F471364

General Info

Members Datasets Scaffolds Average Seq Length
636 268 1272 139

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0120094|Ga0466966_0120094_868_1347
Length 159
Sequence MTESRTEETVNSIQNEIEDRLSQAAPEVEVLLAEVVGGETLRLFIDHPQGVTLDLCEQVSQLLTDYRDRYALEVSSPGQDRPLTRPGHYSRFLGRRAKVRLREAPAPAGEALPSQLVGHKSVTGELVGASDVEVTIAAPEGVVAIPYSQIVRSNLEPGD

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
194 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
198 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
199 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
200 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
201 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 2.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.28
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0120094 3300044684 Bacteria 1615
2 JGI24739J22299_10069332 3300001989 Unclassified 1099
3 JGI24739J22299_10112775 3300001989 Bacteria 815
4 JGI24743J22301_10008359 3300001991 Bacteria 1815
5 JGI24735J21928_10093463 3300002067 Bacteria 863
6 JGI24738J21930_10053675 3300002075 Bacteria 823
7 JGI24744J21845_10037001 3300002077 Unclassified 920
8 JGI24742J22300_10023420 3300002244 Bacteria 1061
9 JGI25406J46586_10014933 3300003203 Bacteria 3288
10 Ga0070683_100066088 3300005329 Bacteria 3368
11 Ga0070683_100361451 3300005329 Bacteria 1382
12 Ga0070683_100923162 3300005329 Bacteria 838
13 Ga0070683_100925442 3300005329 Bacteria 836
14 Ga0070690_100312136 3300005330 Bacteria 1130
15 Ga0070690_100325688 3300005330 Bacteria 1109
16 Ga0070670_100233516 3300005331 Bacteria 1601
17 Ga0068869_100032304 3300005334 Bacteria 3688
18 Ga0070666_10230724 3300005335 Bacteria 1307
19 Ga0070680_100915776 3300005336 Bacteria 756
20 Ga0070680_101105561 3300005336 Bacteria 685
21 Ga0070682_100006422 3300005337 Bacteria 6606
22 Ga0070682_100162361 3300005337 Bacteria 1544
23 Ga0070682_100470989 3300005337 Bacteria 967
24 Ga0068868_100140880 3300005338 Bacteria 1979
25 Ga0070660_100146711 3300005339 Bacteria 1895
26 Ga0070660_100326173 3300005339 Bacteria 1262
27 Ga0070660_101093373 3300005339 Unclassified 675
28 Ga0070689_100086027 3300005340 Bacteria 2472
29 Ga0070689_100266550 3300005340 Bacteria 1417
30 Ga0070691_10037557 3300005341 Bacteria 2285
31 Ga0070691_10399784 3300005341 Bacteria 774
32 Ga0070687_100519041 3300005343 Bacteria 805
33 Ga0070661_100181922 3300005344 Bacteria 1599
34 Ga0070661_100283504 3300005344 Bacteria 1286
35 Ga0070661_101700001 3300005344 Unclassified 535
36 Ga0070692_10062670 3300005345 Bacteria 1962
37 Ga0070692_10156640 3300005345 Bacteria 1301
38 Ga0070668_100171744 3300005347 Bacteria 1765
39 Ga0070668_100400194 3300005347 Bacteria 1172
40 Ga0070668_100524790 3300005347 Bacteria 1028
41 Ga0070669_100094857 3300005353 Bacteria 2242
42 Ga0070669_100128239 3300005353 Bacteria 1943
43 Ga0070675_100258695 3300005354 Bacteria 1525
44 Ga0070671_100188600 3300005355 Bacteria 1747
45 Ga0070671_100501969 3300005355 Bacteria 1044
46 Ga0070671_100553726 3300005355 Bacteria 992
47 Ga0070673_100554252 3300005364 Bacteria 1044
48 Ga0070673_100756535 3300005364 Bacteria 895
49 Ga0070688_100159512 3300005365 Bacteria 1549
50 Ga0070688_100945025 3300005365 Bacteria 682
51 Ga0070659_100069415 3300005366 Bacteria 2797
52 Ga0070659_100114889 3300005366 Bacteria 2175
53 Ga0070659_100116677 3300005366 Bacteria 2158
54 Ga0070659_100906596 3300005366 Bacteria 770
55 Ga0070667_100646797 3300005367 Bacteria 976
56 Ga0070667_100664520 3300005367 Unclassified 963
57 Ga0070703_10050500 3300005406 Bacteria 1328
58 Ga0070713_101601171 3300005436 Bacteria 632
59 Ga0070710_10291660 3300005437 Bacteria 1062
60 Ga0070701_10053010 3300005438 Bacteria 2110
61 Ga0070701_10139314 3300005438 Bacteria 1386
62 Ga0070711_100000367 3300005439 Bacteria 23337
63 Ga0070711_100164576 3300005439 Bacteria 1685
64 Ga0070711_100837913 3300005439 Bacteria 782
65 Ga0070700_100059772 3300005441 Bacteria 2400
66 Ga0070700_100062524 3300005441 Bacteria 2352
67 Ga0070700_100308166 3300005441 Bacteria 1158
68 Ga0070694_100106751 3300005444 Bacteria 1989
69 Ga0070694_100379021 3300005444 Bacteria 1103
70 Ga0070678_100066822 3300005456 Bacteria 2674
71 Ga0070678_100210025 3300005456 Bacteria 1612
72 Ga0070678_100583612 3300005456 Bacteria 996
73 Ga0070662_100139724 3300005457 Bacteria 1876
74 Ga0070662_100208065 3300005457 Bacteria 1555
75 Ga0070662_100221420 3300005457 Bacteria 1510
76 Ga0070662_100415148 3300005457 Bacteria 1112
77 Ga0068867_100131470 3300005459 Bacteria 1946
78 Ga0068867_101118244 3300005459 Unclassified 720
79 Ga0068867_102309356 3300005459 Bacteria 511
80 Ga0070685_10014072 3300005466 Bacteria 4232
81 Ga0070679_100798507 3300005530 Bacteria 887
82 Ga0070679_101038708 3300005530 Bacteria 764
83 Ga0070684_100001966 3300005535 Bacteria 15097
84 Ga0070684_100569788 3300005535 Bacteria 1052
85 Ga0070684_100593593 3300005535 Bacteria 1029
86 Ga0070684_100697029 3300005535 Bacteria 947
87 Ga0070684_101032585 3300005535 Bacteria 772
88 Ga0070684_101352055 3300005535 Unclassified 671
89 Ga0070686_100176461 3300005544 Bacteria 1515
90 Ga0070686_100203706 3300005544 Bacteria 1420
91 Ga0070686_100470694 3300005544 Bacteria 970
92 Ga0070695_100409008 3300005545 Bacteria 1030
93 Ga0070695_100561273 3300005545 Bacteria 891
94 Ga0070695_100966419 3300005545 Bacteria 691
95 Ga0070696_100519992 3300005546 Bacteria 949
96 Ga0070693_100456717 3300005547 Unclassified 898
97 Ga0070665_100001256 3300005548 Bacteria 30586
98 Ga0070665_100056592 3300005548 Bacteria 3932
99 Ga0070665_100276697 3300005548 Bacteria 1680
100 Ga0070665_100854769 3300005548 Unclassified 923
101 Ga0070704_100391459 3300005549 Bacteria 1183
102 Ga0070704_100597704 3300005549 Bacteria 969
103 Ga0070704_101110443 3300005549 Unclassified 718
104 Ga0070664_100094147 3300005564 Bacteria 2597
105 Ga0070664_100115968 3300005564 Bacteria 2342
106 Ga0070664_100205565 3300005564 Bacteria 1758
107 Ga0070664_100230612 3300005564 Bacteria 1659
108 Ga0070664_100422005 3300005564 Bacteria 1222
109 Ga0070664_101025360 3300005564 Bacteria 776
110 Ga0068857_100207872 3300005577 Bacteria 1785
111 Ga0068857_100244390 3300005577 Bacteria 1644
112 Ga0068857_100266838 3300005577 Bacteria 1572
113 Ga0068857_100511366 3300005577 Bacteria 1128
114 Ga0068854_100062536 3300005578 Bacteria 2699
115 Ga0068854_100175881 3300005578 Bacteria 1669
116 Ga0068854_100175942 3300005578 Bacteria 1668
117 Ga0068854_100508380 3300005578 Bacteria 1016
118 Ga0068854_100822207 3300005578 Unclassified 811
119 Ga0068856_100023629 3300005614 Bacteria 5977
120 Ga0068856_100123932 3300005614 Bacteria 2586
121 Ga0068856_100679938 3300005614 Bacteria 1050
122 Ga0070702_100013885 3300005615 Bacteria 4077
123 Ga0070702_100042146 3300005615 Bacteria 2565
124 Ga0070702_100086641 3300005615 Bacteria 1889
125 Ga0070702_100171480 3300005615 Bacteria 1412
126 Ga0070702_101132462 3300005615 Bacteria 627
127 Ga0068852_100199378 3300005616 Bacteria 1893
128 Ga0068852_100283100 3300005616 Bacteria 1599
129 Ga0068852_100479026 3300005616 Bacteria 1236
130 Ga0068852_100791890 3300005616 Bacteria 962
131 Ga0068852_100842114 3300005616 Bacteria 932
132 Ga0068859_100220690 3300005617 Bacteria 1983
133 Ga0068859_100843717 3300005617 Bacteria 1002
134 Ga0068859_102757768 3300005617 Bacteria 540
135 Ga0068864_100141582 3300005618 Bacteria 2170
136 Ga0068864_100275305 3300005618 Bacteria 1569
137 Ga0068864_100305494 3300005618 Bacteria 1490
138 Ga0068864_100491205 3300005618 Bacteria 1180
139 Ga0068864_100707341 3300005618 Bacteria 985
140 Ga0068866_10109821 3300005718 Bacteria 1536
141 Ga0068866_10580002 3300005718 Bacteria 754
142 Ga0068861_100006023 3300005719 Bacteria 8244
143 Ga0068861_100379116 3300005719 Bacteria 1249
144 Ga0068861_100790611 3300005719 Bacteria 890
145 Ga0068851_10144282 3300005834 Bacteria 1297
146 Ga0068851_10155568 3300005834 Bacteria 1252
147 Ga0068851_10554998 3300005834 Unclassified 694
148 Ga0068870_10211591 3300005840 Bacteria 1181
149 Ga0068870_10295333 3300005840 Bacteria 1021
150 Ga0068870_10377519 3300005840 Bacteria 917
151 Ga0068870_10535345 3300005840 Unclassified 786
152 Ga0068863_100351378 3300005841 Bacteria 1436
153 Ga0068863_100438684 3300005841 Bacteria 1280
154 Ga0068863_100460677 3300005841 Bacteria 1249
155 Ga0068863_100940139 3300005841 Bacteria 866
156 Ga0068858_100199507 3300005842 Bacteria 1891
157 Ga0068858_100319149 3300005842 Bacteria 1484
158 Ga0068858_100735666 3300005842 Bacteria 961
159 Ga0068860_100199283 3300005843 Bacteria 1939
160 Ga0068860_100475053 3300005843 Bacteria 1245
161 Ga0068860_100910482 3300005843 Bacteria 896
162 Ga0068862_100110346 3300005844 Bacteria 2414
163 Ga0068862_100728878 3300005844 Bacteria 963
164 Ga0068862_100955003 3300005844 Bacteria 845
165 Ga0081538_10007594 3300005981 Bacteria 9353
166 Ga0081539_10009210 3300005985 Bacteria 8315
167 Ga0081539_10029940 3300005985 Bacteria 3390
168 Ga0070712_100092002 3300006175 Bacteria 2224
169 Ga0070712_100508208 3300006175 Bacteria 1011
170 Ga0097621_101067903 3300006237 Bacteria 757
171 Ga0068871_100314717 3300006358 Bacteria 1377
172 Ga0068871_100471609 3300006358 Bacteria 1128
173 Ga0068871_100825878 3300006358 Bacteria 856
174 Ga0075431_100080776 3300006847 Bacteria 3357
175 Ga0075433_10483610 3300006852 Bacteria 1090
176 Ga0075433_10612445 3300006852 Bacteria 956
177 Ga0075434_100047180 3300006871 Bacteria 4275
178 Ga0075434_100600399 3300006871 Unclassified 1120
179 Ga0068865_100012531 3300006881 Bacteria 5339
180 Ga0068865_100119003 3300006881 Bacteria 1961
181 Ga0075436_100166067 3300006914 Bacteria 1557
182 Ga0097620_100220688 3300006931 Bacteria 1983
183 Ga0097620_100843701 3300006931 Bacteria 1002
184 Ga0097620_102757691 3300006931 Bacteria 540
185 Ga0075435_100032865 3300007076 Bacteria 4099
186 Ga0105250_10110453 3300009092 Bacteria 1126
187 Ga0105240_10182388 3300009093 Bacteria 2476
188 Ga0105240_11211530 3300009093 Unclassified 799
189 Ga0111539_10056400 3300009094 Bacteria 4669
190 Ga0111539_10323779 3300009094 Bacteria 1794
191 Ga0111539_11198218 3300009094 Bacteria 882
192 Ga0105245_10020437 3300009098 Bacteria 5807
193 Ga0105245_10508098 3300009098 Bacteria 1222
194 Ga0105245_10523221 3300009098 Bacteria 1205
195 Ga0105245_10711274 3300009098 Bacteria 1038
196 Ga0105247_10026849 3300009101 Bacteria 3480
197 Ga0105247_10097116 3300009101 Bacteria 1879
198 Ga0105247_10120304 3300009101 Bacteria 1701
199 Ga0105247_10191504 3300009101 Bacteria 1369
200 Ga0114129_10799730 3300009147 Bacteria 1203
201 Ga0114129_10971552 3300009147 Unclassified 1071
202 Ga0114129_13213953 3300009147 Bacteria 531
203 Ga0105243_10103297 3300009148 Bacteria 2370
204 Ga0105243_10113573 3300009148 Bacteria 2271
205 Ga0105243_10571099 3300009148 Bacteria 1084
206 Ga0105243_10727534 3300009148 Bacteria 970
207 Ga0105243_12798407 3300009148 Bacteria 528
208 Ga0105241_10201979 3300009174 Bacteria 1661
209 Ga0105241_10455802 3300009174 Bacteria 1132
210 Ga0105242_10041055 3300009176 Bacteria 3729
211 Ga0105242_11218295 3300009176 Bacteria 773
212 Ga0105248_10161812 3300009177 Bacteria 2524
213 Ga0105248_10286547 3300009177 Bacteria 1854
214 Ga0105248_10467584 3300009177 Bacteria 1422
215 Ga0105237_10453656 3300009545 Bacteria 1288
216 Ga0105238_10709603 3300009551 Bacteria 1018
217 Ga0105249_10050163 3300009553 Bacteria 3805
218 Ga0105249_10107100 3300009553 Bacteria 2638
219 Ga0105249_10223712 3300009553 Bacteria 1853
220 Ga0105249_10774469 3300009553 Bacteria 1022
221 Ga0105249_11702291 3300009553 Unclassified 703
222 Ga0105239_10002616 3300010375 Bacteria 22778
223 Ga0105239_10266236 3300010375 Bacteria 1927
224 Ga0105239_10357963 3300010375 Bacteria 1648
225 Ga0105239_10896295 3300010375 Bacteria 1018
226 Ga0105246_10028864 3300011119 Bacteria 3647
227 Ga0105246_10286149 3300011119 Bacteria 1324
228 Ga0105246_10312067 3300011119 Bacteria 1274
229 Ga0105246_10889854 3300011119 Bacteria 797
230 Ga0157371_10520884 3300013102 Bacteria 879
231 Ga0157369_10276682 3300013105 Bacteria 1748
232 Ga0157369_10345210 3300013105 Bacteria 1546
233 Ga0157369_10357660 3300013105 Bacteria 1516
234 Ga0157369_10619625 3300013105 Bacteria 1116
235 Ga0157374_10011836 3300013296 Bacteria 7568
236 Ga0157374_10157345 3300013296 Bacteria 2212
237 Ga0157374_10505258 3300013296 Bacteria 1214
238 Ga0157378_10781061 3300013297 Archaea 980
239 Ga0163162_10214251 3300013306 Bacteria 2056
240 Ga0163162_10471269 3300013306 Bacteria 1387
241 Ga0163162_10500713 3300013306 Bacteria 1345
242 Ga0163162_10506354 3300013306 Bacteria 1338
243 Ga0163162_10897262 3300013306 Bacteria 1000
244 Ga0157372_10003197 3300013307 Bacteria 17685
245 Ga0157372_10683466 3300013307 Bacteria 1195
246 Ga0157372_10773204 3300013307 Bacteria 1116
247 Ga0157372_11128318 3300013307 Bacteria 907
248 Ga0157372_11589474 3300013307 Unclassified 753
249 Ga0157372_12810656 3300013307 Unclassified 558
250 Ga0157375_10834691 3300013308 Bacteria 1069
251 Ga0163163_10361125 3300014325 Bacteria 1509
252 Ga0163163_10420252 3300014325 Bacteria 1396
253 Ga0163163_10635199 3300014325 Bacteria 1131
254 Ga0163163_10876002 3300014325 Bacteria 961
255 Ga0163163_10880617 3300014325 Unclassified 959
256 Ga0163163_11178721 3300014325 Bacteria 829
257 Ga0157380_10082358 3300014326 Bacteria 2634
258 Ga0157380_10336350 3300014326 Bacteria 1406
259 Ga0157377_10001602 3300014745 Bacteria 9842
260 Ga0157377_10474705 3300014745 Unclassified 869
261 Ga0157377_10669982 3300014745 Bacteria 749
262 Ga0157379_10289810 3300014968 Bacteria 1491
263 Ga0157376_10374164 3300014969 Bacteria 1370
264 Ga0157376_10823037 3300014969 Bacteria 942
265 Ga0163161_10188814 3300017792 Bacteria 1583
266 Ga0163161_11344090 3300017792 Bacteria 622
267 Ga0197907_10212870 3300020069 Bacteria 517
268 Ga0206356_10141367 3300020070 Bacteria 567
269 Ga0206356_11821022 3300020070 Bacteria 700
270 Ga0206349_1345920 3300020075 Bacteria 830
271 Ga0206351_10224249 3300020077 Unclassified 597
272 Ga0206350_10628971 3300020080 Unclassified 648
273 Ga0206354_10306677 3300020081 Bacteria 1064
274 Ga0206354_11655099 3300020081 Bacteria 937
275 Ga0206353_11019103 3300020082 Unclassified 801
276 Ga0206353_11515756 3300020082 Bacteria 1150
277 Ga0224712_10391376 3300022467 Unclassified 662
278 Ga0207656_10374439 3300025321 Bacteria 713
279 Ga0207656_10589771 3300025321 Bacteria 567
280 Ga0207692_10205471 3300025898 Bacteria 1160
281 Ga0207642_10065087 3300025899 Bacteria 1711
282 Ga0207710_10025830 3300025900 Bacteria 2536
283 Ga0207710_10508460 3300025900 Bacteria 625
284 Ga0207688_10004242 3300025901 Bacteria 7814
285 Ga0207688_10044740 3300025901 Bacteria 2467
286 Ga0207688_10092659 3300025901 Bacteria 1737
287 Ga0207688_10246775 3300025901 Bacteria 1081
288 Ga0207680_10216890 3300025903 Bacteria 1310
289 Ga0207647_10138224 3300025904 Bacteria 1429
290 Ga0207647_10160053 3300025904 Bacteria 1314
291 Ga0207643_10044473 3300025908 Bacteria 2507
292 Ga0207643_10469406 3300025908 Bacteria 802
293 Ga0207705_10902194 3300025909 Bacteria 685
294 Ga0207705_11057467 3300025909 Bacteria 626
295 Ga0207693_10016442 3300025915 Bacteria 5911
296 Ga0207693_10315791 3300025915 Unclassified 1223
297 Ga0207663_10004281 3300025916 Bacteria 7084
298 Ga0207663_10151194 3300025916 Bacteria 1629
299 Ga0207663_10226512 3300025916 Bacteria 1363
300 Ga0207660_10279663 3300025917 Bacteria 1324
301 Ga0207662_10066864 3300025918 Bacteria 2166
302 Ga0207662_10549713 3300025918 Bacteria 799
303 Ga0207657_10065951 3300025919 Bacteria 3083
304 Ga0207657_10276110 3300025919 Bacteria 1335
305 Ga0207649_10212326 3300025920 Bacteria 1374
306 Ga0207649_10308927 3300025920 Bacteria 1158
307 Ga0207649_10365714 3300025920 Bacteria 1071
308 Ga0207652_10282047 3300025921 Bacteria 1499
309 Ga0207652_10377981 3300025921 Bacteria 1279
310 Ga0207681_10228589 3300025923 Bacteria 1443
311 Ga0207681_10241651 3300025923 Bacteria 1406
312 Ga0207694_10581404 3300025924 Bacteria 941
313 Ga0207694_10740456 3300025924 Unclassified 829
314 Ga0207659_11486452 3300025926 Bacteria 580
315 Ga0207687_10020288 3300025927 Bacteria 4409
316 Ga0207687_10131181 3300025927 Bacteria 1889
317 Ga0207687_10251287 3300025927 Bacteria 1406
318 Ga0207687_10402996 3300025927 Bacteria 1125
319 Ga0207687_10953952 3300025927 Unclassified 735
320 Ga0207644_10136281 3300025931 Bacteria 1885
321 Ga0207644_10801637 3300025931 Bacteria 788
322 Ga0207644_11640517 3300025931 Unclassified 539
323 Ga0207690_10170456 3300025932 Bacteria 1630
324 Ga0207690_10220301 3300025932 Bacteria 1451
325 Ga0207690_10681431 3300025932 Bacteria 844
326 Ga0207690_10930542 3300025932 Bacteria 722
327 Ga0207706_10056263 3300025933 Bacteria 3469
328 Ga0207706_10125302 3300025933 Bacteria 2259
329 Ga0207706_10127348 3300025933 Bacteria 2239
330 Ga0207706_10564352 3300025933 Bacteria 979
331 Ga0207686_10305277 3300025934 Bacteria 1183
332 Ga0207686_10345508 3300025934 Bacteria 1119
333 Ga0207686_10753103 3300025934 Bacteria 778
334 Ga0207709_10064571 3300025935 Bacteria 2299
335 Ga0207709_10115267 3300025935 Bacteria 1804
336 Ga0207709_10406118 3300025935 Bacteria 1043
337 Ga0207709_10710042 3300025935 Bacteria 805
338 Ga0207670_10478970 3300025936 Bacteria 1008
339 Ga0207669_10078022 3300025937 Bacteria 2109
340 Ga0207669_10513216 3300025937 Bacteria 961
341 Ga0207669_10636112 3300025937 Bacteria 871
342 Ga0207704_10031211 3300025938 Bacteria 2999
343 Ga0207704_10125165 3300025938 Bacteria 1768
344 Ga0207704_10474112 3300025938 Bacteria 1003
345 Ga0207704_10674845 3300025938 Bacteria 853
346 Ga0207665_10939523 3300025939 Bacteria 687
347 Ga0207711_10095580 3300025941 Bacteria 2621
348 Ga0207711_10324459 3300025941 Bacteria 1423
349 Ga0207711_10566472 3300025941 Bacteria 1060
350 Ga0207689_10043192 3300025942 Bacteria 3726
351 Ga0207689_10093438 3300025942 Bacteria 2471
352 Ga0207689_10425166 3300025942 Bacteria 1109
353 Ga0207661_10027862 3300025944 Bacteria 4321
354 Ga0207661_10147345 3300025944 Bacteria 2032
355 Ga0207661_10420505 3300025944 Bacteria 1214
356 Ga0207661_10553762 3300025944 Bacteria 1054
357 Ga0207661_10571891 3300025944 Bacteria 1036
358 Ga0207661_10686199 3300025944 Unclassified 942
359 Ga0207679_10057793 3300025945 Bacteria 2871
360 Ga0207679_10078806 3300025945 Bacteria 2510
361 Ga0207679_10204220 3300025945 Bacteria 1653
362 Ga0207679_10251448 3300025945 Bacteria 1503
363 Ga0207679_10317574 3300025945 Bacteria 1348
364 Ga0207712_10311337 3300025961 Bacteria 1296
365 Ga0207712_10339826 3300025961 Bacteria 1245
366 Ga0207712_10921407 3300025961 Unclassified 773
367 Ga0207668_10021649 3300025972 Bacteria 4103
368 Ga0207668_10026935 3300025972 Bacteria 3740
369 Ga0207668_10166741 3300025972 Bacteria 1723
370 Ga0207668_10286222 3300025972 Bacteria 1354
371 Ga0207640_10065376 3300025981 Bacteria 2426
372 Ga0207640_10254392 3300025981 Bacteria 1365
373 Ga0207640_10262781 3300025981 Bacteria 1346
374 Ga0207640_10501463 3300025981 Bacteria 1011
375 Ga0207640_10549166 3300025981 Bacteria 970
376 Ga0207658_10172158 3300025986 Bacteria 1785
377 Ga0207658_11082910 3300025986 Bacteria 732
378 Ga0207677_10134778 3300026023 Bacteria 1881
379 Ga0207677_10174558 3300026023 Bacteria 1684
380 Ga0207677_10335143 3300026023 Bacteria 1262
381 Ga0207677_10517704 3300026023 Bacteria 1034
382 Ga0207677_10615276 3300026023 Bacteria 955
383 Ga0207703_10131144 3300026035 Bacteria 2164
384 Ga0207703_10586975 3300026035 Bacteria 1053
385 Ga0207639_10238412 3300026041 Bacteria 1580
386 Ga0207639_10261363 3300026041 Bacteria 1514
387 Ga0207639_10668978 3300026041 Bacteria 961
388 Ga0207678_10219823 3300026067 Bacteria 1626
389 Ga0207678_10223288 3300026067 Bacteria 1613
390 Ga0207678_10423307 3300026067 Bacteria 1155
391 Ga0207708_10000450 3300026075 Bacteria 31989
392 Ga0207708_10132186 3300026075 Bacteria 1952
393 Ga0207708_10391064 3300026075 Bacteria 1148
394 Ga0207708_10478975 3300026075 Bacteria 1040
395 Ga0207702_10381117 3300026078 Bacteria 1356
396 Ga0207702_10922346 3300026078 Unclassified 866
397 Ga0207641_10374103 3300026088 Bacteria 1363
398 Ga0207641_10843192 3300026088 Bacteria 908
399 Ga0207641_10990460 3300026088 Bacteria 837
400 Ga0207648_10324912 3300026089 Bacteria 1383
401 Ga0207648_10770982 3300026089 Bacteria 894
402 Ga0207648_11156328 3300026089 Bacteria 726
403 Ga0207648_11608753 3300026089 Unclassified 611
404 Ga0207676_10304603 3300026095 Bacteria 1456
405 Ga0207676_10410192 3300026095 Bacteria 1268
406 Ga0207676_10894854 3300026095 Bacteria 870
407 Ga0207676_11011052 3300026095 Bacteria 819
408 Ga0207676_12079246 3300026095 Unclassified 566
409 Ga0207674_10308999 3300026116 Bacteria 1530
410 Ga0207674_10381746 3300026116 Bacteria 1362
411 Ga0207674_10631390 3300026116 Bacteria 1034
412 Ga0207675_100005544 3300026118 Bacteria 12074
413 Ga0207675_100237160 3300026118 Bacteria 1761
414 Ga0207675_100315517 3300026118 Bacteria 1525
415 Ga0207683_10018666 3300026121 Bacteria 5919
416 Ga0207683_10139370 3300026121 Bacteria 2185
417 Ga0207683_10148919 3300026121 Bacteria 2112
418 Ga0207683_10197196 3300026121 Bacteria 1829
419 Ga0207698_10033920 3300026142 Bacteria 3714
420 Ga0207698_10121045 3300026142 Bacteria 2215
421 Ga0207698_10222650 3300026142 Bacteria 1706
422 Ga0207698_10494887 3300026142 Bacteria 1189
423 Ga0207428_10164034 3300027907 Bacteria 1686
424 Ga0268266_10019735 3300028379 Bacteria 5744
425 Ga0268266_10425707 3300028379 Bacteria 1259
426 Ga0268266_11604293 3300028379 Bacteria 626
427 Ga0268266_11939692 3300028379 Bacteria 563
428 Ga0268265_10254408 3300028380 Bacteria 1558
429 Ga0268264_10581115 3300028381 Bacteria 1102
430 Ga0268264_11212268 3300028381 Bacteria 764
431 Ga0265338_10023293 3300028800 Bacteria 6372
432 Ga0307405_10022127 3300031731 Bacteria 3589
433 Ga0307405_10173847 3300031731 Bacteria 1539
434 Ga0307405_10565217 3300031731 Bacteria 923
435 Ga0307405_11373449 3300031731 Unclassified 617
436 Ga0307413_10366877 3300031824 Bacteria 1117
437 Ga0307413_10623289 3300031824 Bacteria 886
438 Ga0307410_10121788 3300031852 Bacteria 1903
439 Ga0307406_10043836 3300031901 Bacteria 2800
440 Ga0307406_10208958 3300031901 Bacteria 1443
441 Ga0307406_10232893 3300031901 Bacteria 1377
442 Ga0307406_10274620 3300031901 Unclassified 1282
443 Ga0307406_10653339 3300031901 Bacteria 873
444 Ga0307407_10225183 3300031903 Unclassified 1270
445 Ga0307407_10245347 3300031903 Bacteria 1224
446 Ga0307407_10273008 3300031903 Bacteria 1168
447 Ga0307407_10558955 3300031903 Bacteria 847
448 Ga0307407_10586438 3300031903 Bacteria 828
449 Ga0307412_10076009 3300031911 Bacteria 2306
450 Ga0307409_100050108 3300031995 Bacteria 3187
451 Ga0307409_100262418 3300031995 Bacteria 1586
452 Ga0307409_100743400 3300031995 Bacteria 984
453 Ga0307409_100880378 3300031995 Bacteria 908
454 Ga0307416_100023650 3300032002 Bacteria 4464
455 Ga0307416_101545683 3300032002 Bacteria 769
456 Ga0307416_102032165 3300032002 Bacteria 677
457 Ga0307416_102179951 3300032002 Unclassified 655
458 Ga0307414_10023938 3300032004 Bacteria 3884
459 Ga0307414_10613890 3300032004 Unclassified 977
460 Ga0307415_100039447 3300032126 Bacteria 3121
461 Ga0307415_100049024 3300032126 Bacteria 2852
462 Ga0307415_100095083 3300032126 Unclassified 2168
463 Ga0307415_101890859 3300032126 Bacteria 579
464 Ga0373939_0040585 3300035114 Bacteria 1399
465 Ga0373941_0157445 3300035115 Bacteria 838
466 Ga0373961_0380401 3300035241 Bacteria 538
467 Ga0373931_0888522 3300035691 Bacteria 598
468 Ga0373933_0509034 3300035724 Bacteria 789
469 Ga0373947_0014312 3300035725 Bacteria 4550
470 Ga0373937_1502481 3300036401 Bacteria 621
471 Ga0395899_0189184 3300037312 Bacteria 1441
472 Ga0395900_0491085 3300037418 Bacteria 1179
473 Ga0395898_0527477 3300037466 Bacteria 1122
474 Ga0395898_1091605 3300037466 Bacteria 732
475 Ga0395905_0398099 3300037471 Bacteria 1272
476 Ga0395905_0823683 3300037471 Bacteria 831
477 Ga0395901_0021401 3300038443 Bacteria 6625
478 Ga0395901_0545265 3300038443 Bacteria 1176
479 Ga0395901_1831067 3300038443 Bacteria 556
480 Ga0436365_1708835 3300039437 Bacteria 801
481 Ga0436363_0355758 3300039450 Bacteria 3967
482 Ga0439453_0096402 3300041408 Bacteria 655
483 Ga0451789_0481833 3300041443 Bacteria 654
484 Ga0451853_1347858 3300041512 Bacteria 816
485 Ga0451853_3911200 3300041512 Bacteria 837
486 Ga0439448_0058643 3300042005 Bacteria 1270
487 Ga0439456_048292 3300042013 Bacteria 929
488 Ga0439444_0008257 3300042437 Bacteria 1620
489 Ga0439464_0015376 3300042439 Bacteria 2065
490 Ga0439460_0011603 3300042461 Bacteria 2275
491 Ga0450916_003157 3300042530 Bacteria 1797
492 Ga0466972_0015132 3300044658 Bacteria 3857
493 Ga0466965_0118986 3300044683 Bacteria 1363
494 Ga0466965_0234393 3300044683 Bacteria 981
495 Ga0466961_0605815 3300044693 Bacteria 658
496 Ga0466963_0015124 3300044694 Bacteria 4771
497 Ga0466963_1286123 3300044694 Bacteria 513
498 Ga0466964_0004603 3300044706 Bacteria 5099
499 Ga0466964_0012121 3300044706 Bacteria 3260
500 Ga0466968_0008368 3300044735 Bacteria 3961
501 Ga0466968_0118124 3300044735 Bacteria 1198
502 Ga0466970_0105643 3300044765 Bacteria 1536
503 Ga0466957_0041037 3300044842 Bacteria 2798
504 Ga0466957_0070351 3300044842 Bacteria 2162
505 Ga0466960_0106585 3300044901 Bacteria 1450
506 Ga0466960_0252155 3300044901 Bacteria 981
507 Ga0466960_0375377 3300044901 Unclassified 815
508 Ga0466960_0462956 3300044901 Bacteria 738
509 Ga0466960_0681230 3300044901 Bacteria 615
510 Ga0466959_0043083 3300045049 Bacteria 3329
511 Ga0466959_0114215 3300045049 Bacteria 1925
512 Ga0466959_0267306 3300045049 Bacteria 1176
513 Ga0466959_0351845 3300045049 Bacteria 1004
514 Ga0466958_0123935 3300045836 Bacteria 1619
515 Ga0466958_0185210 3300045836 Bacteria 1322
516 Ga0466958_0207499 3300045836 Bacteria 1248
517 Ga0466958_0335452 3300045836 Bacteria 973
518 Ga0466958_0340710 3300045836 Bacteria 964
519 Ga0466967_0009259 3300045976 Bacteria 7295
520 Ga0466967_0009391 3300045976 Bacteria 7254
521 Ga0466967_0014579 3300045976 Bacteria 6129
522 Ga0466967_0464334 3300045976 Bacteria 1239
523 Ga0466967_1305037 3300045976 Bacteria 723
524 Ga0466967_1384853 3300045976 Unclassified 700
525 Ga0495653_0149045 3300046463 Bacteria 1636
526 Ga0495662_0087384 3300046476 Bacteria 1518
527 Ga0495584_0201475 3300046491 Bacteria 1012
528 Ga0495596_0396967 3300046500 Bacteria 537
529 Ga0495631_0230117 3300046518 Bacteria 791
530 Ga0495643_0378545 3300046522 Bacteria 628
531 Ga0495652_0341047 3300046529 Bacteria 1076
532 Ga0495665_0006170 3300046531 Bacteria 6472
533 Ga0495597_0156656 3300046542 Bacteria 932
534 Ga0495645_0001598 3300046543 Bacteria 15333
535 Ga0495645_0334439 3300046543 Bacteria 980
536 Ga0495646_0193639 3300046680 Bacteria 1110
537 Ga0495670_0692223 3300046691 Bacteria 556
538 Ga0495589_0144511 3300046794 Bacteria 1138
539 Ga0496100_0036301 3300048903 Bacteria 3107
540 Ga0496100_0243803 3300048903 Bacteria 1327
541 Ga0496100_0255950 3300048903 Bacteria 1297
542 Ga0496100_0568476 3300048903 Bacteria 878
543 Ga0496101_0519653 3300048904 Unclassified 941
544 Ga0496101_0571053 3300048904 Bacteria 894
545 Ga0496101_0777037 3300048904 Bacteria 755
546 Ga0496101_0811069 3300048904 Unclassified 738
547 Ga0496101_1238038 3300048904 Bacteria 584
548 Ga0496102_0104843 3300048905 Bacteria 2630
549 Ga0496102_0557149 3300048905 Bacteria 1069
550 Ga0496102_1133440 3300048905 Bacteria 702
551 Ga0496102_1753020 3300048905 Bacteria 538
552 Ga0496103_0520961 3300048906 Bacteria 760
553 Ga0496104_0086683 3300048907 Bacteria 2989
554 Ga0496104_0169680 3300048907 Bacteria 2092
555 Ga0496104_0273913 3300048907 Bacteria 1600
556 Ga0496105_0012943 3300048908 Bacteria 6611
557 Ga0496105_0386309 3300048908 Bacteria 1113
558 Ga0496105_0574590 3300048908 Unclassified 877
559 Ga0496106_0103748 3300048909 Bacteria 2207
560 Ga0496106_0251735 3300048909 Bacteria 1412
561 Ga0496106_0558253 3300048909 Bacteria 918
562 Ga0496107_0065246 3300048910 Bacteria 2639
563 Ga0496107_0184041 3300048910 Bacteria 1551
564 Ga0496108_0048030 3300048911 Bacteria 3568
565 Ga0496108_0069557 3300048911 Bacteria 2970
566 Ga0496108_0202028 3300048911 Bacteria 1725
567 Ga0496108_0212279 3300048911 Bacteria 1680
568 Ga0496108_0576656 3300048911 Bacteria 981
569 Ga0496108_1203781 3300048911 Bacteria 640
570 Ga0496109_0009337 3300048912 Bacteria 8357
571 Ga0496109_0029108 3300048912 Bacteria 4944
572 Ga0496109_0038061 3300048912 Bacteria 4348
573 Ga0496109_0163127 3300048912 Bacteria 2088
574 Ga0496109_0340186 3300048912 Bacteria 1417
575 Ga0496109_1043831 3300048912 Bacteria 755
576 Ga0496110_0045801 3300048913 Bacteria 3824
577 Ga0496110_0119448 3300048913 Bacteria 2374
578 Ga0496110_0256130 3300048913 Unclassified 1593
579 Ga0496110_0911090 3300048913 Bacteria 785
580 Ga0496110_1550480 3300048913 Unclassified 572
581 Ga0496111_0096533 3300048914 Bacteria 2169
582 Ga0496111_0147462 3300048914 Bacteria 1745
583 Ga0496111_0251256 3300048914 Bacteria 1312
584 Ga0496111_0305853 3300048914 Archaea 1178
585 Ga0496111_0595897 3300048914 Unclassified 809
586 Ga0496112_0002780 3300048915 Bacteria 14199
587 Ga0496112_0027717 3300048915 Bacteria 5463
588 Ga0496112_0104177 3300048915 Bacteria 2807
589 Ga0496113_0067005 3300048916 Bacteria 2720
590 Ga0496113_0077838 3300048916 Bacteria 2536
591 Ga0496113_0284699 3300048916 Bacteria 1322
592 Ga0496114_0564594 3300048917 Bacteria 1005
593 Ga0496114_1374140 3300048917 Bacteria 593
594 Ga0496114_1455432 3300048917 Bacteria 573
595 Ga0496114_1783545 3300048917 Unclassified 503
596 Ga0496115_0210906 3300048918 Bacteria 1604
597 Ga0501317_039137 3300049533 Bacteria 718
598 Ga0501317_103420 3300049533 Bacteria 516
599 Ga0501321_068795 3300049537 Bacteria 547
600 Ga0501323_065340 3300049539 Bacteria 574
601 Ga0501323_091004 3300049539 Bacteria 508
602 Ga0501031_0981000 3300049568 Bacteria 540
603 Ga0501034_0167433 3300049571 Bacteria 2166
604 Ga0501034_0268745 3300049571 Bacteria 1647
605 Ga0501034_0286674 3300049571 Bacteria 1586
606 Ga0501034_0720372 3300049571 Unclassified 895
607 Ga0501043_0358026 3300049579 Bacteria 1108
608 Ga0501046_0747853 3300049580 Bacteria 687
609 Ga0501067_0056167 3300049583 Bacteria 2182
610 Ga0501067_0067704 3300049583 Bacteria 1977
611 Ga0501069_0204181 3300049585 Bacteria 1146
612 Ga0501070_0513227 3300049586 Bacteria 962
613 Ga0501070_0710098 3300049586 Bacteria 795
614 Ga0501072_0430888 3300049588 Bacteria 1045
615 Ga0501076_0513552 3300049592 Bacteria 988
616 Ga0501083_0257353 3300049744 Bacteria 1136
617 Ga0501044_0057479 3300049823 Bacteria 3992
618 nmdc:mga05p37_61114_c1 3300050507 Bacteria 4638
619 nmdc:mga06r32_224989_c1 3300050510 Bacteria 1865
620 nmdc:mga08y16_1433725_c1 3300050511 Bacteria 653
621 nmdc:mga08y16_199752_c1 3300050511 Bacteria 2072
622 nmdc:mga08y16_47087_c1 3300050511 Bacteria 4514
623 nmdc:mga0n895_1292637_c1 3300050512 Unclassified 701
624 nmdc:mga0n895_17424_c1 3300050512 Bacteria 6619
625 nmdc:mga0rr50_1890692_c1 3300050513 Bacteria 502
626 nmdc:mga0rr50_418496_c1 3300050513 Bacteria 1133
627 nmdc:mga0rr50_82681_c1 3300050513 Bacteria 2481
628 nmdc:mga08x19_92775_c1 3300050514 Bacteria 1995
629 nmdc:mga0a205_292048_c1 3300050515 Bacteria 1504
630 Ga0495655_0146921 3300053083 Bacteria 738
631 Ga0495655_0181511 3300053083 Bacteria 679
632 Ga0495619_0544281 3300053085 Bacteria 797
633 Ga0587111_0179422 3300060346 Bacteria 588
634 Ga0466962_0056896 3300061719 Bacteria 1867
635 Ga0466962_0151682 3300061719 Bacteria 1124
636 Ga0530510_0375806 3300061734 Bacteria 1069
637 Ga0466966_0120094
638 JGI24739J22299_10069332
639 JGI24739J22299_10112775
640 JGI24743J22301_10008359
641 JGI24735J21928_10093463
642 JGI24738J21930_10053675
643 JGI24744J21845_10037001
644 JGI24742J22300_10023420
645 JGI25406J46586_10014933
646 Ga0070683_100066088
647 Ga0070683_100361451
648 Ga0070683_100923162
649 Ga0070683_100925442
650 Ga0070690_100312136
651 Ga0070690_100325688
652 Ga0070670_100233516
653 Ga0068869_100032304
654 Ga0070666_10230724
655 Ga0070680_100915776
656 Ga0070680_101105561
657 Ga0070682_100006422
658 Ga0070682_100162361
659 Ga0070682_100470989
660 Ga0068868_100140880
661 Ga0070660_100146711
662 Ga0070660_100326173
663 Ga0070660_101093373
664 Ga0070689_100086027
665 Ga0070689_100266550
666 Ga0070691_10037557
667 Ga0070691_10399784
668 Ga0070687_100519041
669 Ga0070661_100181922
670 Ga0070661_100283504
671 Ga0070661_101700001
672 Ga0070692_10062670
673 Ga0070692_10156640
674 Ga0070668_100171744
675 Ga0070668_100400194
676 Ga0070668_100524790
677 Ga0070669_100094857
678 Ga0070669_100128239
679 Ga0070675_100258695
680 Ga0070671_100188600
681 Ga0070671_100501969
682 Ga0070671_100553726
683 Ga0070673_100554252
684 Ga0070673_100756535
685 Ga0070688_100159512
686 Ga0070688_100945025
687 Ga0070659_100069415
688 Ga0070659_100114889
689 Ga0070659_100116677
690 Ga0070659_100906596
691 Ga0070667_100646797
692 Ga0070667_100664520
693 Ga0070703_10050500
694 Ga0070713_101601171
695 Ga0070710_10291660
696 Ga0070701_10053010
697 Ga0070701_10139314
698 Ga0070711_100000367
699 Ga0070711_100164576
700 Ga0070711_100837913
701 Ga0070700_100059772
702 Ga0070700_100062524
703 Ga0070700_100308166
704 Ga0070694_100106751
705 Ga0070694_100379021
706 Ga0070678_100066822
707 Ga0070678_100210025
708 Ga0070678_100583612
709 Ga0070662_100139724
710 Ga0070662_100208065
711 Ga0070662_100221420
712 Ga0070662_100415148
713 Ga0068867_100131470
714 Ga0068867_101118244
715 Ga0068867_102309356
716 Ga0070685_10014072
717 Ga0070679_100798507
718 Ga0070679_101038708
719 Ga0070684_100001966
720 Ga0070684_100569788
721 Ga0070684_100593593
722 Ga0070684_100697029
723 Ga0070684_101032585
724 Ga0070684_101352055
725 Ga0070686_100176461
726 Ga0070686_100203706
727 Ga0070686_100470694
728 Ga0070695_100409008
729 Ga0070695_100561273
730 Ga0070695_100966419
731 Ga0070696_100519992
732 Ga0070693_100456717
733 Ga0070665_100001256
734 Ga0070665_100056592
735 Ga0070665_100276697
736 Ga0070665_100854769
737 Ga0070704_100391459
738 Ga0070704_100597704
739 Ga0070704_101110443
740 Ga0070664_100094147
741 Ga0070664_100115968
742 Ga0070664_100205565
743 Ga0070664_100230612
744 Ga0070664_100422005
745 Ga0070664_101025360
746 Ga0068857_100207872
747 Ga0068857_100244390
748 Ga0068857_100266838
749 Ga0068857_100511366
750 Ga0068854_100062536
751 Ga0068854_100175881
752 Ga0068854_100175942
753 Ga0068854_100508380
754 Ga0068854_100822207
755 Ga0068856_100023629
756 Ga0068856_100123932
757 Ga0068856_100679938
758 Ga0070702_100013885
759 Ga0070702_100042146
760 Ga0070702_100086641
761 Ga0070702_100171480
762 Ga0070702_101132462
763 Ga0068852_100199378
764 Ga0068852_100283100
765 Ga0068852_100479026
766 Ga0068852_100791890
767 Ga0068852_100842114
768 Ga0068859_100220690
769 Ga0068859_100843717
770 Ga0068859_102757768
771 Ga0068864_100141582
772 Ga0068864_100275305
773 Ga0068864_100305494
774 Ga0068864_100491205
775 Ga0068864_100707341
776 Ga0068866_10109821
777 Ga0068866_10580002
778 Ga0068861_100006023
779 Ga0068861_100379116
780 Ga0068861_100790611
781 Ga0068851_10144282
782 Ga0068851_10155568
783 Ga0068851_10554998
784 Ga0068870_10211591
785 Ga0068870_10295333
786 Ga0068870_10377519
787 Ga0068870_10535345
788 Ga0068863_100351378
789 Ga0068863_100438684
790 Ga0068863_100460677
791 Ga0068863_100940139
792 Ga0068858_100199507
793 Ga0068858_100319149
794 Ga0068858_100735666
795 Ga0068860_100199283
796 Ga0068860_100475053
797 Ga0068860_100910482
798 Ga0068862_100110346
799 Ga0068862_100728878
800 Ga0068862_100955003
801 Ga0081538_10007594
802 Ga0081539_10009210
803 Ga0081539_10029940
804 Ga0070712_100092002
805 Ga0070712_100508208
806 Ga0097621_101067903
807 Ga0068871_100314717
808 Ga0068871_100471609
809 Ga0068871_100825878
810 Ga0075431_100080776
811 Ga0075433_10483610
812 Ga0075433_10612445
813 Ga0075434_100047180
814 Ga0075434_100600399
815 Ga0068865_100012531
816 Ga0068865_100119003
817 Ga0075436_100166067
818 Ga0097620_100220688
819 Ga0097620_100843701
820 Ga0097620_102757691
821 Ga0075435_100032865
822 Ga0105250_10110453
823 Ga0105240_10182388
824 Ga0105240_11211530
825 Ga0111539_10056400
826 Ga0111539_10323779
827 Ga0111539_11198218
828 Ga0105245_10020437
829 Ga0105245_10508098
830 Ga0105245_10523221
831 Ga0105245_10711274
832 Ga0105247_10026849
833 Ga0105247_10097116
834 Ga0105247_10120304
835 Ga0105247_10191504
836 Ga0114129_10799730
837 Ga0114129_10971552
838 Ga0114129_13213953
839 Ga0105243_10103297
840 Ga0105243_10113573
841 Ga0105243_10571099
842 Ga0105243_10727534
843 Ga0105243_12798407
844 Ga0105241_10201979
845 Ga0105241_10455802
846 Ga0105242_10041055
847 Ga0105242_11218295
848 Ga0105248_10161812
849 Ga0105248_10286547
850 Ga0105248_10467584
851 Ga0105237_10453656
852 Ga0105238_10709603
853 Ga0105249_10050163
854 Ga0105249_10107100
855 Ga0105249_10223712
856 Ga0105249_10774469
857 Ga0105249_11702291
858 Ga0105239_10002616
859 Ga0105239_10266236
860 Ga0105239_10357963
861 Ga0105239_10896295
862 Ga0105246_10028864
863 Ga0105246_10286149
864 Ga0105246_10312067
865 Ga0105246_10889854
866 Ga0157371_10520884
867 Ga0157369_10276682
868 Ga0157369_10345210
869 Ga0157369_10357660
870 Ga0157369_10619625
871 Ga0157374_10011836
872 Ga0157374_10157345
873 Ga0157374_10505258
874 Ga0157378_10781061
875 Ga0163162_10214251
876 Ga0163162_10471269
877 Ga0163162_10500713
878 Ga0163162_10506354
879 Ga0163162_10897262
880 Ga0157372_10003197
881 Ga0157372_10683466
882 Ga0157372_10773204
883 Ga0157372_11128318
884 Ga0157372_11589474
885 Ga0157372_12810656
886 Ga0157375_10834691
887 Ga0163163_10361125
888 Ga0163163_10420252
889 Ga0163163_10635199
890 Ga0163163_10876002
891 Ga0163163_10880617
892 Ga0163163_11178721
893 Ga0157380_10082358
894 Ga0157380_10336350
895 Ga0157377_10001602
896 Ga0157377_10474705
897 Ga0157377_10669982
898 Ga0157379_10289810
899 Ga0157376_10374164
900 Ga0157376_10823037
901 Ga0163161_10188814
902 Ga0163161_11344090
903 Ga0197907_10212870
904 Ga0206356_10141367
905 Ga0206356_11821022
906 Ga0206349_1345920
907 Ga0206351_10224249
908 Ga0206350_10628971
909 Ga0206354_10306677
910 Ga0206354_11655099
911 Ga0206353_11019103
912 Ga0206353_11515756
913 Ga0224712_10391376
914 Ga0207656_10374439
915 Ga0207656_10589771
916 Ga0207692_10205471
917 Ga0207642_10065087
918 Ga0207710_10025830
919 Ga0207710_10508460
920 Ga0207688_10004242
921 Ga0207688_10044740
922 Ga0207688_10092659
923 Ga0207688_10246775
924 Ga0207680_10216890
925 Ga0207647_10138224
926 Ga0207647_10160053
927 Ga0207643_10044473
928 Ga0207643_10469406
929 Ga0207705_10902194
930 Ga0207705_11057467
931 Ga0207693_10016442
932 Ga0207693_10315791
933 Ga0207663_10004281
934 Ga0207663_10151194
935 Ga0207663_10226512
936 Ga0207660_10279663
937 Ga0207662_10066864
938 Ga0207662_10549713
939 Ga0207657_10065951
940 Ga0207657_10276110
941 Ga0207649_10212326
942 Ga0207649_10308927
943 Ga0207649_10365714
944 Ga0207652_10282047
945 Ga0207652_10377981
946 Ga0207681_10228589
947 Ga0207681_10241651
948 Ga0207694_10581404
949 Ga0207694_10740456
950 Ga0207659_11486452
951 Ga0207687_10020288
952 Ga0207687_10131181
953 Ga0207687_10251287
954 Ga0207687_10402996
955 Ga0207687_10953952
956 Ga0207644_10136281
957 Ga0207644_10801637
958 Ga0207644_11640517
959 Ga0207690_10170456
960 Ga0207690_10220301
961 Ga0207690_10681431
962 Ga0207690_10930542
963 Ga0207706_10056263
964 Ga0207706_10125302
965 Ga0207706_10127348
966 Ga0207706_10564352
967 Ga0207686_10305277
968 Ga0207686_10345508
969 Ga0207686_10753103
970 Ga0207709_10064571
971 Ga0207709_10115267
972 Ga0207709_10406118
973 Ga0207709_10710042
974 Ga0207670_10478970
975 Ga0207669_10078022
976 Ga0207669_10513216
977 Ga0207669_10636112
978 Ga0207704_10031211
979 Ga0207704_10125165
980 Ga0207704_10474112
981 Ga0207704_10674845
982 Ga0207665_10939523
983 Ga0207711_10095580
984 Ga0207711_10324459
985 Ga0207711_10566472
986 Ga0207689_10043192
987 Ga0207689_10093438
988 Ga0207689_10425166
989 Ga0207661_10027862
990 Ga0207661_10147345
991 Ga0207661_10420505
992 Ga0207661_10553762
993 Ga0207661_10571891
994 Ga0207661_10686199
995 Ga0207679_10057793
996 Ga0207679_10078806
997 Ga0207679_10204220
998 Ga0207679_10251448
999 Ga0207679_10317574
1000 Ga0207712_10311337
1001 Ga0207712_10339826
1002 Ga0207712_10921407
1003 Ga0207668_10021649
1004 Ga0207668_10026935
1005 Ga0207668_10166741
1006 Ga0207668_10286222
1007 Ga0207640_10065376
1008 Ga0207640_10254392
1009 Ga0207640_10262781
1010 Ga0207640_10501463
1011 Ga0207640_10549166
1012 Ga0207658_10172158
1013 Ga0207658_11082910
1014 Ga0207677_10134778
1015 Ga0207677_10174558
1016 Ga0207677_10335143
1017 Ga0207677_10517704
1018 Ga0207677_10615276
1019 Ga0207703_10131144
1020 Ga0207703_10586975
1021 Ga0207639_10238412
1022 Ga0207639_10261363
1023 Ga0207639_10668978
1024 Ga0207678_10219823
1025 Ga0207678_10223288
1026 Ga0207678_10423307
1027 Ga0207708_10000450
1028 Ga0207708_10132186
1029 Ga0207708_10391064
1030 Ga0207708_10478975
1031 Ga0207702_10381117
1032 Ga0207702_10922346
1033 Ga0207641_10374103
1034 Ga0207641_10843192
1035 Ga0207641_10990460
1036 Ga0207648_10324912
1037 Ga0207648_10770982
1038 Ga0207648_11156328
1039 Ga0207648_11608753
1040 Ga0207676_10304603
1041 Ga0207676_10410192
1042 Ga0207676_10894854
1043 Ga0207676_11011052
1044 Ga0207676_12079246
1045 Ga0207674_10308999
1046 Ga0207674_10381746
1047 Ga0207674_10631390
1048 Ga0207675_100005544
1049 Ga0207675_100237160
1050 Ga0207675_100315517
1051 Ga0207683_10018666
1052 Ga0207683_10139370
1053 Ga0207683_10148919
1054 Ga0207683_10197196
1055 Ga0207698_10033920
1056 Ga0207698_10121045
1057 Ga0207698_10222650
1058 Ga0207698_10494887
1059 Ga0207428_10164034
1060 Ga0268266_10019735
1061 Ga0268266_10425707
1062 Ga0268266_11604293
1063 Ga0268266_11939692
1064 Ga0268265_10254408
1065 Ga0268264_10581115
1066 Ga0268264_11212268
1067 Ga0265338_10023293
1068 Ga0307405_10022127
1069 Ga0307405_10173847
1070 Ga0307405_10565217
1071 Ga0307405_11373449
1072 Ga0307413_10366877
1073 Ga0307413_10623289
1074 Ga0307410_10121788
1075 Ga0307406_10043836
1076 Ga0307406_10208958
1077 Ga0307406_10232893
1078 Ga0307406_10274620
1079 Ga0307406_10653339
1080 Ga0307407_10225183
1081 Ga0307407_10245347
1082 Ga0307407_10273008
1083 Ga0307407_10558955
1084 Ga0307407_10586438
1085 Ga0307412_10076009
1086 Ga0307409_100050108
1087 Ga0307409_100262418
1088 Ga0307409_100743400
1089 Ga0307409_100880378
1090 Ga0307416_100023650
1091 Ga0307416_101545683
1092 Ga0307416_102032165
1093 Ga0307416_102179951
1094 Ga0307414_10023938
1095 Ga0307414_10613890
1096 Ga0307415_100039447
1097 Ga0307415_100049024
1098 Ga0307415_100095083
1099 Ga0307415_101890859
1100 Ga0373939_0040585
1101 Ga0373941_0157445
1102 Ga0373961_0380401
1103 Ga0373931_0888522
1104 Ga0373933_0509034
1105 Ga0373947_0014312
1106 Ga0373937_1502481
1107 Ga0395899_0189184
1108 Ga0395900_0491085
1109 Ga0395898_0527477
1110 Ga0395898_1091605
1111 Ga0395905_0398099
1112 Ga0395905_0823683
1113 Ga0395901_0021401
1114 Ga0395901_0545265
1115 Ga0395901_1831067
1116 Ga0436365_1708835
1117 Ga0436363_0355758
1118 Ga0439453_0096402
1119 Ga0451789_0481833
1120 Ga0451853_1347858
1121 Ga0451853_3911200
1122 Ga0439448_0058643
1123 Ga0439456_048292
1124 Ga0439444_0008257
1125 Ga0439464_0015376
1126 Ga0439460_0011603
1127 Ga0450916_003157
1128 Ga0466972_0015132
1129 Ga0466965_0118986
1130 Ga0466965_0234393
1131 Ga0466961_0605815
1132 Ga0466963_0015124
1133 Ga0466963_1286123
1134 Ga0466964_0004603
1135 Ga0466964_0012121
1136 Ga0466968_0008368
1137 Ga0466968_0118124
1138 Ga0466970_0105643
1139 Ga0466957_0041037
1140 Ga0466957_0070351
1141 Ga0466960_0106585
1142 Ga0466960_0252155
1143 Ga0466960_0375377
1144 Ga0466960_0462956
1145 Ga0466960_0681230
1146 Ga0466959_0043083
1147 Ga0466959_0114215
1148 Ga0466959_0267306
1149 Ga0466959_0351845
1150 Ga0466958_0123935
1151 Ga0466958_0185210
1152 Ga0466958_0207499
1153 Ga0466958_0335452
1154 Ga0466958_0340710
1155 Ga0466967_0009259
1156 Ga0466967_0009391
1157 Ga0466967_0014579
1158 Ga0466967_0464334
1159 Ga0466967_1305037
1160 Ga0466967_1384853
1161 Ga0495653_0149045
1162 Ga0495662_0087384
1163 Ga0495584_0201475
1164 Ga0495596_0396967
1165 Ga0495631_0230117
1166 Ga0495643_0378545
1167 Ga0495652_0341047
1168 Ga0495665_0006170
1169 Ga0495597_0156656
1170 Ga0495645_0001598
1171 Ga0495645_0334439
1172 Ga0495646_0193639
1173 Ga0495670_0692223
1174 Ga0495589_0144511
1175 Ga0496100_0036301
1176 Ga0496100_0243803
1177 Ga0496100_0255950
1178 Ga0496100_0568476
1179 Ga0496101_0519653
1180 Ga0496101_0571053
1181 Ga0496101_0777037
1182 Ga0496101_0811069
1183 Ga0496101_1238038
1184 Ga0496102_0104843
1185 Ga0496102_0557149
1186 Ga0496102_1133440
1187 Ga0496102_1753020
1188 Ga0496103_0520961
1189 Ga0496104_0086683
1190 Ga0496104_0169680
1191 Ga0496104_0273913
1192 Ga0496105_0012943
1193 Ga0496105_0386309
1194 Ga0496105_0574590
1195 Ga0496106_0103748
1196 Ga0496106_0251735
1197 Ga0496106_0558253
1198 Ga0496107_0065246
1199 Ga0496107_0184041
1200 Ga0496108_0048030
1201 Ga0496108_0069557
1202 Ga0496108_0202028
1203 Ga0496108_0212279
1204 Ga0496108_0576656
1205 Ga0496108_1203781
1206 Ga0496109_0009337
1207 Ga0496109_0029108
1208 Ga0496109_0038061
1209 Ga0496109_0163127
1210 Ga0496109_0340186
1211 Ga0496109_1043831
1212 Ga0496110_0045801
1213 Ga0496110_0119448
1214 Ga0496110_0256130
1215 Ga0496110_0911090
1216 Ga0496110_1550480
1217 Ga0496111_0096533
1218 Ga0496111_0147462
1219 Ga0496111_0251256
1220 Ga0496111_0305853
1221 Ga0496111_0595897
1222 Ga0496112_0002780
1223 Ga0496112_0027717
1224 Ga0496112_0104177
1225 Ga0496113_0067005
1226 Ga0496113_0077838
1227 Ga0496113_0284699
1228 Ga0496114_0564594
1229 Ga0496114_1374140
1230 Ga0496114_1455432
1231 Ga0496114_1783545
1232 Ga0496115_0210906
1233 Ga0501317_039137
1234 Ga0501317_103420
1235 Ga0501321_068795
1236 Ga0501323_065340
1237 Ga0501323_091004
1238 Ga0501031_0981000
1239 Ga0501034_0167433
1240 Ga0501034_0268745
1241 Ga0501034_0286674
1242 Ga0501034_0720372
1243 Ga0501043_0358026
1244 Ga0501046_0747853
1245 Ga0501067_0056167
1246 Ga0501067_0067704
1247 Ga0501069_0204181
1248 Ga0501070_0513227
1249 Ga0501070_0710098
1250 Ga0501072_0430888
1251 Ga0501076_0513552
1252 Ga0501083_0257353
1253 Ga0501044_0057479
1254 nmdc:mga05p37_61114_c1
1255 nmdc:mga06r32_224989_c1
1256 nmdc:mga08y16_1433725_c1
1257 nmdc:mga08y16_199752_c1
1258 nmdc:mga08y16_47087_c1
1259 nmdc:mga0n895_1292637_c1
1260 nmdc:mga0n895_17424_c1
1261 nmdc:mga0rr50_1890692_c1
1262 nmdc:mga0rr50_418496_c1
1263 nmdc:mga0rr50_82681_c1
1264 nmdc:mga08x19_92775_c1
1265 nmdc:mga0a205_292048_c1
1266 Ga0495655_0146921
1267 Ga0495655_0181511
1268 Ga0495619_0544281
1269 Ga0587111_0179422
1270 Ga0466962_0056896
1271 Ga0466962_0151682
1272 Ga0530510_0375806

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02576

RimP_N

RimP N-terminal domain

17

80

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dy9-assembly1.cif.gz_F y68t hfq from methanococcus jannaschii in complex with amp 0.8597 81 134
4x9c-assembly1.cif.gz_C 1.4a crystal structure of hfq from methanococcus jannaschii 0.8537 81 134
2x4j-assembly1.cif.gz_A crystal structure of orf137 from pyrobaculum spherical virus 0.8447 84 137
6lyp-assembly1.cif.gz_A cryo-em structure of atmsl1 wild type 0.8189 102 128
7nav-assembly1.cif.gz_X bacterial 30s ribosomal subunit assembly complex state d (consensus refinement) 0.8152 1 138
ID Description Score Start End Superfamily
af_P0A8A8_87_147_2.30.30.180 Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain 0.9616 76 136 2.30.30.180
af_P0A8A8_87_147_2.30.30.180 Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain 0.9465 76 136 2.30.30.180
af_Q2G2D3_87_153_2.30.30.180 Mainly Beta;Roll;SH3 type barrels.;Ribosome maturation factor RimP, C-terminal domain 0.9433 76 137 2.30.30.180
2ej9A02 Mainly Beta;Roll;SH3 type barrels.; 0.8704 83 133 2.30.30.100
af_P71915_175_222_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8685 102 128 2.30.30.60
ID Description Score Start End GO Terms
AF-A0A534HRL7-F1-model_v4 Ribosome maturation factor RimP 0.9545 72 137
AF-A0A534HRL7-F1-model_v4 Ribosome maturation factor RimP 0.9408 72 137
AF-A0A7X7GAY2-F1-model_v4 Ribosome maturation factor RimP 0.9278 5 138 GO:0000028
GO:0005829
GO:0006412
AF-T0XX09-F1-model_v4 Protein belonging to Uncharacterized protein family UPF0090 0.924 73 138
AF-A0A6M4H728-F1-model_v4 Ribosome maturation factor RimP 0.9198 4 138 GO:0000028
GO:0005829
GO:0006412

Map