F471409

General Info

Members Datasets Scaffolds Average Seq Length
637 264 1274 139

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10266550|Ga0075432_102665501
Length 156
Sequence VRVLFPLSLKKTVLMVKQTMNLTFGIIKPDAVSAGHTGSIIDRILDSGFKIRGLKLIHMTLRQAEGFYAVHRERPFFPGLTEFMSSGPCVVMALDKEGAVKSWRDLMGATDPAKADEGTLRKQFGGSVGENAVHGSDSDENAAIEIAYFFSQLELV

Samples

Sample ID Description Type Environment
1 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
5 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
174 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
187 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
188 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
209 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
210 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
237 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
238 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
239 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
240 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
241 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
242 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
243 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
244 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
245 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
246 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
251 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
252 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
253 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
254 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 2751185800 Brucella pituitosa AA2 Isolate Unclassified
262 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
263 2854911287 Brucella lupini LUP21 Isolate Unclassified
264 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 0.63
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.73
Rhizosphere 96.7
Stem 0
Stem Tuber 0
Unclassified 11.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075432_10266550 3300006058 Bacteria 700
2 SwRhRL2b_contig_398119 2162886007 Bacteria 865
3 LJQas_1000805 3300000549 Bacteria 4939
4 JGI24030J14995_103297 3300001426 Bacteria 565
5 JGI24034J14986_102345 3300001432 Bacteria 983
6 JGI24748J21848_1000020 3300002074 Bacteria 114324
7 JGI24034J26672_10000002 3300002239 Bacteria 925353
8 JGI24742J22300_10036241 3300002244 Bacteria 871
9 Ga0065704_10015878 3300005289 Bacteria 1552
10 Ga0065704_10154697 3300005289 Bacteria 1400
11 Ga0065704_10167214 3300005289 Bacteria 1314
12 Ga0065712_10059693 3300005290 Bacteria 517
13 Ga0065712_10129202 3300005290 Bacteria 1570
14 Ga0065712_10132246 3300005290 Bacteria 1514
15 Ga0065715_10013936 3300005293 Bacteria 1984
16 Ga0065715_10130621 3300005293 Bacteria 2023
17 Ga0065707_10086298 3300005295 Bacteria 5543
18 Ga0065707_10098125 3300005295 Bacteria 3111
19 Ga0065707_10175437 3300005295 Bacteria 1454
20 Ga0065707_10465038 3300005295 Unclassified 769
21 Ga0070676_10021289 3300005328 Bacteria 3629
22 Ga0070690_100005729 3300005330 Bacteria 6996
23 Ga0070690_100008756 3300005330 Bacteria 5843
24 Ga0070690_100032260 3300005330 Bacteria 3270
25 Ga0070690_100480925 3300005330 Bacteria 926
26 Ga0070670_100014976 3300005331 Bacteria 6655
27 Ga0070670_100138797 3300005331 Bacteria 2102
28 Ga0070670_101433846 3300005331 Unclassified 633
29 Ga0070670_101827116 3300005331 Bacteria 559
30 Ga0070677_10056007 3300005333 Unclassified 1611
31 Ga0068869_100001716 3300005334 Bacteria 13080
32 Ga0068869_100009103 3300005334 Bacteria 6433
33 Ga0068869_100017284 3300005334 Bacteria 4886
34 Ga0068869_100074180 3300005334 Bacteria 2525
35 Ga0068869_100465078 3300005334 Bacteria 1051
36 Ga0068869_100546983 3300005334 Bacteria 972
37 Ga0068869_100735147 3300005334 Bacteria 844
38 Ga0070666_10040815 3300005335 Bacteria 3098
39 Ga0070680_100000797 3300005336 Bacteria 22198
40 Ga0070682_100000167 3300005337 Bacteria 50701
41 Ga0068868_100024117 3300005338 Bacteria 4611
42 Ga0068868_100747420 3300005338 Bacteria 878
43 Ga0068868_100919451 3300005338 Unclassified 796
44 Ga0070689_100001531 3300005340 Bacteria 14740
45 Ga0070689_100021935 3300005340 Bacteria 4761
46 Ga0070689_100056400 3300005340 Bacteria 3046
47 Ga0070689_101857018 3300005340 Unclassified 550
48 Ga0070687_100044136 3300005343 Bacteria 2269
49 Ga0070661_101226698 3300005344 Bacteria 628
50 Ga0070661_101825241 3300005344 Unclassified 516
51 Ga0070692_10025848 3300005345 Bacteria 2897
52 Ga0070692_10551427 3300005345 Bacteria 755
53 Ga0070668_100479174 3300005347 Bacteria 1074
54 Ga0070668_100830024 3300005347 Bacteria 823
55 Ga0070668_101872021 3300005347 Unclassified 552
56 Ga0070669_100005130 3300005353 Bacteria 9474
57 Ga0070669_100042210 3300005353 Bacteria 3318
58 Ga0070669_100277015 3300005353 Bacteria 1343
59 Ga0070669_100573794 3300005353 Bacteria 943
60 Ga0070675_100045173 3300005354 Bacteria 3604
61 Ga0070675_100431149 3300005354 Bacteria 1180
62 Ga0070671_100011256 3300005355 Bacteria 7186
63 Ga0070671_100035493 3300005355 Bacteria 4130
64 Ga0070671_100197718 3300005355 Bacteria 1704
65 Ga0070671_100451881 3300005355 Bacteria 1102
66 Ga0070671_100898476 3300005355 Unclassified 774
67 Ga0070671_101579877 3300005355 Bacteria 581
68 Ga0070674_100809953 3300005356 Bacteria 809
69 Ga0070673_100093815 3300005364 Bacteria 2459
70 Ga0070673_100134924 3300005364 Unclassified 2076
71 Ga0070673_100322304 3300005364 Bacteria 1365
72 Ga0070673_100344358 3300005364 Bacteria 1321
73 Ga0070673_100355723 3300005364 Bacteria 1301
74 Ga0070673_100572596 3300005364 Bacteria 1028
75 Ga0070688_100039810 3300005365 Bacteria 2878
76 Ga0070688_100093393 3300005365 Unclassified 1970
77 Ga0070659_101696786 3300005366 Unclassified 565
78 Ga0070667_100071407 3300005367 Bacteria 2957
79 Ga0070667_100446414 3300005367 Bacteria 1181
80 Ga0070667_101152105 3300005367 Bacteria 725
81 Ga0070703_10325613 3300005406 Bacteria 648
82 Ga0070709_10719733 3300005434 Bacteria 778
83 Ga0070701_10006009 3300005438 Bacteria 5074
84 Ga0070701_10033242 3300005438 Bacteria 2576
85 Ga0070701_10146153 3300005438 Bacteria 1357
86 Ga0070701_10187452 3300005438 Bacteria 1215
87 Ga0070711_100571225 3300005439 Bacteria 940
88 Ga0070705_100138155 3300005440 Bacteria 1600
89 Ga0070700_100000873 3300005441 Bacteria 14847
90 Ga0070700_100027792 3300005441 Bacteria 3358
91 Ga0070700_100091656 3300005441 Bacteria 1985
92 Ga0070700_100756156 3300005441 Bacteria 778
93 Ga0070694_100007979 3300005444 Bacteria 6471
94 Ga0070694_100020354 3300005444 Bacteria 4229
95 Ga0070694_100209453 3300005444 Bacteria 1457
96 Ga0070694_100262236 3300005444 Bacteria 1311
97 Ga0070694_100425671 3300005444 Bacteria 1044
98 Ga0070694_100745294 3300005444 Unclassified 799
99 Ga0070694_100862669 3300005444 Bacteria 746
100 Ga0070694_100991918 3300005444 Unclassified 697
101 Ga0070694_101878817 3300005444 Bacteria 511
102 Ga0070708_100059028 3300005445 Bacteria 3419
103 Ga0070708_100222381 3300005445 Bacteria 1771
104 Ga0070708_100233273 3300005445 Bacteria 1727
105 Ga0070662_100042004 3300005457 Bacteria 3265
106 Ga0070662_100206720 3300005457 Bacteria 1560
107 Ga0070662_100246209 3300005457 Unclassified 1435
108 Ga0070681_10032172 3300005458 Bacteria 5264
109 Ga0070681_11942090 3300005458 Bacteria 516
110 Ga0068867_100072990 3300005459 Bacteria 2570
111 Ga0068867_100558430 3300005459 Bacteria 993
112 Ga0068867_100810429 3300005459 Bacteria 836
113 Ga0068867_100944829 3300005459 Bacteria 778
114 Ga0070685_10136085 3300005466 Bacteria 1541
115 Ga0070685_10356996 3300005466 Bacteria 1001
116 Ga0070685_11468069 3300005466 Unclassified 525
117 Ga0070706_100037208 3300005467 Bacteria 4495
118 Ga0070706_100453016 3300005467 Bacteria 1194
119 Ga0070707_101632796 3300005468 Unclassified 612
120 Ga0070698_100012448 3300005471 Bacteria 9003
121 Ga0070698_100244272 3300005471 Bacteria 1728
122 Ga0070698_100510103 3300005471 Bacteria 1141
123 Ga0070698_101569231 3300005471 Bacteria 610
124 Ga0070699_100026753 3300005518 Bacteria 4976
125 Ga0070699_100122910 3300005518 Bacteria 2283
126 Ga0070699_100177071 3300005518 Bacteria 1892
127 Ga0070699_101606823 3300005518 Bacteria 596
128 Ga0070679_100000855 3300005530 Bacteria 26483
129 Ga0070684_100754173 3300005535 Unclassified 909
130 Ga0070697_100000073 3300005536 Bacteria 79804
131 Ga0070697_100000434 3300005536 Bacteria 32091
132 Ga0070697_100218068 3300005536 Bacteria 1626
133 Ga0070697_100246709 3300005536 Bacteria 1526
134 Ga0068853_100690224 3300005539 Bacteria 973
135 Ga0070672_100024729 3300005543 Bacteria 4443
136 Ga0070686_100001814 3300005544 Bacteria 11907
137 Ga0070686_100003855 3300005544 Bacteria 8247
138 Ga0070686_100005111 3300005544 Bacteria 7243
139 Ga0070686_100078320 3300005544 Bacteria 2182
140 Ga0070686_100998624 3300005544 Bacteria 686
141 Ga0070695_100058378 3300005545 Bacteria 2495
142 Ga0070695_100098743 3300005545 Bacteria 1963
143 Ga0070695_100494095 3300005545 Bacteria 945
144 Ga0070695_101352088 3300005545 Unclassified 590
145 Ga0070696_100162787 3300005546 Unclassified 1645
146 Ga0070696_100194860 3300005546 Bacteria 1510
147 Ga0070696_100419946 3300005546 Bacteria 1050
148 Ga0070696_100695217 3300005546 Unclassified 828
149 Ga0070696_101140767 3300005546 Unclassified 656
150 Ga0070696_102022469 3300005546 Unclassified 500
151 Ga0070693_100227799 3300005547 Unclassified 1225
152 Ga0070693_100231200 3300005547 Bacteria 1217
153 Ga0070693_100376544 3300005547 Bacteria 978
154 Ga0070693_100378314 3300005547 Bacteria 976
155 Ga0070693_100405964 3300005547 Unclassified 946
156 Ga0070665_100328175 3300005548 Bacteria 1534
157 Ga0070665_101831130 3300005548 Bacteria 613
158 Ga0070704_100373154 3300005549 Bacteria 1210
159 Ga0070704_102035563 3300005549 Bacteria 533
160 Ga0068855_101034972 3300005563 Bacteria 861
161 Ga0070664_100538436 3300005564 Bacteria 1079
162 Ga0070664_100773900 3300005564 Bacteria 897
163 Ga0070664_100811772 3300005564 Bacteria 875
164 Ga0068857_100132808 3300005577 Bacteria 2246
165 Ga0068857_100348220 3300005577 Bacteria 1372
166 Ga0068857_101048116 3300005577 Unclassified 786
167 Ga0068857_101258126 3300005577 Bacteria 717
168 Ga0068854_100147755 3300005578 Bacteria 1810
169 Ga0068854_100223081 3300005578 Bacteria 1492
170 Ga0068854_100645511 3300005578 Bacteria 908
171 Ga0068854_100867616 3300005578 Bacteria 791
172 Ga0068856_100015041 3300005614 Bacteria 7473
173 Ga0070702_100105382 3300005615 Bacteria 1738
174 Ga0070702_100143230 3300005615 Bacteria 1525
175 Ga0070702_100368089 3300005615 Bacteria 1018
176 Ga0070702_100516242 3300005615 Bacteria 880
177 Ga0068852_100067982 3300005616 Bacteria 3116
178 Ga0068852_102797194 3300005616 Unclassified 506
179 Ga0068859_100121652 3300005617 Bacteria 2677
180 Ga0068859_100208781 3300005617 Bacteria 2039
181 Ga0068859_100288789 3300005617 Bacteria 1733
182 Ga0068859_100424465 3300005617 Bacteria 1426
183 Ga0068859_100456660 3300005617 Bacteria 1373
184 Ga0068859_101267621 3300005617 Bacteria 812
185 Ga0068864_100002273 3300005618 Bacteria 15887
186 Ga0068864_100038030 3300005618 Bacteria 4108
187 Ga0068864_100128705 3300005618 Bacteria 2272
188 Ga0068864_100395795 3300005618 Bacteria 1312
189 Ga0068864_100757977 3300005618 Bacteria 952
190 Ga0068866_10001025 3300005718 Bacteria 12288
191 Ga0068866_10354495 3300005718 Bacteria 933
192 Ga0068861_100031866 3300005719 Bacteria 3877
193 Ga0068861_100038173 3300005719 Bacteria 3574
194 Ga0068861_100094344 3300005719 Bacteria 2368
195 Ga0068861_100388485 3300005719 Bacteria 1235
196 Ga0068861_100424671 3300005719 Bacteria 1185
197 Ga0068861_100981474 3300005719 Bacteria 805
198 Ga0068851_10592155 3300005834 Bacteria 674
199 Ga0068870_10028547 3300005840 Bacteria 2803
200 Ga0068870_10029737 3300005840 Bacteria 2754
201 Ga0068863_100026238 3300005841 Bacteria 5560
202 Ga0068863_100069625 3300005841 Bacteria 3326
203 Ga0068863_100071048 3300005841 Bacteria 3293
204 Ga0068863_100380818 3300005841 Bacteria 1377
205 Ga0068863_100428345 3300005841 Unclassified 1297
206 Ga0068863_100473743 3300005841 Bacteria 1231
207 Ga0068863_101272198 3300005841 Bacteria 742
208 Ga0068858_100000008 3300005842 Bacteria 238361
209 Ga0068858_100025999 3300005842 Bacteria 5444
210 Ga0068858_100096659 3300005842 Bacteria 2753
211 Ga0068858_100286785 3300005842 Bacteria 1568
212 Ga0068860_100194366 3300005843 Bacteria 1964
213 Ga0068860_100200092 3300005843 Bacteria 1935
214 Ga0068860_100629100 3300005843 Bacteria 1080
215 Ga0068860_100864254 3300005843 Bacteria 920
216 Ga0068860_101011397 3300005843 Bacteria 849
217 Ga0068860_101105032 3300005843 Bacteria 812
218 Ga0068862_100104066 3300005844 Bacteria 2486
219 Ga0068862_100353977 3300005844 Bacteria 1363
220 Ga0068862_101238342 3300005844 Bacteria 746
221 Ga0068862_102161579 3300005844 Bacteria 568
222 Ga0068862_102504676 3300005844 Bacteria 528
223 Ga0070715_10157506 3300006163 Bacteria 1119
224 Ga0070716_100191809 3300006173 Bacteria 1351
225 Ga0070712_100020457 3300006175 Bacteria 4331
226 Ga0097621_100009963 3300006237 Bacteria 6926
227 Ga0097621_100021695 3300006237 Bacteria 4974
228 Ga0068871_100021196 3300006358 Bacteria 4991
229 Ga0068871_101549332 3300006358 Bacteria 627
230 Ga0075431_100283300 3300006847 Bacteria 1678
231 Ga0075433_10054175 3300006852 Bacteria 3499
232 Ga0075433_10076576 3300006852 Bacteria 2946
233 Ga0075433_10118724 3300006852 Bacteria 2347
234 Ga0075433_10119470 3300006852 Bacteria 2340
235 Ga0075433_10183463 3300006852 Bacteria 1862
236 Ga0075433_10298561 3300006852 Bacteria 1426
237 Ga0075434_100075295 3300006871 Bacteria 3368
238 Ga0075434_100092275 3300006871 Bacteria 3030
239 Ga0075434_100128251 3300006871 Bacteria 2554
240 Ga0075434_100225915 3300006871 Bacteria 1892
241 Ga0075434_100498370 3300006871 Bacteria 1239
242 Ga0075434_101315298 3300006871 Bacteria 733
243 Ga0075429_100362938 3300006880 Bacteria 1268
244 Ga0068865_100008853 3300006881 Bacteria 6225
245 Ga0068865_100733491 3300006881 Bacteria 847
246 Ga0068865_101021209 3300006881 Bacteria 725
247 Ga0097620_100121651 3300006931 Bacteria 2677
248 Ga0097620_100208778 3300006931 Bacteria 2039
249 Ga0097620_100288790 3300006931 Bacteria 1733
250 Ga0097620_100424458 3300006931 Bacteria 1426
251 Ga0097620_100456629 3300006931 Bacteria 1373
252 Ga0097620_101267642 3300006931 Bacteria 812
253 Ga0075435_100248201 3300007076 Bacteria 1515
254 Ga0105240_10515221 3300009093 Bacteria 1328
255 Ga0105240_10764602 3300009093 Unclassified 1049
256 Ga0105240_11591030 3300009093 Bacteria 684
257 Ga0105240_11885125 3300009093 Bacteria 622
258 Ga0111539_10055294 3300009094 Bacteria 4718
259 Ga0111539_12215387 3300009094 Bacteria 637
260 Ga0105245_10165681 3300009098 Bacteria 2101
261 Ga0105245_10319621 3300009098 Bacteria 1529
262 Ga0105245_10335004 3300009098 Bacteria 1495
263 Ga0105245_10890221 3300009098 Bacteria 931
264 Ga0105247_10000001 3300009101 Bacteria 739726
265 Ga0114129_10006570 3300009147 Bacteria 16504
266 Ga0114129_10101431 3300009147 Bacteria 3982
267 Ga0114129_10166403 3300009147 Bacteria 3009
268 Ga0114129_10952003 3300009147 Bacteria 1084
269 Ga0114129_11326896 3300009147 Bacteria 891
270 Ga0114129_12425328 3300009147 Bacteria 628
271 Ga0105243_10000344 3300009148 Bacteria 50059
272 Ga0105243_10009483 3300009148 Bacteria 7410
273 Ga0105243_10213530 3300009148 Bacteria 1701
274 Ga0105243_10321908 3300009148 Unclassified 1409
275 Ga0105243_10381272 3300009148 Bacteria 1304
276 Ga0105243_10528272 3300009148 Bacteria 1123
277 Ga0105243_10820239 3300009148 Bacteria 919
278 Ga0105243_11288162 3300009148 Bacteria 747
279 Ga0105243_11906597 3300009148 Bacteria 627
280 Ga0105243_11966569 3300009148 Bacteria 618
281 Ga0105241_10017755 3300009174 Bacteria 5233
282 Ga0105241_10092573 3300009174 Bacteria 2387
283 Ga0105241_10467342 3300009174 Bacteria 1119
284 Ga0105241_10687677 3300009174 Bacteria 933
285 Ga0105241_11110890 3300009174 Bacteria 745
286 Ga0105241_11817657 3300009174 Unclassified 595
287 Ga0105242_10015641 3300009176 Bacteria 5894
288 Ga0105242_10314255 3300009176 Bacteria 1435
289 Ga0105242_10318774 3300009176 Bacteria 1425
290 Ga0105248_10008480 3300009177 Bacteria 11280
291 Ga0105248_10033340 3300009177 Bacteria 5752
292 Ga0105248_10066082 3300009177 Bacteria 4061
293 Ga0105248_10239097 3300009177 Bacteria 2044
294 Ga0105248_10449693 3300009177 Bacteria 1452
295 Ga0105249_10064463 3300009553 Unclassified 3368
296 Ga0105249_10096797 3300009553 Bacteria 2770
297 Ga0105249_10131614 3300009553 Bacteria 2389
298 Ga0105249_10151899 3300009553 Bacteria 2230
299 Ga0105249_10174905 3300009553 Unclassified 2084
300 Ga0105249_10224776 3300009553 Bacteria 1849
301 Ga0105249_12580637 3300009553 Unclassified 580
302 Ga0105239_10028211 3300010375 Bacteria 6174
303 Ga0105239_10069721 3300010375 Bacteria 3862
304 Ga0105239_10741107 3300010375 Bacteria 1124
305 Ga0105239_10742722 3300010375 Bacteria 1123
306 Ga0105239_11003150 3300010375 Unclassified 960
307 Ga0105246_10126845 3300011119 Bacteria 1900
308 Ga0157371_10190588 3300013102 Bacteria 1468
309 Ga0157371_10308662 3300013102 Bacteria 1146
310 Ga0157374_10080707 3300013296 Bacteria 3086
311 Ga0157374_10297699 3300013296 Bacteria 1596
312 Ga0157378_10000019 3300013297 Bacteria 132704
313 Ga0157378_10002954 3300013297 Bacteria 15117
314 Ga0157378_10014294 3300013297 Bacteria 6949
315 Ga0157378_10023819 3300013297 Bacteria 5386
316 Ga0157378_10124734 3300013297 Bacteria 2378
317 Ga0157378_10151355 3300013297 Bacteria 2162
318 Ga0157378_10236720 3300013297 Unclassified 1742
319 Ga0157378_10520897 3300013297 Bacteria 1190
320 Ga0157378_10662517 3300013297 Unclassified 1060
321 Ga0157378_10835624 3300013297 Bacteria 948
322 Ga0157378_12274722 3300013297 Unclassified 594
323 Ga0157378_12918037 3300013297 Bacteria 530
324 Ga0163162_10006123 3300013306 Bacteria 11647
325 Ga0163162_10054393 3300013306 Bacteria 4026
326 Ga0163162_10082154 3300013306 Bacteria 3294
327 Ga0163162_10447488 3300013306 Bacteria 1424
328 Ga0157372_10021868 3300013307 Bacteria 6913
329 Ga0157372_10042615 3300013307 Bacteria 5021
330 Ga0157375_10006370 3300013308 Bacteria 10290
331 Ga0157375_10188074 3300013308 Bacteria 2219
332 Ga0157375_10846485 3300013308 Unclassified 1061
333 Ga0157375_11547734 3300013308 Bacteria 783
334 Ga0157375_12043801 3300013308 Unclassified 681
335 Ga0163163_10009099 3300014325 Bacteria 8849
336 Ga0163163_10108397 3300014325 Bacteria 2805
337 Ga0163163_10190228 3300014325 Bacteria 2101
338 Ga0163163_10716939 3300014325 Bacteria 1064
339 Ga0163163_11173445 3300014325 Bacteria 830
340 Ga0157380_10004065 3300014326 Bacteria 10092
341 Ga0157380_10013574 3300014326 Bacteria 5946
342 Ga0157380_10026988 3300014326 Bacteria 4364
343 Ga0157380_10042977 3300014326 Bacteria 3535
344 Ga0157380_10089790 3300014326 Bacteria 2533
345 Ga0157380_10097142 3300014326 Bacteria 2444
346 Ga0157380_10260445 3300014326 Bacteria 1575
347 Ga0157380_10847458 3300014326 Bacteria 935
348 Ga0157380_12338770 3300014326 Bacteria 599
349 Ga0157377_11165247 3300014745 Bacteria 594
350 Ga0157379_10597379 3300014968 Bacteria 1030
351 Ga0157376_10002237 3300014969 Bacteria 13041
352 Ga0157376_10361701 3300014969 Bacteria 1392
353 Ga0157376_11308716 3300014969 Unclassified 755
354 Ga0163161_10033514 3300017792 Bacteria 3670
355 Ga0163161_10074055 3300017792 Bacteria 2497
356 Ga0163161_10090838 3300017792 Bacteria 2259
357 Ga0163161_11294234 3300017792 Bacteria 633
358 Ga0207672_1000078 3300025223 Bacteria 13028
359 Ga0207666_1020245 3300025271 Bacteria 975
360 Ga0207656_10175712 3300025321 Bacteria 1026
361 Ga0207653_10428724 3300025885 Bacteria 519
362 Ga0207682_10032060 3300025893 Bacteria 2112
363 Ga0207682_10075166 3300025893 Unclassified 1438
364 Ga0207642_10248713 3300025899 Bacteria 1008
365 Ga0207642_10514977 3300025899 Bacteria 734
366 Ga0207710_10000003 3300025900 Bacteria 1071597
367 Ga0207688_10251329 3300025901 Bacteria 1071
368 Ga0207680_10125931 3300025903 Bacteria 1682
369 Ga0207643_10011379 3300025908 Bacteria 4804
370 Ga0207684_10049257 3300025910 Bacteria 3574
371 Ga0207684_10215826 3300025910 Unclassified 1655
372 Ga0207707_10000031 3300025912 Bacteria 159505
373 Ga0207695_10069328 3300025913 Bacteria 3608
374 Ga0207695_10376119 3300025913 Bacteria 1306
375 Ga0207671_10296592 3300025914 Unclassified 1277
376 Ga0207693_10016954 3300025915 Bacteria 5817
377 Ga0207663_10198029 3300025916 Bacteria 1447
378 Ga0207660_10004970 3300025917 Bacteria 8667
379 Ga0207662_10057967 3300025918 Bacteria 2317
380 Ga0207662_10438306 3300025918 Unclassified 892
381 Ga0207652_10000087 3300025921 Bacteria 99945
382 Ga0207646_10115218 3300025922 Bacteria 2414
383 Ga0207646_10248018 3300025922 Bacteria 1608
384 Ga0207646_11385882 3300025922 Unclassified 612
385 Ga0207646_11691554 3300025922 Unclassified 544
386 Ga0207681_10000869 3300025923 Bacteria 19867
387 Ga0207681_10182498 3300025923 Bacteria 1600
388 Ga0207650_10009105 3300025925 Bacteria 6785
389 Ga0207650_11204983 3300025925 Unclassified 645
390 Ga0207659_10323394 3300025926 Bacteria 1273
391 Ga0207659_10361445 3300025926 Bacteria 1207
392 Ga0207687_10304115 3300025927 Bacteria 1285
393 Ga0207687_10398893 3300025927 Bacteria 1131
394 Ga0207687_10410314 3300025927 Bacteria 1116
395 Ga0207644_10010974 3300025931 Bacteria 5984
396 Ga0207644_10017623 3300025931 Bacteria 4828
397 Ga0207644_10201808 3300025931 Bacteria 1569
398 Ga0207644_11249761 3300025931 Unclassified 624
399 Ga0207706_10074820 3300025933 Bacteria 2978
400 Ga0207706_10086661 3300025933 Bacteria 2753
401 Ga0207706_10209971 3300025933 Bacteria 1707
402 Ga0207706_10983438 3300025933 Unclassified 710
403 Ga0207686_10005373 3300025934 Bacteria 6869
404 Ga0207686_10315408 3300025934 Bacteria 1166
405 Ga0207709_10000498 3300025935 Bacteria 35179
406 Ga0207709_10309163 3300025935 Bacteria 1178
407 Ga0207709_11336856 3300025935 Bacteria 593
408 Ga0207670_10001259 3300025936 Bacteria 13381
409 Ga0207670_10025949 3300025936 Bacteria 3687
410 Ga0207670_10212784 3300025936 Bacteria 1475
411 Ga0207704_10200769 3300025938 Bacteria 1459
412 Ga0207704_10841155 3300025938 Unclassified 769
413 Ga0207665_10205250 3300025939 Bacteria 1437
414 Ga0207665_11005038 3300025939 Bacteria 663
415 Ga0207691_10020629 3300025940 Bacteria 6230
416 Ga0207691_10581431 3300025940 Unclassified 949
417 Ga0207711_10012124 3300025941 Bacteria 7168
418 Ga0207711_10034012 3300025941 Unclassified 4315
419 Ga0207711_10339700 3300025941 Bacteria 1390
420 Ga0207711_10781406 3300025941 Bacteria 889
421 Ga0207711_11617307 3300025941 Bacteria 591
422 Ga0207689_10004054 3300025942 Bacteria 13306
423 Ga0207689_10014345 3300025942 Bacteria 6742
424 Ga0207689_10020436 3300025942 Bacteria 5573
425 Ga0207689_10026390 3300025942 Bacteria 4863
426 Ga0207689_10192226 3300025942 Bacteria 1684
427 Ga0207689_10197901 3300025942 Bacteria 1658
428 Ga0207689_10848686 3300025942 Bacteria 771
429 Ga0207679_10492377 3300025945 Bacteria 1093
430 Ga0207679_10779377 3300025945 Bacteria 871
431 Ga0207651_10083400 3300025960 Bacteria 2311
432 Ga0207651_10119332 3300025960 Bacteria 1997
433 Ga0207651_10178278 3300025960 Bacteria 1683
434 Ga0207651_10205703 3300025960 Bacteria 1581
435 Ga0207651_10286693 3300025960 Bacteria 1363
436 Ga0207651_10557298 3300025960 Bacteria 997
437 Ga0207712_10096980 3300025961 Bacteria 2183
438 Ga0207712_10118933 3300025961 Bacteria 1996
439 Ga0207712_10264681 3300025961 Bacteria 1396
440 Ga0207712_11122420 3300025961 Unclassified 700
441 Ga0207640_10086974 3300025981 Bacteria 2153
442 Ga0207640_10128791 3300025981 Bacteria 1826
443 Ga0207640_10310724 3300025981 Bacteria 1251
444 Ga0207640_10446368 3300025981 Bacteria 1065
445 Ga0207640_10531200 3300025981 Bacteria 985
446 Ga0207658_10573748 3300025986 Bacteria 1011
447 Ga0207658_11000218 3300025986 Bacteria 763
448 Ga0207677_10123422 3300026023 Bacteria 1953
449 Ga0207677_11001475 3300026023 Bacteria 758
450 Ga0207703_10000109 3300026035 Bacteria 97743
451 Ga0207703_10053591 3300026035 Unclassified 3279
452 Ga0207703_10106468 3300026035 Bacteria 2385
453 Ga0207703_11200067 3300026035 Bacteria 729
454 Ga0207703_11577478 3300026035 Bacteria 632
455 Ga0207639_10221712 3300026041 Bacteria 1634
456 Ga0207639_10965381 3300026041 Bacteria 798
457 Ga0207708_10000340 3300026075 Bacteria 36852
458 Ga0207708_10084236 3300026075 Bacteria 2444
459 Ga0207708_10279370 3300026075 Bacteria 1353
460 Ga0207708_10458106 3300026075 Bacteria 1063
461 Ga0207702_10172005 3300026078 Bacteria 1987
462 Ga0207641_10017839 3300026088 Bacteria 5815
463 Ga0207641_10122104 3300026088 Bacteria 2326
464 Ga0207641_10143985 3300026088 Bacteria 2153
465 Ga0207641_10549541 3300026088 Bacteria 1126
466 Ga0207641_10775888 3300026088 Bacteria 947
467 Ga0207648_10018150 3300026089 Bacteria 6372
468 Ga0207648_10057578 3300026089 Bacteria 3391
469 Ga0207648_10997856 3300026089 Bacteria 784
470 Ga0207648_12043355 3300026089 Bacteria 534
471 Ga0207676_10002507 3300026095 Bacteria 13082
472 Ga0207676_10065719 3300026095 Unclassified 2889
473 Ga0207676_10075962 3300026095 Bacteria 2712
474 Ga0207676_10191747 3300026095 Bacteria 1799
475 Ga0207676_10458173 3300026095 Bacteria 1203
476 Ga0207676_10744767 3300026095 Unclassified 952
477 Ga0207676_11084324 3300026095 Bacteria 791
478 Ga0207674_10075746 3300026116 Bacteria 3374
479 Ga0207674_10135278 3300026116 Bacteria 2427
480 Ga0207674_10824838 3300026116 Bacteria 895
481 Ga0207674_11039009 3300026116 Unclassified 789
482 Ga0207675_100002039 3300026118 Bacteria 20154
483 Ga0207675_100077366 3300026118 Bacteria 3117
484 Ga0207675_100253835 3300026118 Bacteria 1702
485 Ga0207675_100419194 3300026118 Bacteria 1322
486 Ga0207683_10188827 3300026121 Bacteria 1870
487 Ga0207683_10301356 3300026121 Bacteria 1466
488 Ga0209588_1103652 3300027671 Bacteria 915
489 Ga0209971_1007849 3300027682 Bacteria 2530
490 Ga0268266_10286149 3300028379 Bacteria 1534
491 Ga0268266_12074591 3300028379 Bacteria 541
492 Ga0268265_10102934 3300028380 Bacteria 2311
493 Ga0268265_10724328 3300028380 Unclassified 963
494 Ga0268265_11331633 3300028380 Bacteria 719
495 Ga0268264_10207090 3300028381 Bacteria 1798
496 Ga0268264_10297450 3300028381 Bacteria 1518
497 Ga0268264_10372053 3300028381 Bacteria 1366
498 Ga0268264_11169445 3300028381 Bacteria 778
499 Ga0268264_11429957 3300028381 Bacteria 702
500 Ga0268264_12115010 3300028381 Bacteria 571
501 Ga0307515_10024929 3300028794 Bacteria 10381
502 Ga0265316_10924155 3300031344 Bacteria 609
503 Ga0307513_10006165 3300031456 Bacteria 15723
504 Ga0307513_10135603 3300031456 Bacteria 2398
505 Ga0307513_10356915 3300031456 Bacteria 1208
506 Ga0307513_10533992 3300031456 Bacteria 887
507 Ga0316579_10139704 3300031691 Bacteria 1167
508 Ga0316576_10580366 3300031727 Bacteria 819
509 Ga0307405_10141520 3300031731 Unclassified 1678
510 Ga0307405_10872663 3300031731 Bacteria 759
511 Ga0307413_10001591 3300031824 Bacteria 8761
512 Ga0307413_10654335 3300031824 Bacteria 867
513 Ga0307413_10751992 3300031824 Bacteria 815
514 Ga0307413_11119369 3300031824 Bacteria 681
515 Ga0307410_10058945 3300031852 Unclassified 2619
516 Ga0307410_10480467 3300031852 Bacteria 1019
517 Ga0307410_10505785 3300031852 Unclassified 995
518 Ga0307406_10072264 3300031901 Bacteria 2264
519 Ga0307407_10009819 3300031903 Bacteria 4478
520 Ga0307407_10823134 3300031903 Bacteria 708
521 Ga0307412_11311704 3300031911 Unclassified 652
522 Ga0307409_100014005 3300031995 Bacteria 5193
523 Ga0307409_100335434 3300031995 Bacteria 1421
524 Ga0307409_102579873 3300031995 Bacteria 537
525 Ga0307416_100092134 3300032002 Bacteria 2606
526 Ga0307416_100331466 3300032002 Unclassified 1530
527 Ga0307416_101164053 3300032002 Unclassified 876
528 Ga0307416_102812131 3300032002 Unclassified 582
529 Ga0307414_10057307 3300032004 Bacteria 2738
530 Ga0307414_11194675 3300032004 Bacteria 704
531 Ga0307411_10007312 3300032005 Bacteria 5611
532 Ga0307411_10316229 3300032005 Bacteria 1259
533 Ga0307411_11277282 3300032005 Bacteria 668
534 Ga0307415_100542034 3300032126 Bacteria 1025
535 Ga0307415_100951606 3300032126 Bacteria 795
536 Ga0316583_10021503 3300032133 Bacteria 2312
537 Ga0316583_10116422 3300032133 Bacteria 932
538 Ga0316583_10166074 3300032133 Bacteria 768
539 Ga0316585_10065354 3300032137 Bacteria 1178
540 Ga0316592_1061409 3300033524 Bacteria 844
541 Ga0316586_1000616 3300033527 Bacteria 3550
542 Ga0316588_1011977 3300033528 Bacteria 1860
543 Ga0316587_1000391 3300033529 Bacteria 4270
544 Ga0373926_0037475 3300035083 Bacteria 1725
545 Ga0373923_0161701 3300035111 Bacteria 1022
546 Ga0373954_0020909 3300035118 Bacteria 2961
547 Ga0373956_0045512 3300035119 Bacteria 1958
548 Ga0373955_0286845 3300035172 Bacteria 991
549 Ga0316574_0151834 3300035398 Bacteria 1492
550 Ga0316574_0504257 3300035398 Bacteria 754
551 Ga0373935_0184872 3300035692 Bacteria 1432
552 Ga0373927_0009833 3300035695 Bacteria 6410
553 Ga0373933_0320293 3300035724 Bacteria 1005
554 Ga0373947_0031397 3300035725 Bacteria 3126
555 Ga0373937_0534161 3300036401 Bacteria 1114
556 Ga0316582_1061143 3300036647 Bacteria 552
557 Ga0316584_0127263 3300036712 Bacteria 1902
558 Ga0316584_0905818 3300036712 Bacteria 593
559 Ga0395905_1045413 3300037471 Bacteria 720
560 Ga0242420_003262 3300038996 Unclassified 2390
561 Ga0436365_0042402 3300039437 Bacteria 3618
562 Ga0436365_0659853 3300039437 Bacteria 1881
563 Ga0450914_049286 3300042118 Bacteria 551
564 Ga0450890_026173 3300042127 Bacteria 812
565 Ga0439464_0027515 3300042439 Bacteria 1581
566 Ga0451577_0330204 3300042876 Bacteria 1383
567 Ga0453683_0010074 3300044673 Bacteria 6281
568 Ga0453684_0002708 3300044712 Bacteria 42012
569 Ga0451576_0065901 3300045051 Bacteria 3770
570 Ga0451576_0151694 3300045051 Bacteria 2417
571 Ga0451576_0765764 3300045051 Bacteria 1014
572 Ga0451576_1231357 3300045051 Bacteria 781
573 Ga0451576_1314377 3300045051 Unclassified 754
574 Ga0495651_0060052 3300046462 Bacteria 2914
575 Ga0495580_0000381 3300046472 Bacteria 36384
576 Ga0495632_0070935 3300046519 Bacteria 1675
577 Ga0495663_0003270 3300046525 Bacteria 4708
578 Ga0495598_0000613 3300046537 Bacteria 6748
579 Ga0495621_0000644 3300046539 Bacteria 8780
580 Ga0495667_0301849 3300046559 Bacteria 1014
581 Ga0495656_0106712 3300046615 Bacteria 1304
582 Ga0495613_0170632 3300046689 Bacteria 1544
583 Ga0495636_0104233 3300047318 Bacteria 1243
584 Ga0495674_0071622 3300047319 Bacteria 2991
585 Ga0495672_0225713 3300047320 Bacteria 922
586 Ga0495593_0290798 3300047673 Bacteria 817
587 Ga0495602_0558250 3300048088 Bacteria 793
588 Ga0496101_0406328 3300048904 Bacteria 1073
589 Ga0496101_0525711 3300048904 Bacteria 935
590 Ga0496102_0306563 3300048905 Bacteria 1496
591 Ga0496103_0088544 3300048906 Unclassified 1952
592 Ga0496104_0027206 3300048907 Bacteria 5292
593 Ga0496106_0022105 3300048909 Bacteria 4725
594 Ga0496106_0275149 3300048909 Unclassified 1348
595 Ga0496108_0184384 3300048911 Bacteria 1808
596 Ga0496108_0867941 3300048911 Bacteria 776
597 Ga0496108_1485687 3300048911 Bacteria 564
598 Ga0496109_0480689 3300048912 Unclassified 1173
599 Ga0501291_097411 3300049514 Unclassified 609
600 Ga0501294_031516 3300049517 Bacteria 621
601 Ga0501216_137498 3300049660 Bacteria 571
602 Ga0501227_024195 3300049665 Bacteria 1416
603 Ga0501233_014314 3300049668 Bacteria 1619
604 Ga0501235_159834 3300049669 Unclassified 589
605 Ga0501239_002687 3300049672 Bacteria 1634
606 Ga0501240_048782 3300049673 Bacteria 722
607 Ga0501247_009133 3300049677 Bacteria 1167
608 Ga0501248_014631 3300049678 Bacteria 747
609 Ga0501250_040135 3300049680 Bacteria 684
610 Ga0501225_0028546 3300049705 Bacteria 1533
611 Ga0501229_007847 3300049706 Bacteria 1330
612 Ga0501080_0359714 3300049742 Bacteria 1313
613 Ga0501267_037412 3300049764 Bacteria 594
614 Ga0501270_110918 3300049767 Bacteria 585
615 Ga0501279_009421 3300049775 Bacteria 1308
616 Ga0501283_059775 3300049779 Bacteria 687
617 Ga0501226_007840 3300049853 Bacteria 1196
618 nmdc:mga05p37_141015_c1 3300050507 Bacteria 2953
619 nmdc:mga05p37_1730763_c1 3300050507 Bacteria 607
620 nmdc:mga06r32_364210_c1 3300050510 Bacteria 1429
621 nmdc:mga08y16_59840_c1 3300050511 Bacteria 3979
622 nmdc:mga0n895_207436_c1 3300050512 Bacteria 1990
623 nmdc:mga0n895_285729_c1 3300050512 Unclassified 1672
624 nmdc:mga0n895_31225_c1 3300050512 Bacteria 5098
625 nmdc:mga0rr50_1682805_c1 3300050513 Bacteria 535
626 nmdc:mga0rr50_235506_c1 3300050513 Bacteria 1516
627 nmdc:mga0a205_112358_c1 3300050515 Bacteria 2623
628 nmdc:mga0a205_17518_c1 3300050515 Bacteria 6718
629 nmdc:mga0a205_183533_c1 3300050515 Bacteria 1986
630 nmdc:mga0a205_250193_c1 3300050515 Bacteria 1652
631 nmdc:mga0a205_295250_c1 3300050515 Bacteria 1494
632 nmdc:mga0a205_627773_c1 3300050515 Unclassified 926
633 nmdc:mga0a205_66330_c1 3300050515 Bacteria 3488
634 2753359007 2751185800 Bacteria 5467370
635 2837652619 2837651117 Bacteria 3772164
636 2854914526 2854911287 Bacteria 5582813
637 2915651513 2915650412 Bacteria 4288180
638 Ga0075432_10266550
639 SwRhRL2b_contig_398119
640 LJQas_1000805
641 JGI24030J14995_103297
642 JGI24034J14986_102345
643 JGI24748J21848_1000020
644 JGI24034J26672_10000002
645 JGI24742J22300_10036241
646 Ga0065704_10015878
647 Ga0065704_10154697
648 Ga0065704_10167214
649 Ga0065712_10059693
650 Ga0065712_10129202
651 Ga0065712_10132246
652 Ga0065715_10013936
653 Ga0065715_10130621
654 Ga0065707_10086298
655 Ga0065707_10098125
656 Ga0065707_10175437
657 Ga0065707_10465038
658 Ga0070676_10021289
659 Ga0070690_100005729
660 Ga0070690_100008756
661 Ga0070690_100032260
662 Ga0070690_100480925
663 Ga0070670_100014976
664 Ga0070670_100138797
665 Ga0070670_101433846
666 Ga0070670_101827116
667 Ga0070677_10056007
668 Ga0068869_100001716
669 Ga0068869_100009103
670 Ga0068869_100017284
671 Ga0068869_100074180
672 Ga0068869_100465078
673 Ga0068869_100546983
674 Ga0068869_100735147
675 Ga0070666_10040815
676 Ga0070680_100000797
677 Ga0070682_100000167
678 Ga0068868_100024117
679 Ga0068868_100747420
680 Ga0068868_100919451
681 Ga0070689_100001531
682 Ga0070689_100021935
683 Ga0070689_100056400
684 Ga0070689_101857018
685 Ga0070687_100044136
686 Ga0070661_101226698
687 Ga0070661_101825241
688 Ga0070692_10025848
689 Ga0070692_10551427
690 Ga0070668_100479174
691 Ga0070668_100830024
692 Ga0070668_101872021
693 Ga0070669_100005130
694 Ga0070669_100042210
695 Ga0070669_100277015
696 Ga0070669_100573794
697 Ga0070675_100045173
698 Ga0070675_100431149
699 Ga0070671_100011256
700 Ga0070671_100035493
701 Ga0070671_100197718
702 Ga0070671_100451881
703 Ga0070671_100898476
704 Ga0070671_101579877
705 Ga0070674_100809953
706 Ga0070673_100093815
707 Ga0070673_100134924
708 Ga0070673_100322304
709 Ga0070673_100344358
710 Ga0070673_100355723
711 Ga0070673_100572596
712 Ga0070688_100039810
713 Ga0070688_100093393
714 Ga0070659_101696786
715 Ga0070667_100071407
716 Ga0070667_100446414
717 Ga0070667_101152105
718 Ga0070703_10325613
719 Ga0070709_10719733
720 Ga0070701_10006009
721 Ga0070701_10033242
722 Ga0070701_10146153
723 Ga0070701_10187452
724 Ga0070711_100571225
725 Ga0070705_100138155
726 Ga0070700_100000873
727 Ga0070700_100027792
728 Ga0070700_100091656
729 Ga0070700_100756156
730 Ga0070694_100007979
731 Ga0070694_100020354
732 Ga0070694_100209453
733 Ga0070694_100262236
734 Ga0070694_100425671
735 Ga0070694_100745294
736 Ga0070694_100862669
737 Ga0070694_100991918
738 Ga0070694_101878817
739 Ga0070708_100059028
740 Ga0070708_100222381
741 Ga0070708_100233273
742 Ga0070662_100042004
743 Ga0070662_100206720
744 Ga0070662_100246209
745 Ga0070681_10032172
746 Ga0070681_11942090
747 Ga0068867_100072990
748 Ga0068867_100558430
749 Ga0068867_100810429
750 Ga0068867_100944829
751 Ga0070685_10136085
752 Ga0070685_10356996
753 Ga0070685_11468069
754 Ga0070706_100037208
755 Ga0070706_100453016
756 Ga0070707_101632796
757 Ga0070698_100012448
758 Ga0070698_100244272
759 Ga0070698_100510103
760 Ga0070698_101569231
761 Ga0070699_100026753
762 Ga0070699_100122910
763 Ga0070699_100177071
764 Ga0070699_101606823
765 Ga0070679_100000855
766 Ga0070684_100754173
767 Ga0070697_100000073
768 Ga0070697_100000434
769 Ga0070697_100218068
770 Ga0070697_100246709
771 Ga0068853_100690224
772 Ga0070672_100024729
773 Ga0070686_100001814
774 Ga0070686_100003855
775 Ga0070686_100005111
776 Ga0070686_100078320
777 Ga0070686_100998624
778 Ga0070695_100058378
779 Ga0070695_100098743
780 Ga0070695_100494095
781 Ga0070695_101352088
782 Ga0070696_100162787
783 Ga0070696_100194860
784 Ga0070696_100419946
785 Ga0070696_100695217
786 Ga0070696_101140767
787 Ga0070696_102022469
788 Ga0070693_100227799
789 Ga0070693_100231200
790 Ga0070693_100376544
791 Ga0070693_100378314
792 Ga0070693_100405964
793 Ga0070665_100328175
794 Ga0070665_101831130
795 Ga0070704_100373154
796 Ga0070704_102035563
797 Ga0068855_101034972
798 Ga0070664_100538436
799 Ga0070664_100773900
800 Ga0070664_100811772
801 Ga0068857_100132808
802 Ga0068857_100348220
803 Ga0068857_101048116
804 Ga0068857_101258126
805 Ga0068854_100147755
806 Ga0068854_100223081
807 Ga0068854_100645511
808 Ga0068854_100867616
809 Ga0068856_100015041
810 Ga0070702_100105382
811 Ga0070702_100143230
812 Ga0070702_100368089
813 Ga0070702_100516242
814 Ga0068852_100067982
815 Ga0068852_102797194
816 Ga0068859_100121652
817 Ga0068859_100208781
818 Ga0068859_100288789
819 Ga0068859_100424465
820 Ga0068859_100456660
821 Ga0068859_101267621
822 Ga0068864_100002273
823 Ga0068864_100038030
824 Ga0068864_100128705
825 Ga0068864_100395795
826 Ga0068864_100757977
827 Ga0068866_10001025
828 Ga0068866_10354495
829 Ga0068861_100031866
830 Ga0068861_100038173
831 Ga0068861_100094344
832 Ga0068861_100388485
833 Ga0068861_100424671
834 Ga0068861_100981474
835 Ga0068851_10592155
836 Ga0068870_10028547
837 Ga0068870_10029737
838 Ga0068863_100026238
839 Ga0068863_100069625
840 Ga0068863_100071048
841 Ga0068863_100380818
842 Ga0068863_100428345
843 Ga0068863_100473743
844 Ga0068863_101272198
845 Ga0068858_100000008
846 Ga0068858_100025999
847 Ga0068858_100096659
848 Ga0068858_100286785
849 Ga0068860_100194366
850 Ga0068860_100200092
851 Ga0068860_100629100
852 Ga0068860_100864254
853 Ga0068860_101011397
854 Ga0068860_101105032
855 Ga0068862_100104066
856 Ga0068862_100353977
857 Ga0068862_101238342
858 Ga0068862_102161579
859 Ga0068862_102504676
860 Ga0070715_10157506
861 Ga0070716_100191809
862 Ga0070712_100020457
863 Ga0097621_100009963
864 Ga0097621_100021695
865 Ga0068871_100021196
866 Ga0068871_101549332
867 Ga0075431_100283300
868 Ga0075433_10054175
869 Ga0075433_10076576
870 Ga0075433_10118724
871 Ga0075433_10119470
872 Ga0075433_10183463
873 Ga0075433_10298561
874 Ga0075434_100075295
875 Ga0075434_100092275
876 Ga0075434_100128251
877 Ga0075434_100225915
878 Ga0075434_100498370
879 Ga0075434_101315298
880 Ga0075429_100362938
881 Ga0068865_100008853
882 Ga0068865_100733491
883 Ga0068865_101021209
884 Ga0097620_100121651
885 Ga0097620_100208778
886 Ga0097620_100288790
887 Ga0097620_100424458
888 Ga0097620_100456629
889 Ga0097620_101267642
890 Ga0075435_100248201
891 Ga0105240_10515221
892 Ga0105240_10764602
893 Ga0105240_11591030
894 Ga0105240_11885125
895 Ga0111539_10055294
896 Ga0111539_12215387
897 Ga0105245_10165681
898 Ga0105245_10319621
899 Ga0105245_10335004
900 Ga0105245_10890221
901 Ga0105247_10000001
902 Ga0114129_10006570
903 Ga0114129_10101431
904 Ga0114129_10166403
905 Ga0114129_10952003
906 Ga0114129_11326896
907 Ga0114129_12425328
908 Ga0105243_10000344
909 Ga0105243_10009483
910 Ga0105243_10213530
911 Ga0105243_10321908
912 Ga0105243_10381272
913 Ga0105243_10528272
914 Ga0105243_10820239
915 Ga0105243_11288162
916 Ga0105243_11906597
917 Ga0105243_11966569
918 Ga0105241_10017755
919 Ga0105241_10092573
920 Ga0105241_10467342
921 Ga0105241_10687677
922 Ga0105241_11110890
923 Ga0105241_11817657
924 Ga0105242_10015641
925 Ga0105242_10314255
926 Ga0105242_10318774
927 Ga0105248_10008480
928 Ga0105248_10033340
929 Ga0105248_10066082
930 Ga0105248_10239097
931 Ga0105248_10449693
932 Ga0105249_10064463
933 Ga0105249_10096797
934 Ga0105249_10131614
935 Ga0105249_10151899
936 Ga0105249_10174905
937 Ga0105249_10224776
938 Ga0105249_12580637
939 Ga0105239_10028211
940 Ga0105239_10069721
941 Ga0105239_10741107
942 Ga0105239_10742722
943 Ga0105239_11003150
944 Ga0105246_10126845
945 Ga0157371_10190588
946 Ga0157371_10308662
947 Ga0157374_10080707
948 Ga0157374_10297699
949 Ga0157378_10000019
950 Ga0157378_10002954
951 Ga0157378_10014294
952 Ga0157378_10023819
953 Ga0157378_10124734
954 Ga0157378_10151355
955 Ga0157378_10236720
956 Ga0157378_10520897
957 Ga0157378_10662517
958 Ga0157378_10835624
959 Ga0157378_12274722
960 Ga0157378_12918037
961 Ga0163162_10006123
962 Ga0163162_10054393
963 Ga0163162_10082154
964 Ga0163162_10447488
965 Ga0157372_10021868
966 Ga0157372_10042615
967 Ga0157375_10006370
968 Ga0157375_10188074
969 Ga0157375_10846485
970 Ga0157375_11547734
971 Ga0157375_12043801
972 Ga0163163_10009099
973 Ga0163163_10108397
974 Ga0163163_10190228
975 Ga0163163_10716939
976 Ga0163163_11173445
977 Ga0157380_10004065
978 Ga0157380_10013574
979 Ga0157380_10026988
980 Ga0157380_10042977
981 Ga0157380_10089790
982 Ga0157380_10097142
983 Ga0157380_10260445
984 Ga0157380_10847458
985 Ga0157380_12338770
986 Ga0157377_11165247
987 Ga0157379_10597379
988 Ga0157376_10002237
989 Ga0157376_10361701
990 Ga0157376_11308716
991 Ga0163161_10033514
992 Ga0163161_10074055
993 Ga0163161_10090838
994 Ga0163161_11294234
995 Ga0207672_1000078
996 Ga0207666_1020245
997 Ga0207656_10175712
998 Ga0207653_10428724
999 Ga0207682_10032060
1000 Ga0207682_10075166
1001 Ga0207642_10248713
1002 Ga0207642_10514977
1003 Ga0207710_10000003
1004 Ga0207688_10251329
1005 Ga0207680_10125931
1006 Ga0207643_10011379
1007 Ga0207684_10049257
1008 Ga0207684_10215826
1009 Ga0207707_10000031
1010 Ga0207695_10069328
1011 Ga0207695_10376119
1012 Ga0207671_10296592
1013 Ga0207693_10016954
1014 Ga0207663_10198029
1015 Ga0207660_10004970
1016 Ga0207662_10057967
1017 Ga0207662_10438306
1018 Ga0207652_10000087
1019 Ga0207646_10115218
1020 Ga0207646_10248018
1021 Ga0207646_11385882
1022 Ga0207646_11691554
1023 Ga0207681_10000869
1024 Ga0207681_10182498
1025 Ga0207650_10009105
1026 Ga0207650_11204983
1027 Ga0207659_10323394
1028 Ga0207659_10361445
1029 Ga0207687_10304115
1030 Ga0207687_10398893
1031 Ga0207687_10410314
1032 Ga0207644_10010974
1033 Ga0207644_10017623
1034 Ga0207644_10201808
1035 Ga0207644_11249761
1036 Ga0207706_10074820
1037 Ga0207706_10086661
1038 Ga0207706_10209971
1039 Ga0207706_10983438
1040 Ga0207686_10005373
1041 Ga0207686_10315408
1042 Ga0207709_10000498
1043 Ga0207709_10309163
1044 Ga0207709_11336856
1045 Ga0207670_10001259
1046 Ga0207670_10025949
1047 Ga0207670_10212784
1048 Ga0207704_10200769
1049 Ga0207704_10841155
1050 Ga0207665_10205250
1051 Ga0207665_11005038
1052 Ga0207691_10020629
1053 Ga0207691_10581431
1054 Ga0207711_10012124
1055 Ga0207711_10034012
1056 Ga0207711_10339700
1057 Ga0207711_10781406
1058 Ga0207711_11617307
1059 Ga0207689_10004054
1060 Ga0207689_10014345
1061 Ga0207689_10020436
1062 Ga0207689_10026390
1063 Ga0207689_10192226
1064 Ga0207689_10197901
1065 Ga0207689_10848686
1066 Ga0207679_10492377
1067 Ga0207679_10779377
1068 Ga0207651_10083400
1069 Ga0207651_10119332
1070 Ga0207651_10178278
1071 Ga0207651_10205703
1072 Ga0207651_10286693
1073 Ga0207651_10557298
1074 Ga0207712_10096980
1075 Ga0207712_10118933
1076 Ga0207712_10264681
1077 Ga0207712_11122420
1078 Ga0207640_10086974
1079 Ga0207640_10128791
1080 Ga0207640_10310724
1081 Ga0207640_10446368
1082 Ga0207640_10531200
1083 Ga0207658_10573748
1084 Ga0207658_11000218
1085 Ga0207677_10123422
1086 Ga0207677_11001475
1087 Ga0207703_10000109
1088 Ga0207703_10053591
1089 Ga0207703_10106468
1090 Ga0207703_11200067
1091 Ga0207703_11577478
1092 Ga0207639_10221712
1093 Ga0207639_10965381
1094 Ga0207708_10000340
1095 Ga0207708_10084236
1096 Ga0207708_10279370
1097 Ga0207708_10458106
1098 Ga0207702_10172005
1099 Ga0207641_10017839
1100 Ga0207641_10122104
1101 Ga0207641_10143985
1102 Ga0207641_10549541
1103 Ga0207641_10775888
1104 Ga0207648_10018150
1105 Ga0207648_10057578
1106 Ga0207648_10997856
1107 Ga0207648_12043355
1108 Ga0207676_10002507
1109 Ga0207676_10065719
1110 Ga0207676_10075962
1111 Ga0207676_10191747
1112 Ga0207676_10458173
1113 Ga0207676_10744767
1114 Ga0207676_11084324
1115 Ga0207674_10075746
1116 Ga0207674_10135278
1117 Ga0207674_10824838
1118 Ga0207674_11039009
1119 Ga0207675_100002039
1120 Ga0207675_100077366
1121 Ga0207675_100253835
1122 Ga0207675_100419194
1123 Ga0207683_10188827
1124 Ga0207683_10301356
1125 Ga0209588_1103652
1126 Ga0209971_1007849
1127 Ga0268266_10286149
1128 Ga0268266_12074591
1129 Ga0268265_10102934
1130 Ga0268265_10724328
1131 Ga0268265_11331633
1132 Ga0268264_10207090
1133 Ga0268264_10297450
1134 Ga0268264_10372053
1135 Ga0268264_11169445
1136 Ga0268264_11429957
1137 Ga0268264_12115010
1138 Ga0307515_10024929
1139 Ga0265316_10924155
1140 Ga0307513_10006165
1141 Ga0307513_10135603
1142 Ga0307513_10356915
1143 Ga0307513_10533992
1144 Ga0316579_10139704
1145 Ga0316576_10580366
1146 Ga0307405_10141520
1147 Ga0307405_10872663
1148 Ga0307413_10001591
1149 Ga0307413_10654335
1150 Ga0307413_10751992
1151 Ga0307413_11119369
1152 Ga0307410_10058945
1153 Ga0307410_10480467
1154 Ga0307410_10505785
1155 Ga0307406_10072264
1156 Ga0307407_10009819
1157 Ga0307407_10823134
1158 Ga0307412_11311704
1159 Ga0307409_100014005
1160 Ga0307409_100335434
1161 Ga0307409_102579873
1162 Ga0307416_100092134
1163 Ga0307416_100331466
1164 Ga0307416_101164053
1165 Ga0307416_102812131
1166 Ga0307414_10057307
1167 Ga0307414_11194675
1168 Ga0307411_10007312
1169 Ga0307411_10316229
1170 Ga0307411_11277282
1171 Ga0307415_100542034
1172 Ga0307415_100951606
1173 Ga0316583_10021503
1174 Ga0316583_10116422
1175 Ga0316583_10166074
1176 Ga0316585_10065354
1177 Ga0316592_1061409
1178 Ga0316586_1000616
1179 Ga0316588_1011977
1180 Ga0316587_1000391
1181 Ga0373926_0037475
1182 Ga0373923_0161701
1183 Ga0373954_0020909
1184 Ga0373956_0045512
1185 Ga0373955_0286845
1186 Ga0316574_0151834
1187 Ga0316574_0504257
1188 Ga0373935_0184872
1189 Ga0373927_0009833
1190 Ga0373933_0320293
1191 Ga0373947_0031397
1192 Ga0373937_0534161
1193 Ga0316582_1061143
1194 Ga0316584_0127263
1195 Ga0316584_0905818
1196 Ga0395905_1045413
1197 Ga0242420_003262
1198 Ga0436365_0042402
1199 Ga0436365_0659853
1200 Ga0450914_049286
1201 Ga0450890_026173
1202 Ga0439464_0027515
1203 Ga0451577_0330204
1204 Ga0453683_0010074
1205 Ga0453684_0002708
1206 Ga0451576_0065901
1207 Ga0451576_0151694
1208 Ga0451576_0765764
1209 Ga0451576_1231357
1210 Ga0451576_1314377
1211 Ga0495651_0060052
1212 Ga0495580_0000381
1213 Ga0495632_0070935
1214 Ga0495663_0003270
1215 Ga0495598_0000613
1216 Ga0495621_0000644
1217 Ga0495667_0301849
1218 Ga0495656_0106712
1219 Ga0495613_0170632
1220 Ga0495636_0104233
1221 Ga0495674_0071622
1222 Ga0495672_0225713
1223 Ga0495593_0290798
1224 Ga0495602_0558250
1225 Ga0496101_0406328
1226 Ga0496101_0525711
1227 Ga0496102_0306563
1228 Ga0496103_0088544
1229 Ga0496104_0027206
1230 Ga0496106_0022105
1231 Ga0496106_0275149
1232 Ga0496108_0184384
1233 Ga0496108_0867941
1234 Ga0496108_1485687
1235 Ga0496109_0480689
1236 Ga0501291_097411
1237 Ga0501294_031516
1238 Ga0501216_137498
1239 Ga0501227_024195
1240 Ga0501233_014314
1241 Ga0501235_159834
1242 Ga0501239_002687
1243 Ga0501240_048782
1244 Ga0501247_009133
1245 Ga0501248_014631
1246 Ga0501250_040135
1247 Ga0501225_0028546
1248 Ga0501229_007847
1249 Ga0501080_0359714
1250 Ga0501267_037412
1251 Ga0501270_110918
1252 Ga0501279_009421
1253 Ga0501283_059775
1254 Ga0501226_007840
1255 nmdc:mga05p37_141015_c1
1256 nmdc:mga05p37_1730763_c1
1257 nmdc:mga06r32_364210_c1
1258 nmdc:mga08y16_59840_c1
1259 nmdc:mga0n895_207436_c1
1260 nmdc:mga0n895_285729_c1
1261 nmdc:mga0n895_31225_c1
1262 nmdc:mga0rr50_1682805_c1
1263 nmdc:mga0rr50_235506_c1
1264 nmdc:mga0a205_112358_c1
1265 nmdc:mga0a205_17518_c1
1266 nmdc:mga0a205_183533_c1
1267 nmdc:mga0a205_250193_c1
1268 nmdc:mga0a205_295250_c1
1269 nmdc:mga0a205_627773_c1
1270 nmdc:mga0a205_66330_c1
1271 2753359007
1272 2837652619
1273 2854914526
1274 2915651513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

21

155

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nck-assembly1.cif.gz_R crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution 0.9969 3 137
6aes-assembly2.cif.gz_B crystal structure of nucleoside diphosphate kinase from pseudomonas aeruginosa at 3.55 a resolution. 0.9937 3 137
4ek2-assembly1.cif.gz_A the structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis bound to deoxyadenosine monophosphate 0.9935 3 137
5v6d-assembly3.cif.gz_F crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate 0.9933 3 137
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9928 3 137
ID Description Score Start End Superfamily
af_Q6Z7E5_29_180_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9896 3 132 3.30.70.141
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9871 3 137 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.986 3 137 3.30.70.141
af_A4IG45_154_309_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9849 3 132 3.30.70.141
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9783 3 138 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A3M1S670-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.004 3 138 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A3M2CU60-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.004 3 138 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A2N6EU76-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.002 3 138 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A2D7MEP1-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.002 2 138 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-C8X4V1-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 1.001 3 138 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872

Map