855_100014533 Ga0068855_1000145333 289
138 3300005563 Ga0068855_100439241 Ga0068855_1004392411 289
139 3300005577 Ga0068857_100087956 Ga0068857_1000879562 289
140 3300005614 Ga0068856_100423367 Ga0068856_1004233672 289
141 3300009551 Ga0105238_10002416 Ga0105238_1000241612 289
142 3300013100 Ga0157373_10000805 Ga0157373_1000080510 289
143 3300013307 Ga0157372_10002093 Ga0157372_1000209312 289
144 3300025226 Ga0209674_100924 Ga0209674_1009245 289
145 3300025909 Ga0207705_10105711 Ga0207705_101057112 289
146 3300025909 Ga0207705_10326292 Ga0207705_103262921 289
147 3300025913 Ga0207695_10038912 Ga0207695_100389124 289
148 3300025919 Ga0207657_10138459 Ga0207657_101384592 289
149 3300025920 Ga0207649_10140811 Ga0207649_101408111 289
150 3300025924 Ga0207694_10017993 Ga0207694_100179932 289
151 3300025932 Ga0207690_10073456 Ga0207690_100734562 289
152 3300025949 Ga0207667_10007055 Ga0207667_100070553 289
153 3300026041 Ga0207639_10015247 Ga0207639_100152474 289
154 3300026041 Ga0207639_10017700 Ga0207639_100177002 289
155 3300026041 Ga0207639_10032518 Ga0207639_100325183 289
156 3300026116 Ga0207674_10130368 Ga0207674_101303682 289
157 3300005339 Ga0070660_100014288 Ga0070660_1000142882 290
158 3300005366 Ga0070659_100076267 Ga0070659_1000762673 290
159 3300005435 Ga0070714_100000930 Ga0070714_10000093014 290
160 3300005458 Ga0070681_10032143 Ga0070681_100321432 290
161 3300005546 Ga0070696_100000357 Ga0070696_10000035714 290
162 3300013100 Ga0157373_10084130 Ga0157373_100841302 290
163 3300015261 Ga0182006_1007188 Ga0182006_10071884 290
164 3300015262 Ga0182007_10012867 Ga0182007_100128672 290
165 3300025898 Ga0207692_10019978 Ga0207692_100199782 290
166 3300025912 Ga0207707_10003336 Ga0207707_100033362 290
167 3300025917 Ga0207660_10018262 Ga0207660_100182623 290
168 3300025929 Ga0207664_10000403 Ga0207664_1000040314 290
169 3300025932 Ga0207690_10011392 Ga0207690_100113923 290
170 3300026116 Ga0207674_10069528 Ga0207674_100695281 290
171 3300009545 Ga0105237_10718797 Ga0105237_107187971 291
172 3300013100 Ga0157373_10124667 Ga0157373_101246672 291
173 3300005345 Ga0070692_10014711 Ga0070692_100147114 292
174 3300005614 Ga0068856_100295055 Ga0068856_1002950551 292
175 3300005616 Ga0068852_100024221 Ga0068852_1000242215 292
176 3300013102 Ga0157371_10020161 Ga0157371_100201615 292
177 3300020082 Ga0206353_10313916 Ga0206353_103139162 292
178 3300025909 Ga0207705_10011495 Ga0207705_100114956 292
179 3300025913 Ga0207695_10010285 Ga0207695_100102855 292
180 3300025917 Ga0207660_10007280 Ga0207660_100072806 292
181 3300025919 Ga0207657_10070370 Ga0207657_100703702 292
182 3300025921 Ga0207652_10011131 Ga0207652_100111317 292
183 3300025949 Ga0207667_10002262 Ga0207667_1000226213 292
184 3300026041 Ga0207639_10007916 Ga0207639_100079167 292
185 3300026067 Ga0207678_10263048 Ga0207678_102630481 292
186 3300046519 Ga0495632_0000005 Ga0495632_0000005_332794_333678 293
187 3300048918 Ga0496115_0019782 Ga0496115_0019782_117_1043 294
188 3300048928 Ga0496125_0250405 Ga0496125_0250405_148_1074 294
189 3300049569 Ga0501032_0020929 Ga0501032_0020929_2319_3206 294
190 3300037418 Ga0395900_0000206 Ga0395900_0000206_53296_54186 295
191 3300005365 Ga0070688_100008301 Ga0070688_1000083012 296
192 3300005466 Ga0070685_10067640 Ga0070685_100676402 296
193 3300037418 Ga0395900_0039144 Ga0395900_0039144_2113_3030 297
194 3300038443 Ga0395901_0221705 Ga0395901_0221705_607_1524 297
195 3300005340 Ga0070689_100056467 Ga0070689_1000564672 298
196 3300005344 Ga0070661_100014581 Ga0070661_1000145814 298
197 3300005455 Ga0070663_100067146 Ga0070663_1000671463 298
198 3300025920 Ga0207649_10054906 Ga0207649_100549061 298
199 3300026067 Ga0207678_10083549 Ga0207678_100835492 298
200 3300046460 Ga0495638_0001484 Ga0495638_0001484_1569_2504 298
201 3300046471 Ga0495650_0000092 Ga0495650_0000092_3348_4283 298
202 3300005337 Ga0070682_100000784 Ga0070682_1000007844 299
203 3300005458 Ga0070681_10166203 Ga0070681_101662032 299
204 3300005457 Ga0070662_100184699 Ga0070662_1001846992 300
205 3300009093 Ga0105240_10126228 Ga0105240_101262282 300
206 3300025933 Ga0207706_10217562 Ga0207706_102175622 300
207 3300049589 Ga0501073_0000312 Ga0501073_0000312_2001_2960 300
208 iso_pu_bacteria 2687453130 2687581677 300
209 iso_pu_bacteria 2818991440 2819565098 300
210 iso_pu_bacteria 2842914999 2842917010 300
211 iso_pu_bacteria 2884338543 2884342240 300
212 iso_pu_bacteria 2884411467 2884411809 300
213 iso_pu_bacteria 2895395659 2895398341 300
214 iso_pu_bacteria 2904463128 2904465375 300
215 iso_pu_bacteria 2919085039 2919087912 300
216 iso_pu_bacteria 2928963466 2928966657 300
217 3300005336 Ga0070680_100107682 Ga0070680_1001076822 301
218 3300005458 Ga0070681_10256017 Ga0070681_102560172 301
219 3300005530 Ga0070679_100132542 Ga0070679_1001325422 301
220 3300005546 Ga0070696_100092988 Ga0070696_1000929882 301
221 3300013104 Ga0157370_10017280 Ga0157370_100172802 301
222 3300013307 Ga0157372_10208479 Ga0157372_102084792 301
223 3300025921 Ga0207652_10158209 Ga0207652_101582092 301
224 3300037418 Ga0395900_0015796 Ga0395900_0015796_821_1735 301
225 iso_pu_bacteria 2643221577 2643896360 301
226 iso_pu_bacteria 2643221685 2644478879 301
227 iso_pu_bacteria 2739367700 2739733676 301
228 3300001989 JGI24739J22299_10043324 JGI24739J22299_100433242 302
229 3300013307 Ga0157372_10092723 Ga0157372_100927233 302
230 3300015685 Ga0183369_1011 Ga0183369_101133 302
231 3300015687 Ga0183368_1007 Ga0183368_100737 302
232 3300025226 Ga0209674_100037 Ga0209674_100037325 302
233 3300025904 Ga0207647_10001536 Ga0207647_1000153615 302
234 3300037312 Ga0395899_0026012 Ga0395899_0026012_593_1513 302
235 3300037312 Ga0395899_0043225 Ga0395899_0043225_240_1157 302
236 3300037418 Ga0395900_0004679 Ga0395900_0004679_12237_13154 302
237 3300037418 Ga0395900_0165780 Ga0395900_0165780_1016_1933 302
238 3300037418 Ga0395900_0170694 Ga0395900_0170694_601_1530 302
239 3300037466 Ga0395898_0161307 Ga0395898_0161307_173_1090 302
240 3300038443 Ga0395901_0009703 Ga0395901_0009703_1332_2261 302
241 3300038443 Ga0395901_0236221 Ga0395901_0236221_537_1454 302
242 3300044694 Ga0466963_0036297 Ga0466963_0036297_171_1091 302
243 3300048916 Ga0496113_0003396 Ga0496113_0003396_5472_6389 302
244 3300048918 Ga0496115_0000427 Ga0496115_0000427_4964_5881 302
245 3300049569 Ga0501032_0012292 Ga0501032_0012292_70_990 302
246 3300049570 Ga0501033_0055397 Ga0501033_0055397_230_1150 302
247 3300049572 Ga0501036_0020627 Ga0501036_0020627_3708_4628 302
248 3300049573 Ga0501037_0162569 Ga0501037_0162569_247_1167 302
249 3300049574 Ga0501038_0080203 Ga0501038_0080203_1723_2652 302
250 3300049579 Ga0501043_0017632 Ga0501043_0017632_346_1266 302
251 3300049581 Ga0501047_0001223 Ga0501047_0001223_11611_12531 302
252 3300049581 Ga0501047_0069157 Ga0501047_0069157_1736_2665 302
253 3300049586 Ga0501070_0034926 Ga0501070_0034926_191_1111 302
254 3300049822 Ga0501035_0097206 Ga0501035_0097206_445_1365 302
255 3300049823 Ga0501044_0051333 Ga0501044_0051333_2312_3232 302
256 3300049823 Ga0501044_0378752 Ga0501044_0378752_244_1167 302
257 iso_pu_bacteria 2593339238 2595448992 302
258 iso_pu_bacteria 2593339239 2595452850 302
259 iso_pu_bacteria 2718218334 2721029056 302
260 iso_pu_bacteria 2734482264 2735835364 302
261 iso_pu_bacteria 2738543009 2739229522 302
262 iso_pu_bacteria 2842918807 2842922519 302
263 iso_pu_bacteria 2919404418 2919407883 302
264 iso_pu_bacteria 2941471342 2941474701 302
265 iso_pu_bacteria 2953994433 2953996978 302
266 3300003578 Ga0006562J51391_1100886 Ga0006562J51391_11008862 303
267 3300005262 Ga0065165_1000887 Ga0065165_100088714 303
268 3300005344 Ga0070661_100021235 Ga0070661_1000212353 303
269 3300005458 Ga0070681_10000680 Ga0070681_100006809 303
270 3300005530 Ga0070679_100007899 Ga0070679_1000078999 303
271 3300009101 Ga0105247_10005430 Ga0105247_100054306 303
272 3300009551 Ga0105238_10041722 Ga0105238_100417225 303
273 3300013104 Ga0157370_10011839 Ga0157370_100118395 303
274 3300013105 Ga0157369_10001681 Ga0157369_1000168112 303
275 3300014497 Ga0182008_10003482 Ga0182008_100034827 303
276 3300014497 Ga0182008_10027917 Ga0182008_100279172 303
277 3300015261 Ga0182006_1000082 Ga0182006_10000822 303
278 3300015261 Ga0182006_1000319 Ga0182006_100031913 303
279 3300015265 Ga0182005_1000015 Ga0182005_100001519 303
280 3300015265 Ga0182005_1007876 Ga0182005_10078763 303
281 3300025233 Ga0209437_100685 Ga0209437_10068511 303
282 3300025254 Ga0209148_1001587 Ga0209148_10015873 303
283 3300025299 Ga0209256_1014451 Ga0209256_10144512 303
284 3300025904 Ga0207647_10000130 Ga0207647_1000013041 303
285 3300025912 Ga0207707_10000930 Ga0207707_1000093015 303
286 3300025917 Ga0207660_10003239 Ga0207660_1000323910 303
287 3300025921 Ga0207652_10000855 Ga0207652_1000085515 303
288 3300025924 Ga0207694_10046351 Ga0207694_100463514 303
289 3300031731 Ga0307405_10291375 Ga0307405_102913751 303
290 3300031911 Ga0307412_10001046 Ga0307412_1000104613 303
291 3300041404 Ga0439436_0000019 Ga0439436_0000019_29795_30712 303
292 3300041452 Ga0451793_0808167 Ga0451793_0808167_605_1519 303
293 3300041512 Ga0451853_2586392 Ga0451853_2586392_230_1147 303
294 3300042011 Ga0439454_001532 Ga0439454_001532_547_1464 303
295 3300042184 Ga0450908_000049 Ga0450908_000049_20471_21388 303
296 3300042438 Ga0439459_0008918 Ga0439459_0008918_27_941 303
297 3300044672 Ga0466982_0000052 Ga0466982_0000052_8377_9294 303
298 3300044842 Ga0466957_0180920 Ga0466957_0180920_276_1193 303
299 3300046452 Ga0495617_000448 Ga0495617_000448_9252_10169 303
300 3300046457 Ga0495590_0066795 Ga0495590_0066795_83_1000 303
301 3300046460 Ga0495638_0000090 Ga0495638_0000090_6126_7040 303
302 3300046460 Ga0495638_0000252 Ga0495638_0000252_27990_28907 303
303 3300046460 Ga0495638_0017975 Ga0495638_0017975_1532_2449 303
304 3300046471 Ga0495650_0003523 Ga0495650_0003523_4679_5596 303
305 3300046471 Ga0495650_0028891 Ga0495650_0028891_931_1848 303
306 3300046491 Ga0495584_0156912 Ga0495584_0156912_191_1108 303
307 3300046492 Ga0495585_0000024 Ga0495585_0000024_118946_119863 303
308 3300046492 Ga0495585_0005782 Ga0495585_0005782_1591_2508 303
309 3300046501 Ga0495607_0003628 Ga0495607_0003628_6066_6983 303
310 3300046507 Ga0495606_0001041 Ga0495606_0001041_150_1067 303
311 3300046507 Ga0495606_0005569 Ga0495606_0005569_3891_4808 303
312 3300046507 Ga0495606_0110348 Ga0495606_0110348_627_1544 303
313 3300046512 Ga0495610_0007613 Ga0495610_0007613_3827_4744 303
314 3300046512 Ga0495610_0094600 Ga0495610_0094600_394_1311 303
315 3300046513 Ga0495616_0001751 Ga0495616_0001751_1550_2467 303
316 3300046513 Ga0495616_0018489 Ga0495616_0018489_1128_2045 303
317 3300046515 Ga0495620_0000425 Ga0495620_0000425_8916_9833 303
318 3300046518 Ga0495631_0001411 Ga0495631_0001411_1440_2357 303
319 3300046518 Ga0495631_0002167 Ga0495631_0002167_4572_5489 303
320 3300046519 Ga0495632_0128063 Ga0495632_0128063_185_1102 303
321 3300046520 Ga0495637_0004441 Ga0495637_0004441_163_1080 303
322 3300046524 Ga0495648_0000485 Ga0495648_0000485_28410_29327 303
323 3300046524 Ga0495648_0005027 Ga0495648_0005027_4688_5605 303
324 3300046616 Ga0495668_0006807 Ga0495668_0006807_4793_5710 303
325 3300046616 Ga0495668_0056694 Ga0495668_0056694_133_1050 303
326 3300046648 Ga0495611_0000005 Ga0495611_0000005_255279_256196 303
327 3300046648 Ga0495611_0000819 Ga0495611_0000819_14208_15125 303
328 3300046660 Ga0495625_0001159 Ga0495625_0001159_27990_28907 303
329 3300046660 Ga0495625_0077431 Ga0495625_0077431_978_1895 303
330 3300046665 Ga0495661_0001221 Ga0495661_0001221_19664_20581 303
331 3300046691 Ga0495670_0002168 Ga0495670_0002168_2327_3244 303
332 3300046691 Ga0495670_0004383 Ga0495670_0004383_1408_2325 303
333 3300046691 Ga0495670_0027584 Ga0495670_0027584_160_1077 303
334 3300046794 Ga0495589_0000389 Ga0495589_0000389_27990_28907 303
335 3300046810 Ga0495660_0000237 Ga0495660_0000237_50746_51663 303
336 3300046810 Ga0495660_0006009 Ga0495660_0006009_4748_5665 303
337 3300047323 Ga0495683_0003205 Ga0495683_0003205_6894_7811 303
338 3300047446 Ga0495679_000382 Ga0495679_000382_5067_5984 303
339 3300047469 Ga0495673_0000038 Ga0495673_0000038_33895_34812 303
340 3300047469 Ga0495673_0000685 Ga0495673_0000685_4116_5033 303
341 3300047469 Ga0495673_0002075 Ga0495673_0002075_8981_9898 303
342 3300047472 Ga0495686_0000050 Ga0495686_0000050_31006_31923 303
343 3300047472 Ga0495686_0001912 Ga0495686_0001912_11001_11918 303
344 3300048903 Ga0496100_0001269 Ga0496100_0001269_3012_3929 303
345 3300048904 Ga0496101_0004978 Ga0496101_0004978_1904_2821 303
346 3300048909 Ga0496106_0000786 Ga0496106_0000786_8328_9245 303
347 3300048920 Ga0496117_0007752 Ga0496117_0007752_9188_10105 303
348 3300048920 Ga0496117_0024071 Ga0496117_0024071_1818_2735 303
349 3300048921 Ga0496118_0004444 Ga0496118_0004444_13494_14411 303
350 3300048921 Ga0496118_0004962 Ga0496118_0004962_10170_11087 303
351 3300048921 Ga0496118_0169965 Ga0496118_0169965_353_1270 303
352 3300048922 Ga0496119_0011971 Ga0496119_0011971_2455_3372 303
353 3300048924 Ga0496121_0001206 Ga0496121_0001206_13367_14284 303
354 3300048924 Ga0496121_0005512 Ga0496121_0005512_12313_13230 303
355 3300048924 Ga0496121_0012211 Ga0496121_0012211_1506_2423 303
356 3300048925 Ga0496122_0008212 Ga0496122_0008212_6903_7820 303
357 3300048925 Ga0496122_0011683 Ga0496122_0011683_198_1115 303
358 3300048925 Ga0496122_0043651 Ga0496122_0043651_1723_2640 303
359 3300048926 Ga0496123_0009105 Ga0496123_0009105_4900_5817 303
360 3300048926 Ga0496123_0009315 Ga0496123_0009315_2455_3372 303
361 3300048926 Ga0496123_0181123 Ga0496123_0181123_160_1077 303
362 3300048927 Ga0496124_0001429 Ga0496124_0001429_21958_22875 303
363 3300048927 Ga0496124_0055119 Ga0496124_0055119_2390_3316 303
364 3300048929 Ga0496126_0011972 Ga0496126_0011972_3723_4640 303
365 3300049459 Ga0495678_002592 Ga0495678_002592_6099_7016 303
366 3300049460 Ga0495682_0005770 Ga0495682_0005770_48_965 303
367 3300049460 Ga0495682_0039855 Ga0495682_0039855_759_1676 303
368 3300050516 nmdc:mga0sz30_11551_c1 nmdc:mga0sz30_11551_c1_1550_2467 303
369 3300053087 Ga0500643_000378 Ga0500643_000378_28464_29381 303
370 3300053103 Ga0500555_000348 Ga0500555_000348_14054_14971 303
371 3300053730 Ga0500645_001206 Ga0500645_001206_6774_7691 303
372 3300009553 Ga0105249_10056528 Ga0105249_100565282 304
373 3300025961 Ga0207712_10025875 Ga0207712_100258752 304
374 3300001915 JGI24741J21665_1008106 JGI24741J21665_10081062 305
375 3300001979 JGI24740J21852_10000931 JGI24740J21852_100009318 305
376 3300001990 JGI24737J22298_10000633 JGI24737J22298_100006335 305
377 3300002705 JGI25156J39149_1004170 JGI25156J39149_10041702 305
378 3300002737 JGI25162J39368_1000249 JGI25162J39368_100024932 305
379 3300002737 JGI25162J39368_1002541 JGI25162J39368_10025417 305
380 3300002741 JGI25157J39369_1001205 JGI25157J39369_10012059 305
381 3300002741 JGI25157J39369_1001281 JGI25157J39369_10012817 305
382 3300002741 JGI25157J39369_1002499 JGI25157J39369_10024994 305
383 3300002772 JGI25164J39214_1000004 JGI25164J39214_100000437 305
384 3300002772 JGI25164J39214_1001210 JGI25164J39214_10012107 305
385 3300002772 JGI25164J39214_1001216 JGI25164J39214_10012168 305
386 3300003214 JGI25165J46597_1000110 JGI25165J46597_1000110116 305
387 3300003214 JGI25165J46597_1002182 JGI25165J46597_10021827 305
388 3300003214 JGI25165J46597_1003527 JGI25165J46597_10035273 305
389 3300003215 JGI25153J46596_10026961 JGI25153J46596_100269612 305
390 3300003316 rootH1_10080198 rootH1_100801984 305
391 3300003578 Ga0006562J51391_1003480 Ga0006562J51391_10034809 305
392 3300003578 Ga0006562J51391_1003481 Ga0006562J51391_10034816 305
393 3300003756 Ga0055533_1000886 Ga0055533_10008869 305
394 3300003756 Ga0055533_1003563 Ga0055533_10035633 305
395 3300003760 Ga0055527_1000060 Ga0055527_100006016 305
396 3300003760 Ga0055527_1000158 Ga0055527_10001583 305
397 3300003761 Ga0055535_1000331 Ga0055535_10003313 305
398 3300003761 Ga0055535_1000407 Ga0055535_10004073 305
399 3300003761 Ga0055535_1001855 Ga0055535_10018553 305
400 3300003761 Ga0055535_1001873 Ga0055535_10018733 305
401 3300003762 Ga0055542_1000171 Ga0055542_10001713 305
402 3300003762 Ga0055542_1000358 Ga0055542_100035842 305
403 3300003762 Ga0055542_1001762 Ga0055542_10017626 305
404 3300003762 Ga0055542_1001772 Ga0055542_10017726 305
405 3300003763 Ga0055529_1000384 Ga0055529_100038442 305
406 3300003763 Ga0055529_1000450 Ga0055529_100045033 305
407 3300003763 Ga0055529_1000471 Ga0055529_100047136 305
408 3300005327 Ga0070658_10077157 Ga0070658_100771572 305
409 3300005327 Ga0070658_10242299 Ga0070658_102422991 305
410 3300005335 Ga0070666_10000099 Ga0070666_1000009942 305
411 3300005339 Ga0070660_100156530 Ga0070660_1001565302 305
412 3300005344 Ga0070661_100027314 Ga0070661_1000273143 305
413 3300005345 Ga0070692_10009726 Ga0070692_100097261 305
414 3300005366 Ga0070659_100000789 Ga0070659_1000007898 305
415 3300005366 Ga0070659_100005989 Ga0070659_1000059898 305
416 3300005366 Ga0070659_100217428 Ga0070659_1002174282 305
417 3300005367 Ga0070667_100185108 Ga0070667_1001851082 305
418 3300005435 Ga0070714_100000392 Ga0070714_10000039211 305
419 3300005435 Ga0070714_100008963 Ga0070714_1000089636 305
420 3300005436 Ga0070713_100000391 Ga0070713_1000003913 305
421 3300005455 Ga0070663_100212204 Ga0070663_1002122042 305
422 3300005457 Ga0070662_100115484 Ga0070662_1001154842 305
423 3300005458 Ga0070681_10000500 Ga0070681_100005002 305
424 3300005458 Ga0070681_10186772 Ga0070681_101867722 305
425 3300005539 Ga0068853_100161317 Ga0068853_1001613172 305
426 3300005539 Ga0068853_100173192 Ga0068853_1001731922 305
427 3300005546 Ga0070696_100005209 Ga0070696_1000052096 305
428 3300005547 Ga0070693_100000882 Ga0070693_10000088210 305
429 3300005547 Ga0070693_100040722 Ga0070693_1000407222 305
430 3300005563 Ga0068855_100058198 Ga0068855_1000581982 305
431 3300005563 Ga0068855_100076161 Ga0068855_1000761612 305
432 3300005563 Ga0068855_100475087 Ga0068855_1004750871 305
433 3300005577 Ga0068857_100006695 Ga0068857_1000066954 305
434 3300005578 Ga0068854_100006992 Ga0068854_1000069922 305
435 3300005578 Ga0068854_100017143 Ga0068854_1000171432 305
436 3300005578 Ga0068854_100117109 Ga0068854_1001171092 305
437 3300005614 Ga0068856_100000088 Ga0068856_10000008825 305
438 3300005614 Ga0068856_100015285 Ga0068856_1000152853 305
439 3300005614 Ga0068856_100035641 Ga0068856_1000356412 305
440 3300005616 Ga0068852_100035332 Ga0068852_1000353322 305
441 3300005616 Ga0068852_100092362 Ga0068852_1000923622 305
442 3300005616 Ga0068852_100174291 Ga0068852_1001742912 305
443 3300005842 Ga0068858_100076676 Ga0068858_1000766763 305
444 3300009093 Ga0105240_10003419 Ga0105240_100034194 305
445 3300009093 Ga0105240_10009031 Ga0105240_100090316 305
446 3300009093 Ga0105240_10017579 Ga0105240_100175798 305
447 3300009093 Ga0105240_10164886 Ga0105240_101648862 305
448 3300009093 Ga0105240_10252329 Ga0105240_102523292 305
449 3300009093 Ga0105240_10442638 Ga0105240_104426381 305
450 3300009174 Ga0105241_10024312 Ga0105241_100243124 305
451 3300009545 Ga0105237_10000058 Ga0105237_1000005848 305
452 3300009545 Ga0105237_10000777 Ga0105237_1000077718 305
453 3300009551 Ga0105238_10000428 Ga0105238_1000042810 305
454 3300009551 Ga0105238_10003804 Ga0105238_100038048 305
455 3300009551 Ga0105238_10194465 Ga0105238_101944651 305
456 3300009551 Ga0105238_10198106 Ga0105238_101981062 305
457 3300009551 Ga0105238_10242002 Ga0105238_102420022 305
458 3300009982 Ga0105147_100851 Ga0105147_1008512 305
459 3300010375 Ga0105239_10005406 Ga0105239_100054064 305
460 3300010375 Ga0105239_10110342 Ga0105239_101103422 305
461 3300012500 Ga0157314_1000012 Ga0157314_100001214 305
462 3300013102 Ga0157371_10059103 Ga0157371_100591032 305
463 3300013102 Ga0157371_10147392 Ga0157371_101473922 305
464 3300013104 Ga0157370_10001873 Ga0157370_1000187315 305
465 3300013104 Ga0157370_10031638 Ga0157370_100316384 305
466 3300013104 Ga0157370_10077276 Ga0157370_100772762 305
467 3300013105 Ga0157369_10041370 Ga0157369_100413702 305
468 3300013105 Ga0157369_10100640 Ga0157369_101006403 305
469 3300013105 Ga0157369_10225589 Ga0157369_102255892 305
470 3300013306 Ga0163162_10000848 Ga0163162_1000084815 305
471 3300013307 Ga0157372_10134218 Ga0157372_101342182 305
472 3300013307 Ga0157372_10274815 Ga0157372_102748151 305
473 3300013307 Ga0157372_10428225 Ga0157372_104282252 305
474 3300014497 Ga0182008_10021450 Ga0182008_100214503 305
475 3300015262 Ga0182007_10019921 Ga0182007_100199212 305
476 3300020070 Ga0206356_10344540 Ga0206356_103445403 305
477 3300020070 Ga0206356_10813108 Ga0206356_108131083 305
478 3300020081 Ga0206354_10058580 Ga0206354_100585804 305
479 3300020082 Ga0206353_10367129 Ga0206353_103671294 305
480 3300020082 Ga0206353_10641193 Ga0206353_106411932 305
481 3300020082 Ga0206353_11510336 Ga0206353_115103362 305
482 3300020610 Ga0154015_1113103 Ga0154015_11131032 305
483 3300025226 Ga0209674_100058 Ga0209674_10005836 305
484 3300025226 Ga0209674_100874 Ga0209674_10087410 305
485 3300025228 Ga0209672_100043 Ga0209672_100043200 305
486 3300025228 Ga0209672_100061 Ga0209672_10006136 305
487 3300025230 Ga0209563_100062 Ga0209563_100062191 305
488 3300025231 Ga0207427_100258 Ga0207427_10025840 305
489 3300025231 Ga0207427_100275 Ga0207427_1002752 305
490 3300025233 Ga0209437_100121 Ga0209437_10012130 305
491 3300025233 Ga0209437_100132 Ga0209437_100132122 305
492 3300025242 Ga0209258_100054 Ga0209258_10005436 305
493 3300025242 Ga0209258_100076 Ga0209258_100076200 305
494 3300025242 Ga0209258_100565 Ga0209258_10056521 305
495 3300025246 Ga0209646_1002495 Ga0209646_10024955 305
496 3300025250 Ga0209026_1000119 Ga0209026_100011939 305
497 3300025250 Ga0209026_1000130 Ga0209026_100013014 305
498 3300025250 Ga0209026_1000147 Ga0209026_100014774 305
499 3300025254 Ga0209148_1000066 Ga0209148_100006636 305
500 3300025254 Ga0209148_1000082 Ga0209148_1000082200 305
501 3300025254 Ga0209148_1000611 Ga0209148_100061121 305
502 3300025256 Ga0209759_1000218 Ga0209759_100021816 305
503 3300025256 Ga0209759_1002602 Ga0209759_10026022 305
504 3300025256 Ga0209759_1013168 Ga0209759_10131683 305
505 3300025258 Ga0209129_1011029 Ga0209129_10110292 305
506 3300025261 Ga0209233_1000112 Ga0209233_100011234 305
507 3300025261 Ga0209233_1000114 Ga0209233_1000114175 305
508 3300025272 Ga0209455_1000078 Ga0209455_1000078200 305
509 3300025272 Ga0209455_1000101 Ga0209455_100010136 305
510 3300025272 Ga0209455_1000636 Ga0209455_100063618 305
511 3300025297 Ga0209758_1002347 Ga0209758_10023473 305
512 3300025321 Ga0207656_10016293 Ga0207656_100162932 305
513 3300025904 Ga0207647_10001258 Ga0207647_1000125811 305
514 3300025904 Ga0207647_10022280 Ga0207647_100222804 305
515 3300025909 Ga0207705_10001263 Ga0207705_1000126312 305
516 3300025909 Ga0207705_10015090 Ga0207705_100150905 305
517 3300025909 Ga0207705_10114384 Ga0207705_101143842 305
518 3300025912 Ga0207707_10001518 Ga0207707_1000151814 305
519 3300025913 Ga0207695_10000890 Ga0207695_100008905 305
520 3300025913 Ga0207695_10001815 Ga0207695_1000181527 305
521 3300025913 Ga0207695_10001978 Ga0207695_1000197818 305
522 3300025913 Ga0207695_10003800 Ga0207695_1000380012 305
523 3300025913 Ga0207695_10004750 Ga0207695_1000475018 305
524 3300025913 Ga0207695_10004802 Ga0207695_1000480214 305
525 3300025913 Ga0207695_10011413 Ga0207695_100114134 305
526 3300025913 Ga0207695_10159409 Ga0207695_101594092 305
527 3300025914 Ga0207671_10000026 Ga0207671_10000026202 305
528 3300025914 Ga0207671_10000260 Ga0207671_1000026042 305
529 3300025917 Ga0207660_10001101 Ga0207660_1000110110 305
530 3300025919 Ga0207657_10017066 Ga0207657_100170664 305
531 3300025919 Ga0207657_10026773 Ga0207657_100267732 305
532 3300025919 Ga0207657_10083951 Ga0207657_100839513 305
533 3300025919 Ga0207657_10147890 Ga0207657_101478902 305
534 3300025920 Ga0207649_10000813 Ga0207649_1000081312 305
535 3300025920 Ga0207649_10136054 Ga0207649_101360541 305
536 3300025921 Ga0207652_10000534 Ga0207652_1000053426 305
537 3300025921 Ga0207652_10169616 Ga0207652_101696161 305
538 3300025924 Ga0207694_10006152 Ga0207694_100061524 305
539 3300025924 Ga0207694_10064509 Ga0207694_100645093 305
540 3300025924 Ga0207694_10146315 Ga0207694_101463152 305
541 3300025928 Ga0207700_10118661 Ga0207700_101186612 305
542 3300025929 Ga0207664_10000131 Ga0207664_1000013132 305
543 3300025929 Ga0207664_10184543 Ga0207664_101845432 305
544 3300025932 Ga0207690_10001020 Ga0207690_1000102012 305
545 3300025932 Ga0207690_10001569 Ga0207690_100015693 305
546 3300025932 Ga0207690_10012854 Ga0207690_100128542 305
547 3300025932 Ga0207690_10110973 Ga0207690_101109732 305
548 3300025933 Ga0207706_10151314 Ga0207706_101513141 305
549 3300025944 Ga0207661_10001167 Ga0207661_100011677 305
550 3300025949 Ga0207667_10000228 Ga0207667_1000022814 305
551 3300025949 Ga0207667_10000423 Ga0207667_100004238 305
552 3300025949 Ga0207667_10004840 Ga0207667_1000484011 305
553 3300025949 Ga0207667_10018795 Ga0207667_100187955 305
554 3300025949 Ga0207667_10085920 Ga0207667_100859202 305
555 3300025981 Ga0207640_10001435 Ga0207640_100014358 305
556 3300025981 Ga0207640_10002177 Ga0207640_100021773 305
557 3300025981 Ga0207640_10004571 Ga0207640_100045715 305
558 3300025981 Ga0207640_10006252 Ga0207640_100062524 305
559 3300026035 Ga0207703_10008011 Ga0207703_100080112 305
560 3300026041 Ga0207639_10002168 Ga0207639_100021682 305
561 3300026041 Ga0207639_10146280 Ga0207639_101462802 305
562 3300026067 Ga0207678_10003393 Ga0207678_100033932 305
563 3300026067 Ga0207678_10024316 Ga0207678_100243162 305
564 3300026067 Ga0207678_10153442 Ga0207678_101534421 305
565 3300026067 Ga0207678_10346586 Ga0207678_103465862 305
566 3300026078 Ga0207702_10000649 Ga0207702_1000064931 305
567 3300026078 Ga0207702_10003811 Ga0207702_100038113 305
568 3300026078 Ga0207702_10120326 Ga0207702_101203263 305
569 3300026116 Ga0207674_10000219 Ga0207674_1000021948 305
570 3300026116 Ga0207674_10008157 Ga0207674_100081576 305
571 3300026142 Ga0207698_10001997 Ga0207698_100019972 305
572 3300026142 Ga0207698_10039602 Ga0207698_100396023 305
573 3300026142 Ga0207698_10055048 Ga0207698_100550482 305
574 3300033180 Ga0307510_10000211 Ga0307510_100002115 305
575 3300033180 Ga0307510_10241439 Ga0307510_102414392 305
576 3300037312 Ga0395899_0005527 Ga0395899_0005527_4506_5423 305
577 3300037312 Ga0395899_0030816 Ga0395899_0030816_2775_3710 305
578 3300037418 Ga0395900_0000656 Ga0395900_0000656_27747_28676 305
579 3300037418 Ga0395900_0055819 Ga0395900_0055819_2072_3007 305
580 3300037418 Ga0395900_0056124 Ga0395900_0056124_694_1611 305
581 3300037466 Ga0395898_0093264 Ga0395898_0093264_1089_2006 305
582 3300038443 Ga0395901_0006931 Ga0395901_0006931_8192_9127 305
583 3300038443 Ga0395901_0063271 Ga0395901_0063271_1653_2570 305
584 3300041509 Ga0451843_0901753 Ga0451843_0901753_335_1261 305
585 3300044656 Ga0466969_0008616 Ga0466969_0008616_3002_3928 305
586 3300044684 Ga0466966_0002721 Ga0466966_0002721_4621_5547 305
587 3300044684 Ga0466966_0153891 Ga0466966_0153891_195_1121 305
588 3300044684 Ga0466966_0201724 Ga0466966_0201724_83_1009 305
589 3300044693 Ga0466961_0000918 Ga0466961_0000918_14547_15473 305
590 3300044693 Ga0466961_0026691 Ga0466961_0026691_373_1299 305
591 3300044694 Ga0466963_0066957 Ga0466963_0066957_1034_1960 305
592 3300044719 Ga0466971_0002229 Ga0466971_0002229_904_1830 305
593 3300044735 Ga0466968_0012234 Ga0466968_0012234_297_1223 305
594 3300044765 Ga0466970_0087871 Ga0466970_0087871_655_1581 305
595 3300044765 Ga0466970_0156525 Ga0466970_0156525_303_1229 305
596 3300045049 Ga0466959_0040298 Ga0466959_0040298_1754_2680 305
597 3300045836 Ga0466958_0017902 Ga0466958_0017902_2772_3698 305
598 3300046471 Ga0495650_0000218 Ga0495650_0000218_115219_116145 305
599 3300046507 Ga0495606_0039287 Ga0495606_0039287_1302_2228 305
600 3300048907 Ga0496104_0030897 Ga0496104_0030897_3247_4173 305
601 3300048908 Ga0496105_0004975 Ga0496105_0004975_148_1074 305
602 3300048918 Ga0496115_0006005 Ga0496115_0006005_3328_4254 305
603 3300048920 Ga0496117_0009380 Ga0496117_0009380_3603_4529 305
604 3300048920 Ga0496117_0020494 Ga0496117_0020494_3787_4713 305
605 3300048921 Ga0496118_0005405 Ga0496118_0005405_7322_8248 305
606 3300048921 Ga0496118_0010204 Ga0496118_0010204_4837_5763 305
607 3300048922 Ga0496119_0000725 Ga0496119_0000725_4014_4940 305
608 3300048923 Ga0496120_0000821 Ga0496120_0000821_4005_4931 305
609 3300048923 Ga0496120_0001981 Ga0496120_0001981_19570_20496 305
610 3300048924 Ga0496121_0015979 Ga0496121_0015979_5716_6642 305
611 3300048924 Ga0496121_0108398 Ga0496121_0108398_113_1039 305
612 3300048928 Ga0496125_0002690 Ga0496125_0002690_15439_16365 305
613 3300048929 Ga0496126_0005169 Ga0496126_0005169_10566_11492 305
614 3300048929 Ga0496126_0006381 Ga0496126_0006381_235_1161 305
615 3300048929 Ga0496126_0047878 Ga0496126_0047878_66_992 305
616 3300049568 Ga0501031_0181613 Ga0501031_0181613_84_1007 305
617 3300049571 Ga0501034_0007301 Ga0501034_0007301_4608_5543 305
618 3300049573 Ga0501037_0015831 Ga0501037_0015831_4290_5264 305
619 3300049573 Ga0501037_0028747 Ga0501037_0028747_844_1779 305
620 3300049579 Ga0501043_0026804 Ga0501043_0026804_597_1523 305
621 3300049580 Ga0501046_0010346 Ga0501046_0010346_5419_6345 305
622 3300049581 Ga0501047_0001404 Ga0501047_0001404_16280_17239 305
623 3300049585 Ga0501069_0003670 Ga0501069_0003670_6746_7705 305
624 3300049586 Ga0501070_0008982 Ga0501070_0008982_5991_6950 305
625 3300049586 Ga0501070_0040778 Ga0501070_0040778_1137_2072 305
626 3300049587 Ga0501071_0218503 Ga0501071_0218503_69_1028 305
627 3300049590 Ga0501074_0000594 Ga0501074_0000594_5087_6046 305
628 3300049741 Ga0501079_0123705 Ga0501079_0123705_939_1898 305
629 3300049742 Ga0501080_0006171 Ga0501080_0006171_1902_2861 305
630 3300049822 Ga0501035_0071715 Ga0501035_0071715_1179_2114 305
631 3300049822 Ga0501035_0110059 Ga0501035_0110059_1408_2367 305
632 3300049823 Ga0501044_0002778 Ga0501044_0002778_5514_6449 305
633 3300049823 Ga0501044_0012333 Ga0501044_0012333_1687_2646 305
634 3300049823 Ga0501044_0038344 Ga0501044_0038344_390_1325 305
635 3300053093 Ga0500651_0002524 Ga0500651_0002524_7028_7954 305
636 3300061719 Ga0466962_0000743 Ga0466962_0000743_13685_14611 305
637 iso_pu_bacteria 2939611941 2939614023 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03279

Lip_A_acyltrans

Bacterial lipid A biosynthesis acyltransferase

38

328

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8467 59 294
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.8379 32 295
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.7912 59 294
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.7814 6 298
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.7315 6 298
ID Description Score Start End Superfamily
af_A2BGR3_377_681_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.626 114 200 3.40.50.300
af_Q9VYJ4_80_210_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.62 112 238 3.40.50.620
af_Q9UNY4_836_1160_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5956 114 199 3.40.50.300
af_Q7KTI0_75_205_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5895 113 238 3.40.50.620
af_Q9VYJ4_80_210_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5842 112 238 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1M4XP05-F1-model_v4 KDO2-lipid IV(A) lauroyltransferase 0.9619 28 300 GO:0005886
GO:0009103
GO:0009245
GO:0016746
AF-A0A1T4QHI8-F1-model_v4 KDO2-lipid IV(A) lauroyltransferase 0.9615 28 305 GO:0005886
GO:0009103
GO:0009245
GO:0016746
AF-A0A562BXF6-F1-model_v4 Lipid A biosynthesis acyltransferase (EC 2.3.1.241) (Kdo(2)-lipid IV(A) acyltransferase) 0.9528 2 304 GO:0005886
GO:0008913
GO:0009103
GO:0009245
GO:0036104
AF-A0A3N1P219-F1-model_v4 Lipid A biosynthesis acyltransferase (EC 2.3.1.241) (Kdo(2)-lipid IV(A) acyltransferase) 0.9486 5 305 GO:0005886
GO:0008913
GO:0009103
GO:0009245
GO:0036104
AF-A0A2N9D5K8-F1-model_v4 deleted 0.9485 20 304

Feature Viewer

pLDDT pTM Quality
90.51 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map