F471309

General Info

Members Datasets Scaffolds Average Seq Length
636 283 601 181

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10000498|Ga0070658_100004987
Length 197
Sequence MKTHRKNELVRIELVLNGTRRSGACEPRTLLSDFLRQELGATGTHVGCEHGVCGACTVRIDGVASRSCLSLAVQAEGRAIDTVEGLNNGVAEPGHDGLSDLQEAFRRNHALQCGFCTAGILMSCADYLERRPDPTEPEVREMLSGHLCRCTGYTNIVKAVLETAAGRLGRPHGASLAPADPGHAGVGPAEQALLPNA

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
3 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
4 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
5 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
6 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
7 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
8 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
9 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
10 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
11 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
12 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
13 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
14 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
15 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
16 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
17 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
18 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
19 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
20 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
21 2842733646 Variovorax sp. R-72446 Isolate Unclassified
22 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
23 2885266251 Ralstonia sp. SET104 Isolate Nodule
24 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
25 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
26 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
27 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
28 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
29 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
41 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
42 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
73 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
74 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
222 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
223 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
279 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
280 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
281 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
282 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
283 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 0
Isolates 5.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 2.36
Rhizoplane 5.35
Rhizosphere 78.3
Stem 0
Stem Tuber 0
Unclassified 9.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003487 3300001979 Bacteria 6902
2 JGI24739J22299_10001991 3300001989 Bacteria 7824
3 JGI24737J22298_10036444 3300001990 Bacteria 1519
4 JGI24735J21928_10000412 3300002067 Bacteria 14910
5 JGI24735J21928_10001774 3300002067 Bacteria 7580
6 JGI24735J21928_10020237 3300002067 Bacteria 2040
7 JGI24738J21930_10017529 3300002075 Bacteria 1504
8 JGI25156J39149_1000549 3300002705 Bacteria 21465
9 JGI25156J39149_1000627 3300002705 Bacteria 19421
10 JGI25156J39149_1000829 3300002705 Bacteria 15628
11 JGI25151J46595_10005293 3300003187 Bacteria 6683
12 JGI25151J46595_10034051 3300003187 Bacteria 1953
13 JGI25165J46597_1001074 3300003214 Bacteria 17562
14 rootL2_10024132 3300003322 Bacteria 5893
15 JGI25160J50197_1000184 3300003354 Bacteria 53011
16 Ga0055533_1000123 3300003756 Bacteria 87995
17 Ga0055533_1001475 3300003756 Bacteria 6199
18 Ga0055532_1000076 3300003758 Bacteria 123328
19 Ga0055527_1000038 3300003760 Bacteria 123328
20 Ga0055535_1000060 3300003761 Bacteria 123328
21 Ga0055542_1000089 3300003762 Bacteria 123328
22 Ga0055529_1000106 3300003763 Bacteria 123328
23 Ga0065165_1000040 3300005262 Bacteria 205767
24 Ga0070658_10000498 3300005327 Bacteria 34140
25 Ga0070666_10287294 3300005335 Bacteria 1170
26 Ga0068868_100555704 3300005338 Bacteria 1012
27 Ga0070660_100025247 3300005339 Bacteria 4415
28 Ga0070661_100792864 3300005344 Bacteria 777
29 Ga0070669_100064430 3300005353 Bacteria 2699
30 Ga0070674_100751474 3300005356 Bacteria 838
31 Ga0070713_100155536 3300005436 Bacteria 2038
32 Ga0070663_100022887 3300005455 Bacteria 4182
33 Ga0068855_100001573 3300005563 Bacteria 28655
34 Ga0068855_100172487 3300005563 Bacteria 2449
35 Ga0068857_100033970 3300005577 Bacteria 4512
36 Ga0068858_101154377 3300005842 Bacteria 761
37 Ga0075434_100017879 3300006871 Bacteria 6839
38 Ga0105251_10000175 3300009011 Bacteria 64566
39 Ga0105240_10348774 3300009093 Bacteria 1680
40 Ga0105240_10442119 3300009093 Bacteria 1457
41 Ga0111539_10658846 3300009094 Bacteria 1219
42 Ga0105247_10075942 3300009101 Bacteria 2109
43 Ga0105241_10017623 3300009174 Bacteria 5250
44 Ga0105242_11049621 3300009176 Bacteria 826
45 Ga0105242_11679251 3300009176 Bacteria 671
46 Ga0105238_10041130 3300009551 Bacteria 4682
47 Ga0105238_11073749 3300009551 Bacteria 827
48 Ga0105246_10165185 3300011119 Bacteria 1690
49 Ga0105246_10839819 3300011119 Bacteria 818
50 Ga0157369_10290446 3300013105 Bacteria 1702
51 Ga0157369_10296018 3300013105 Bacteria 1684
52 Ga0157374_10060973 3300013296 Bacteria 3531
53 Ga0163162_10008204 3300013306 Bacteria 10192
54 Ga0163162_10204456 3300013306 Bacteria 2104
55 Ga0157376_10058029 3300014969 Bacteria 3240
56 Ga0183361_10004 3300016635 Bacteria 484183
57 Ga0209435_102634 3300025206 Bacteria 2087
58 Ga0209674_100005 3300025226 Bacteria 1708125
59 Ga0209674_100093 3300025226 Bacteria 170423
60 Ga0209672_100001 3300025228 Bacteria 2828210
61 Ga0209147_100001 3300025229 Bacteria 2384371
62 Ga0209563_100758 3300025230 Bacteria 9874
63 Ga0207427_105577 3300025231 Bacteria 1749
64 Ga0209258_100001 3300025242 Bacteria 2384269
65 Ga0209148_1000003 3300025254 Bacteria 2384288
66 Ga0209759_1000039 3300025256 Bacteria 256444
67 Ga0209759_1000074 3300025256 Bacteria 177152
68 Ga0209759_1000202 3300025256 Bacteria 94051
69 Ga0209759_1026535 3300025256 Bacteria 1212
70 Ga0209233_1000198 3300025261 Bacteria 123847
71 Ga0209455_1000001 3300025272 Bacteria 2384278
72 Ga0209673_1093259 3300025273 Bacteria 662
73 Ga0209130_1007485 3300025284 Bacteria 3363
74 Ga0209675_1005538 3300025291 Bacteria 5267
75 Ga0209025_1000291 3300025294 Bacteria 112755
76 Ga0209025_1001868 3300025294 Bacteria 24674
77 Ga0209564_1004353 3300025295 Bacteria 8715
78 Ga0207426_1000004 3300025302 Bacteria 1047900
79 Ga0207426_1002716 3300025302 Bacteria 10773
80 Ga0207713_1013187 3300025735 Bacteria 4371
81 Ga0207680_10303364 3300025903 Bacteria 1113
82 Ga0207647_10016779 3300025904 Bacteria 4989
83 Ga0207647_10057540 3300025904 Bacteria 2383
84 Ga0207647_10126803 3300025904 Bacteria 1502
85 Ga0207705_10001835 3300025909 Bacteria 16707
86 Ga0207695_10212401 3300025913 Bacteria 1845
87 Ga0207695_10373428 3300025913 Bacteria 1312
88 Ga0207695_10499672 3300025913 Bacteria 1098
89 Ga0207657_10109880 3300025919 Bacteria 2278
90 Ga0207681_10044923 3300025923 Bacteria 2963
91 Ga0207694_10382069 3300025924 Bacteria 1169
92 Ga0207686_10832179 3300025934 Bacteria 741
93 Ga0207669_10529137 3300025937 Bacteria 948
94 Ga0207667_10331258 3300025949 Bacteria 1554
95 Ga0207651_10598864 3300025960 Bacteria 963
96 Ga0207668_10406010 3300025972 Bacteria 1153
97 Ga0207678_10129282 3300026067 Bacteria 2154
98 Ga0207648_10231844 3300026089 Bacteria 1642
99 Ga0207674_10039950 3300026116 Bacteria 4861
100 Ga0207698_10083245 3300026142 Bacteria 2589
101 Ga0209998_10051503 3300027717 Bacteria 954
102 Ga0268266_10912865 3300028379 Bacteria 849
103 Ga0265332_10280993 3300031238 Bacteria 688
104 Ga0307408_100024373 3300031548 Bacteria 4131
105 Ga0307408_100284942 3300031548 Bacteria 1377
106 Ga0307408_100458386 3300031548 Bacteria 1107
107 Ga0307405_10070512 3300031731 Bacteria 2245
108 Ga0307405_10155180 3300031731 Bacteria 1615
109 Ga0307405_10822417 3300031731 Bacteria 780
110 Ga0307413_10011037 3300031824 Bacteria 4418
111 Ga0307410_10037131 3300031852 Bacteria 3179
112 Ga0307407_10022326 3300031903 Bacteria 3281
113 Ga0307407_10526905 3300031903 Bacteria 870
114 Ga0307412_10000015 3300031911 Bacteria 333589
115 Ga0307412_10030183 3300031911 Bacteria 3410
116 Ga0307412_10167309 3300031911 Bacteria 1640
117 Ga0307409_100054345 3300031995 Bacteria 3083
118 Ga0307416_100244400 3300032002 Bacteria 1742
119 Ga0307416_100252409 3300032002 Bacteria 1718
120 Ga0307416_100370265 3300032002 Bacteria 1458
121 Ga0307416_101637009 3300032002 Bacteria 749
122 Ga0307414_10151288 3300032004 Bacteria 1831
123 Ga0307414_11034172 3300032004 Bacteria 757
124 Ga0307411_10017882 3300032005 Bacteria 4054
125 Ga0307415_100013445 3300032126 Bacteria 4779
126 Ga0373961_0004580 3300035241 Bacteria 3339
127 Ga0395899_0008222 3300037312 Bacteria 8037
128 Ga0395899_0013432 3300037312 Bacteria 6264
129 Ga0395899_0024028 3300037312 Bacteria 4609
130 Ga0395900_0000389 3300037418 Bacteria 63583
131 Ga0395900_0076553 3300037418 Bacteria 3438
132 Ga0395898_0000866 3300037466 Bacteria 49465
133 Ga0395905_0000017 3300037471 Bacteria 376619
134 Ga0395905_0207038 3300037471 Bacteria 1838
135 Ga0395901_0000164 3300038443 Bacteria 86884
136 Ga0395901_0007263 3300038443 Bacteria 11181
137 Ga0436360_0488037 3300039438 Bacteria 751
138 Ga0436360_1255352 3300039438 Bacteria 892
139 Ga0436361_1020675 3300039447 Bacteria 8158
140 Ga0451841_0552099 3300041498 Bacteria 565
141 Ga0439449_0239452 3300042007 Bacteria 681
142 Ga0466969_0114846 3300044656 Bacteria 1257
143 Ga0466965_0134341 3300044683 Bacteria 1284
144 Ga0466966_0003675 3300044684 Bacteria 10126
145 Ga0466966_0076420 3300044684 Bacteria 2091
146 Ga0466966_0094713 3300044684 Bacteria 1850
147 Ga0466961_0009736 3300044693 Bacteria 6116
148 Ga0466961_0011395 3300044693 Bacteria 5687
149 Ga0466964_0021906 3300044706 Bacteria 2474
150 Ga0466970_0015839 3300044765 Bacteria 3881
151 Ga0466970_0025746 3300044765 Bacteria 3082
152 Ga0466970_0076746 3300044765 Bacteria 1801
153 Ga0466957_0000384 3300044842 Bacteria 21604
154 Ga0466957_0325617 3300044842 Bacteria 1038
155 Ga0466960_0024327 3300044901 Bacteria 2731
156 Ga0466960_0077654 3300044901 Bacteria 1666
157 Ga0466959_0003358 3300045049 Bacteria 10456
158 Ga0466959_0038113 3300045049 Bacteria 3552
159 Ga0466958_0147970 3300045836 Bacteria 1481
160 Ga0466958_0183534 3300045836 Bacteria 1328
161 Ga0466958_0368219 3300045836 Bacteria 926
162 Ga0495617_000001 3300046452 Bacteria 877032
163 Ga0495627_000026 3300046453 Bacteria 238494
164 Ga0495592_0040789 3300046454 Bacteria 3482
165 Ga0495592_0058374 3300046454 Bacteria 2846
166 Ga0495592_0283194 3300046454 Bacteria 1083
167 Ga0495603_0005061 3300046455 Bacteria 7877
168 Ga0495590_0000113 3300046457 Bacteria 49080
169 Ga0495590_0022794 3300046457 Bacteria 2214
170 Ga0495590_0027155 3300046457 Bacteria 2009
171 Ga0495590_0030732 3300046457 Bacteria 1882
172 Ga0495591_000435 3300046458 Bacteria 34198
173 Ga0495629_0000186 3300046459 Bacteria 56077
174 Ga0495629_0001260 3300046459 Bacteria 19895
175 Ga0495629_0040458 3300046459 Bacteria 3279
176 Ga0495629_0117210 3300046459 Bacteria 1855
177 Ga0495629_0150111 3300046459 Bacteria 1620
178 Ga0495629_0189073 3300046459 Bacteria 1425
179 Ga0495629_0631270 3300046459 Bacteria 715
180 Ga0495641_0022184 3300046461 Bacteria 3180
181 Ga0495641_0110065 3300046461 Bacteria 1229
182 Ga0495651_0005717 3300046462 Bacteria 9477
183 Ga0495651_0045524 3300046462 Bacteria 3399
184 Ga0495651_0137701 3300046462 Bacteria 1774
185 Ga0495653_0000376 3300046463 Bacteria 36050
186 Ga0495653_0009745 3300046463 Bacteria 7855
187 Ga0495653_0017478 3300046463 Bacteria 5832
188 Ga0495653_0040785 3300046463 Bacteria 3626
189 Ga0495653_0041012 3300046463 Bacteria 3615
190 Ga0495653_0067263 3300046463 Bacteria 2691
191 Ga0495653_0176628 3300046463 Bacteria 1469
192 Ga0495650_0000108 3300046471 Bacteria 200369
193 Ga0495650_0002624 3300046471 Bacteria 14069
194 Ga0495650_0008821 3300046471 Bacteria 5826
195 Ga0495650_0042349 3300046471 Bacteria 1939
196 Ga0495650_0123211 3300046471 Bacteria 952
197 Ga0495580_0000694 3300046472 Bacteria 28746
198 Ga0495580_0007599 3300046472 Bacteria 8695
199 Ga0495580_0022292 3300046472 Bacteria 4661
200 Ga0495580_0031336 3300046472 Bacteria 3842
201 Ga0495580_0035364 3300046472 Bacteria 3592
202 Ga0495580_0050990 3300046472 Bacteria 2925
203 Ga0495580_0241469 3300046472 Bacteria 1238
204 Ga0495582_0001985 3300046473 Bacteria 11465
205 Ga0495582_0004361 3300046473 Bacteria 7959
206 Ga0495582_0018186 3300046473 Bacteria 3846
207 Ga0495582_0047043 3300046473 Bacteria 2375
208 Ga0495582_0108490 3300046473 Bacteria 1558
209 Ga0495582_0288010 3300046473 Bacteria 943
210 Ga0495605_0000004 3300046474 Bacteria 395282
211 Ga0495605_0005920 3300046474 Bacteria 7067
212 Ga0495605_0011496 3300046474 Bacteria 4930
213 Ga0495605_0025720 3300046474 Bacteria 3065
214 Ga0495605_0026263 3300046474 Bacteria 3028
215 Ga0495605_0054146 3300046474 Bacteria 1944
216 Ga0495605_0081014 3300046474 Bacteria 1518
217 Ga0495605_0170824 3300046474 Bacteria 961
218 Ga0495662_0046620 3300046476 Bacteria 2093
219 Ga0495662_0050819 3300046476 Bacteria 2001
220 Ga0495664_0001481 3300046477 Bacteria 12427
221 Ga0495664_0002734 3300046477 Bacteria 9487
222 Ga0495664_0059564 3300046477 Bacteria 2273
223 Ga0495664_0110781 3300046477 Bacteria 1657
224 Ga0495664_0114099 3300046477 Bacteria 1632
225 Ga0495584_0091702 3300046491 Bacteria 1532
226 Ga0495585_0000171 3300046492 Bacteria 70110
227 Ga0495585_0019863 3300046492 Bacteria 3867
228 Ga0495585_0082974 3300046492 Bacteria 1734
229 Ga0495594_0004763 3300046499 Bacteria 6989
230 Ga0495594_0223969 3300046499 Bacteria 1072
231 Ga0495596_0002213 3300046500 Bacteria 10599
232 Ga0495596_0002760 3300046500 Bacteria 9208
233 Ga0495596_0005125 3300046500 Bacteria 6239
234 Ga0495596_0006055 3300046500 Bacteria 5635
235 Ga0495596_0012088 3300046500 Bacteria 3706
236 Ga0495596_0043113 3300046500 Bacteria 1778
237 Ga0495596_0043432 3300046500 Bacteria 1771
238 Ga0495596_0050251 3300046500 Bacteria 1634
239 Ga0495596_0171947 3300046500 Bacteria 842
240 Ga0495607_0004258 3300046501 Bacteria 10596
241 Ga0495607_0044968 3300046501 Bacteria 2599
242 Ga0495583_0000075 3300046506 Bacteria 177074
243 Ga0495583_0004355 3300046506 Bacteria 10203
244 Ga0495583_0063373 3300046506 Bacteria 1643
245 Ga0495583_0116601 3300046506 Bacteria 1127
246 Ga0495583_0132863 3300046506 Bacteria 1040
247 Ga0495606_0007787 3300046507 Bacteria 9479
248 Ga0495606_0009810 3300046507 Bacteria 8043
249 Ga0495606_0026033 3300046507 Bacteria 4174
250 Ga0495606_0063237 3300046507 Bacteria 2359
251 Ga0495606_0081970 3300046507 Bacteria 2004
252 Ga0495606_0106284 3300046507 Bacteria 1700
253 Ga0495608_0030313 3300046511 Bacteria 3662
254 Ga0495608_0070854 3300046511 Bacteria 2275
255 Ga0495610_0001465 3300046512 Bacteria 20808
256 Ga0495616_0029302 3300046513 Bacteria 2908
257 Ga0495616_0030647 3300046513 Bacteria 2824
258 Ga0495616_0034490 3300046513 Bacteria 2628
259 Ga0495616_0041876 3300046513 Bacteria 2334
260 Ga0495618_0005736 3300046514 Bacteria 7542
261 Ga0495618_0008368 3300046514 Bacteria 6260
262 Ga0495620_0009809 3300046515 Bacteria 5080
263 Ga0495620_0201479 3300046515 Bacteria 765
264 Ga0495628_0015628 3300046516 Bacteria 6336
265 Ga0495628_0068567 3300046516 Bacteria 2767
266 Ga0495628_0073612 3300046516 Bacteria 2661
267 Ga0495628_0087665 3300046516 Bacteria 2412
268 Ga0495628_0096515 3300046516 Bacteria 2283
269 Ga0495628_0173104 3300046516 Bacteria 1636
270 Ga0495628_0307348 3300046516 Bacteria 1173
271 Ga0495630_0001317 3300046517 Bacteria 17073
272 Ga0495630_0057889 3300046517 Bacteria 2905
273 Ga0495630_0177323 3300046517 Bacteria 1624
274 Ga0495631_0107984 3300046518 Bacteria 1196
275 Ga0495631_0109364 3300046518 Bacteria 1188
276 Ga0495632_0000012 3300046519 Bacteria 264389
277 Ga0495632_0111239 3300046519 Bacteria 1286
278 Ga0495643_0000507 3300046522 Bacteria 48620
279 Ga0495643_0217828 3300046522 Bacteria 907
280 Ga0495643_0305994 3300046522 Bacteria 723
281 Ga0495644_0013436 3300046523 Bacteria 3141
282 Ga0495644_0020652 3300046523 Bacteria 2512
283 Ga0495648_0000022 3300046524 Bacteria 242791
284 Ga0495648_0001528 3300046524 Bacteria 22639
285 Ga0495648_0013768 3300046524 Bacteria 5961
286 Ga0495648_0013933 3300046524 Bacteria 5917
287 Ga0495648_0030148 3300046524 Bacteria 3591
288 Ga0495648_0043409 3300046524 Bacteria 2818
289 Ga0495648_0107439 3300046524 Bacteria 1525
290 Ga0495663_0006925 3300046525 Bacteria 3127
291 Ga0495666_0006042 3300046526 Bacteria 6096
292 Ga0495666_0007191 3300046526 Bacteria 5588
293 Ga0495666_0020377 3300046526 Bacteria 3286
294 Ga0495666_0037200 3300046526 Bacteria 2368
295 Ga0495666_0097868 3300046526 Bacteria 1383
296 Ga0495666_0112941 3300046526 Bacteria 1275
297 Ga0495666_0179067 3300046526 Bacteria 979
298 Ga0495642_0000001 3300046528 Bacteria 389656
299 Ga0495642_0007307 3300046528 Bacteria 4240
300 Ga0495642_0044928 3300046528 Bacteria 1804
301 Ga0495642_0047198 3300046528 Bacteria 1763
302 Ga0495642_0153464 3300046528 Bacteria 997
303 Ga0495652_0057939 3300046529 Bacteria 3283
304 Ga0495652_0114718 3300046529 Bacteria 2160
305 Ga0495652_0217817 3300046529 Bacteria 1436
306 Ga0495652_0509686 3300046529 Bacteria 833
307 Ga0495654_0027351 3300046530 Bacteria 2925
308 Ga0495654_0042039 3300046530 Bacteria 2271
309 Ga0495654_0165743 3300046530 Bacteria 967
310 Ga0495665_0003954 3300046531 Bacteria 8014
311 Ga0495665_0013162 3300046531 Bacteria 4477
312 Ga0495665_0021201 3300046531 Bacteria 3490
313 Ga0495665_0025525 3300046531 Bacteria 3175
314 Ga0495665_0067388 3300046531 Bacteria 1888
315 Ga0495665_0097818 3300046531 Bacteria 1540
316 Ga0495665_0128740 3300046531 Bacteria 1325
317 Ga0495665_0180126 3300046531 Bacteria 1098
318 Ga0495665_0368643 3300046531 Bacteria 730
319 Ga0495640_0003796 3300046533 Bacteria 12127
320 Ga0495640_0320739 3300046533 Bacteria 960
321 Ga0495586_0016355 3300046535 Bacteria 3946
322 Ga0495586_0044096 3300046535 Bacteria 2402
323 Ga0495586_0109020 3300046535 Bacteria 1540
324 Ga0495587_0001077 3300046536 Bacteria 17942
325 Ga0495587_0028642 3300046536 Bacteria 3386
326 Ga0495587_0075183 3300046536 Bacteria 1961
327 Ga0495609_0000335 3300046538 Bacteria 41560
328 Ga0495609_0206040 3300046538 Bacteria 820
329 Ga0495597_0000189 3300046542 Bacteria 55865
330 Ga0495597_0062345 3300046542 Bacteria 1622
331 Ga0495597_0087208 3300046542 Bacteria 1328
332 Ga0495645_0000420 3300046543 Bacteria 29291
333 Ga0495645_0025591 3300046543 Bacteria 4284
334 Ga0495645_0037999 3300046543 Bacteria 3511
335 Ga0495645_0123029 3300046543 Bacteria 1825
336 Ga0495645_0151260 3300046543 Bacteria 1612
337 Ga0495622_0016542 3300046557 Bacteria 3436
338 Ga0495622_0150055 3300046557 Bacteria 1055
339 Ga0495633_0024437 3300046558 Bacteria 2986
340 Ga0495656_0272442 3300046615 Bacteria 860
341 Ga0495668_0000280 3300046616 Bacteria 70339
342 Ga0495668_0011400 3300046616 Bacteria 5323
343 Ga0495668_0162461 3300046616 Bacteria 1223
344 Ga0495634_0006590 3300046642 Bacteria 8807
345 Ga0495634_0032032 3300046642 Bacteria 3617
346 Ga0495634_0111396 3300046642 Bacteria 1759
347 Ga0495634_0195495 3300046642 Bacteria 1259
348 Ga0495611_0064548 3300046648 Bacteria 1667
349 Ga0495625_0009564 3300046660 Bacteria 8099
350 Ga0495635_0001220 3300046663 Bacteria 17189
351 Ga0495635_0124940 3300046663 Bacteria 1754
352 Ga0495661_0004334 3300046665 Bacteria 10270
353 Ga0495661_0005138 3300046665 Bacteria 9329
354 Ga0495661_0043103 3300046665 Bacteria 2776
355 Ga0495588_0019041 3300046674 Bacteria 3358
356 Ga0495657_0011569 3300046675 Bacteria 6594
357 Ga0495599_0003930 3300046678 Bacteria 8744
358 Ga0495599_0135050 3300046678 Bacteria 1531
359 Ga0495623_0008585 3300046679 Bacteria 6633
360 Ga0495623_0010755 3300046679 Bacteria 5924
361 Ga0495623_0035698 3300046679 Bacteria 3186
362 Ga0495623_0094944 3300046679 Bacteria 1823
363 Ga0495623_0381793 3300046679 Bacteria 761
364 Ga0495623_0444325 3300046679 Bacteria 691
365 Ga0495646_0013777 3300046680 Bacteria 5141
366 Ga0495646_0042409 3300046680 Bacteria 2792
367 Ga0495646_0122023 3300046680 Bacteria 1474
368 Ga0495646_0189496 3300046680 Bacteria 1125
369 Ga0495646_0252354 3300046680 Bacteria 944
370 Ga0495646_0373292 3300046680 Bacteria 744
371 Ga0495669_0000013 3300046684 Bacteria 151423
372 Ga0495669_0056910 3300046684 Bacteria 1763
373 Ga0495669_0069315 3300046684 Bacteria 1605
374 Ga0495613_0034509 3300046689 Bacteria 3757
375 Ga0495613_0039051 3300046689 Bacteria 3519
376 Ga0495613_0084097 3300046689 Bacteria 2310
377 Ga0495624_0003455 3300046690 Bacteria 11708
378 Ga0495624_0003627 3300046690 Bacteria 11414
379 Ga0495624_0017587 3300046690 Bacteria 4796
380 Ga0495624_0032329 3300046690 Bacteria 3393
381 Ga0495624_0087784 3300046690 Bacteria 1920
382 Ga0495670_0010095 3300046691 Bacteria 4643
383 Ga0495671_0000197 3300046692 Bacteria 52984
384 Ga0495671_0069848 3300046692 Bacteria 1726
385 Ga0495649_0008562 3300046694 Bacteria 6145
386 Ga0495649_0018584 3300046694 Bacteria 3909
387 Ga0495649_0024969 3300046694 Bacteria 3330
388 Ga0495649_0031966 3300046694 Bacteria 2901
389 Ga0495649_0032219 3300046694 Bacteria 2888
390 Ga0495649_0110451 3300046694 Bacteria 1458
391 Ga0495649_0310651 3300046694 Bacteria 801
392 Ga0495649_0382646 3300046694 Bacteria 708
393 Ga0495589_0000227 3300046794 Bacteria 47488
394 Ga0495589_0000897 3300046794 Bacteria 18442
395 Ga0495589_0003352 3300046794 Bacteria 8690
396 Ga0495589_0009896 3300046794 Bacteria 4952
397 Ga0495589_0011308 3300046794 Bacteria 4633
398 Ga0495589_0027433 3300046794 Bacteria 2879
399 Ga0495589_0049074 3300046794 Bacteria 2089
400 Ga0495589_0098404 3300046794 Bacteria 1417
401 Ga0495589_0146248 3300046794 Bacteria 1130
402 Ga0495589_0251139 3300046794 Bacteria 826
403 Ga0495600_0000585 3300046809 Bacteria 18834
404 Ga0495600_0143051 3300046809 Bacteria 1551
405 Ga0495600_0143862 3300046809 Bacteria 1546
406 Ga0495600_0305084 3300046809 Bacteria 1004
407 Ga0495660_0123931 3300046810 Bacteria 1304
408 Ga0495660_0162941 3300046810 Bacteria 1092
409 Ga0495660_0271865 3300046810 Bacteria 778
410 Ga0495581_0003863 3300047315 Bacteria 8623
411 Ga0495581_0018771 3300047315 Bacteria 4014
412 Ga0495581_0027791 3300047315 Bacteria 3281
413 Ga0495604_0004713 3300047317 Bacteria 10813
414 Ga0495604_0021861 3300047317 Bacteria 5106
415 Ga0495604_0023274 3300047317 Bacteria 4941
416 Ga0495604_0043305 3300047317 Bacteria 3524
417 Ga0495604_0080830 3300047317 Bacteria 2434
418 Ga0495604_0141193 3300047317 Bacteria 1720
419 Ga0495604_0267468 3300047317 Bacteria 1159
420 Ga0495636_0003797 3300047318 Bacteria 5887
421 Ga0495636_0094229 3300047318 Bacteria 1303
422 Ga0495636_0325140 3300047318 Bacteria 723
423 Ga0495674_0005299 3300047319 Bacteria 12367
424 Ga0495674_0008343 3300047319 Bacteria 9876
425 Ga0495674_0010415 3300047319 Bacteria 8802
426 Ga0495674_0012703 3300047319 Bacteria 7935
427 Ga0495674_0012890 3300047319 Bacteria 7872
428 Ga0495674_0115874 3300047319 Bacteria 2267
429 Ga0495674_0214413 3300047319 Bacteria 1593
430 Ga0495672_0000530 3300047320 Bacteria 43361
431 Ga0495672_0002553 3300047320 Bacteria 16598
432 Ga0495672_0032527 3300047320 Bacteria 3243
433 Ga0495672_0081415 3300047320 Bacteria 1803
434 Ga0495672_0116518 3300047320 Bacteria 1426
435 Ga0495672_0123921 3300047320 Bacteria 1369
436 Ga0495676_0004540 3300047321 Bacteria 12692
437 Ga0495676_0049450 3300047321 Bacteria 3380
438 Ga0495676_0052303 3300047321 Bacteria 3261
439 Ga0495676_0109737 3300047321 Bacteria 2026
440 Ga0495676_0165929 3300047321 Bacteria 1558
441 Ga0495680_0041084 3300047322 Bacteria 3678
442 Ga0495680_0062084 3300047322 Bacteria 2873
443 Ga0495680_0069540 3300047322 Bacteria 2686
444 Ga0495680_0083857 3300047322 Bacteria 2402
445 Ga0495680_0155200 3300047322 Bacteria 1666
446 Ga0495683_0002852 3300047323 Bacteria 10233
447 Ga0495683_0002895 3300047323 Bacteria 10159
448 Ga0495683_0007903 3300047323 Bacteria 5708
449 Ga0495683_0015283 3300047323 Bacteria 3996
450 Ga0495683_0015879 3300047323 Bacteria 3911
451 Ga0495683_0016326 3300047323 Bacteria 3856
452 Ga0495683_0054378 3300047323 Bacteria 1995
453 Ga0495683_0098022 3300047323 Bacteria 1413
454 Ga0495683_0110384 3300047323 Bacteria 1313
455 Ga0495683_0179106 3300047323 Bacteria 969
456 Ga0495687_000005 3300047443 Bacteria 610401
457 Ga0495687_000007 3300047443 Bacteria 552679
458 Ga0495687_003923 3300047443 Bacteria 10417
459 Ga0495687_053426 3300047443 Bacteria 1701
460 Ga0495687_054215 3300047443 Bacteria 1684
461 Ga0495675_0001979 3300047444 Bacteria 12225
462 Ga0495675_0015848 3300047444 Bacteria 4766
463 Ga0495675_0040611 3300047444 Bacteria 2964
464 Ga0495675_0040647 3300047444 Bacteria 2963
465 Ga0495675_0087087 3300047444 Bacteria 1963
466 Ga0495677_0006049 3300047445 Bacteria 4576
467 Ga0495677_0008201 3300047445 Bacteria 3881
468 Ga0495679_000008 3300047446 Bacteria 367186
469 Ga0495679_057463 3300047446 Bacteria 1150
470 Ga0495673_0017974 3300047469 Bacteria 3576
471 Ga0495673_0058370 3300047469 Bacteria 1663
472 Ga0495681_0044381 3300047470 Bacteria 2137
473 Ga0495681_0330935 3300047470 Bacteria 583
474 Ga0495684_0029253 3300047471 Bacteria 4229
475 Ga0495684_0418674 3300047471 Bacteria 937
476 Ga0495686_0000021 3300047472 Bacteria 426560
477 Ga0495686_0027738 3300047472 Bacteria 3695
478 Ga0495686_0031758 3300047472 Bacteria 3421
479 Ga0495593_0004995 3300047673 Bacteria 7853
480 Ga0495593_0017191 3300047673 Bacteria 4070
481 Ga0495593_0017395 3300047673 Bacteria 4047
482 Ga0495593_0040214 3300047673 Bacteria 2518
483 Ga0495593_0048247 3300047673 Bacteria 2263
484 Ga0495593_0136278 3300047673 Bacteria 1244
485 Ga0495602_0013723 3300048088 Bacteria 8262
486 Ga0495602_0040716 3300048088 Bacteria 4255
487 Ga0495602_0043769 3300048088 Bacteria 4066
488 Ga0495602_0106491 3300048088 Bacteria 2288
489 Ga0495602_0128099 3300048088 Bacteria 2029
490 Ga0495602_0143668 3300048088 Bacteria 1885
491 Ga0495614_0004519 3300048089 Bacteria 6276
492 Ga0495614_0112791 3300048089 Bacteria 1194
493 Ga0495614_0373933 3300048089 Bacteria 666
494 Ga0495626_0000066 3300048091 Bacteria 141280
495 Ga0495626_0015603 3300048091 Bacteria 3883
496 Ga0495626_0017698 3300048091 Bacteria 3593
497 Ga0495626_0027971 3300048091 Bacteria 2737
498 Ga0495626_0029951 3300048091 Bacteria 2627
499 Ga0495626_0033317 3300048091 Bacteria 2470
500 Ga0495626_0035051 3300048091 Bacteria 2397
501 Ga0495626_0061299 3300048091 Bacteria 1711
502 Ga0495626_0061873 3300048091 Bacteria 1701
503 Ga0496100_0000086 3300048903 Bacteria 53043
504 Ga0496100_0052934 3300048903 Bacteria 2641
505 Ga0496101_0000224 3300048904 Bacteria 42435
506 Ga0496101_0036704 3300048904 Bacteria 3471
507 Ga0496102_0000520 3300048905 Bacteria 42004
508 Ga0496102_0007896 3300048905 Bacteria 9093
509 Ga0496102_0047407 3300048905 Bacteria 3904
510 Ga0496102_0444736 3300048905 Bacteria 1216
511 Ga0496102_0520937 3300048905 Bacteria 1111
512 Ga0496103_0000532 3300048906 Bacteria 30848
513 Ga0496103_0001352 3300048906 Bacteria 16552
514 Ga0496103_0005826 3300048906 Bacteria 7358
515 Ga0496103_0133131 3300048906 Bacteria 1588
516 Ga0496104_0026944 3300048907 Bacteria 5314
517 Ga0496104_0028772 3300048907 Bacteria 5150
518 Ga0496105_0027617 3300048908 Bacteria 4638
519 Ga0496105_0046250 3300048908 Bacteria 3592
520 Ga0496105_0113900 3300048908 Bacteria 2231
521 Ga0496105_0351817 3300048908 Bacteria 1176
522 Ga0496106_0007276 3300048909 Bacteria 8178
523 Ga0496106_0086254 3300048909 Bacteria 2418
524 Ga0496107_0795199 3300048910 Bacteria 693
525 Ga0496109_1082742 3300048912 Bacteria 739
526 Ga0496110_0014132 3300048913 Bacteria 6620
527 Ga0496110_0375147 3300048913 Bacteria 1296
528 Ga0496110_0734758 3300048913 Bacteria 890
529 Ga0496110_0738226 3300048913 Bacteria 887
530 Ga0496111_0003795 3300048914 Bacteria 9424
531 Ga0496112_0008709 3300048915 Bacteria 9099
532 Ga0496113_0017192 3300048916 Bacteria 5015
533 Ga0496113_0064476 3300048916 Bacteria 2770
534 Ga0496113_0427067 3300048916 Bacteria 1064
535 Ga0496115_0311314 3300048918 Bacteria 1289
536 Ga0496116_0005841 3300048919 Bacteria 11308
537 Ga0496116_0058591 3300048919 Bacteria 2510
538 Ga0496116_0231406 3300048919 Bacteria 937
539 Ga0496117_0000098 3300048920 Bacteria 196331
540 Ga0496117_0000449 3300048920 Bacteria 68459
541 Ga0496117_0003202 3300048920 Bacteria 19375
542 Ga0496117_0018184 3300048920 Bacteria 5835
543 Ga0496117_0091020 3300048920 Bacteria 1963
544 Ga0496117_0213928 3300048920 Bacteria 1078
545 Ga0496117_0216394 3300048920 Bacteria 1070
546 Ga0496118_0000728 3300048921 Bacteria 53140
547 Ga0496118_0007373 3300048921 Bacteria 11679
548 Ga0496118_0010833 3300048921 Bacteria 8979
549 Ga0496118_0061009 3300048921 Bacteria 2795
550 Ga0496118_0216570 3300048921 Bacteria 1119
551 Ga0496119_0051888 3300048922 Bacteria 2516
552 Ga0496119_0073170 3300048922 Bacteria 1999
553 Ga0496120_0086914 3300048923 Bacteria 1680
554 Ga0496121_0001239 3300048924 Bacteria 44338
555 Ga0496121_0002273 3300048924 Bacteria 29902
556 Ga0496121_0012843 3300048924 Bacteria 9064
557 Ga0496121_0064899 3300048924 Bacteria 2974
558 Ga0496122_0000034 3300048925 Bacteria 320661
559 Ga0496122_0046803 3300048925 Bacteria 3345
560 Ga0496123_0000141 3300048926 Bacteria 147111
561 Ga0496123_0021245 3300048926 Bacteria 5050
562 Ga0496123_0157094 3300048926 Bacteria 1218
563 Ga0496124_0089225 3300048927 Bacteria 2518
564 Ga0496124_0119263 3300048927 Bacteria 2110
565 Ga0496124_0400910 3300048927 Bacteria 952
566 Ga0496124_0427283 3300048927 Bacteria 911
567 Ga0496124_0429200 3300048927 Bacteria 908
568 Ga0496125_0009973 3300048928 Bacteria 9655
569 Ga0496125_0464700 3300048928 Bacteria 721
570 Ga0496126_0000728 3300048929 Bacteria 59766
571 Ga0496126_0001303 3300048929 Bacteria 39732
572 Ga0496126_0154428 3300048929 Bacteria 1965
573 Ga0495682_0021961 3300049460 Bacteria 2389
574 Ga0495682_0056399 3300049460 Bacteria 1424
575 Ga0495682_0061030 3300049460 Bacteria 1361
576 Ga0495682_0144677 3300049460 Bacteria 848
577 Ga0501034_0000050 3300049571 Bacteria 213092
578 Ga0501034_0000489 3300049571 Bacteria 64357
579 Ga0501043_0751048 3300049579 Bacteria 709
580 Ga0501047_0004667 3300049581 Bacteria 12891
581 Ga0501047_0029084 3300049581 Bacteria 5329
582 Ga0501067_0109824 3300049583 Bacteria 1533
583 Ga0501069_0000439 3300049585 Bacteria 18935
584 Ga0501070_0002940 3300049586 Bacteria 14832
585 Ga0501073_0000445 3300049589 Bacteria 28558
586 Ga0501074_0000251 3300049590 Bacteria 30181
587 Ga0501075_0462029 3300049591 Bacteria 968
588 Ga0501076_0257596 3300049592 Bacteria 1428
589 Ga0501079_0008339 3300049741 Bacteria 7852
590 Ga0501079_0953911 3300049741 Bacteria 675
591 Ga0501080_0026108 3300049742 Bacteria 5426
592 Ga0501080_0033413 3300049742 Bacteria 4800
593 Ga0501081_0036847 3300049743 Bacteria 3336
594 Ga0501083_0008196 3300049744 Bacteria 7393
595 Ga0501035_0139054 3300049822 Bacteria 2112
596 Ga0501044_0167175 3300049823 Bacteria 2173
597 nmdc:mga0n895_6492_c1 3300050512 Bacteria 9939
598 Ga0495619_0484821 3300053085 Bacteria 851
599 Ga0501084_0383882 3300054114 Bacteria 1187
600 Ga0501082_0028698 3300060353 Bacteria 4793
601 Ga0530510_0155515 3300061734 Bacteria 1690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100458386 Ga0307408_1004583862 153
2 3300031824 Ga0307413_10011037 Ga0307413_100110374 153
3 3300031852 Ga0307410_10037131 Ga0307410_100371312 153
4 3300031903 Ga0307407_10022326 Ga0307407_100223262 153
5 3300031911 Ga0307412_10030183 Ga0307412_100301832 153
6 3300031995 Ga0307409_100054345 Ga0307409_1000543453 153
7 3300032002 Ga0307416_100370265 Ga0307416_1003702652 153
8 3300032004 Ga0307414_10151288 Ga0307414_101512883 153
9 3300032005 Ga0307411_10017882 Ga0307411_100178823 153
10 3300032126 Ga0307415_100013445 Ga0307415_1000134453 153
11 3300047318 Ga0495636_0325140 Ga0495636_0325140_12_494 153
12 3300026089 Ga0207648_10231844 Ga0207648_102318442 154
13 3300047320 Ga0495672_0032527 Ga0495672_0032527_1689_2171 154
14 3300025937 Ga0207669_10529137 Ga0207669_105291372 158
15 3300027717 Ga0209998_10051503 Ga0209998_100515032 158
16 3300041498 Ga0451841_0552099 Ga0451841_0552099_15_518 158
17 3300005436 Ga0070713_100155536 Ga0070713_1001555363 159
18 3300031238 Ga0265332_10280993 Ga0265332_102809932 159
19 3300046461 Ga0495641_0110065 Ga0495641_0110065_731_1213 159
20 3300046462 Ga0495651_0137701 Ga0495651_0137701_607_1098 159
21 3300046679 Ga0495623_0381793 Ga0495623_0381793_30_512 159
22 3300046679 Ga0495623_0444325 Ga0495623_0444325_59_550 159
23 3300047320 Ga0495672_0116518 Ga0495672_0116518_838_1326 159
24 3300047446 Ga0495679_057463 Ga0495679_057463_644_1126 159
25 3300048907 Ga0496104_0026944 Ga0496104_0026944_1700_2191 159
26 3300049581 Ga0501047_0004667 Ga0501047_0004667_4612_5100 160
27 3300049581 Ga0501047_0029084 Ga0501047_0029084_2673_3161 160
28 3300049583 Ga0501067_0109824 Ga0501067_0109824_208_696 160
29 3300049585 Ga0501069_0000439 Ga0501069_0000439_4924_5412 160
30 3300049586 Ga0501070_0002940 Ga0501070_0002940_4996_5484 160
31 3300049589 Ga0501073_0000445 Ga0501073_0000445_18282_18770 160
32 3300049590 Ga0501074_0000251 Ga0501074_0000251_20123_20611 160
33 3300049592 Ga0501076_0257596 Ga0501076_0257596_827_1315 160
34 3300049741 Ga0501079_0008339 Ga0501079_0008339_3977_4465 160
35 3300049742 Ga0501080_0026108 Ga0501080_0026108_3648_4136 160
36 3300049742 Ga0501080_0033413 Ga0501080_0033413_3648_4136 160
37 3300049744 Ga0501083_0008196 Ga0501083_0008196_3777_4265 160
38 3300049822 Ga0501035_0139054 Ga0501035_0139054_410_898 160
39 3300060353 Ga0501082_0028698 Ga0501082_0028698_351_839 160
40 3300006871 Ga0075434_100017879 Ga0075434_1000178793 162
41 3300009094 Ga0111539_10658846 Ga0111539_106588462 162
42 3300032002 Ga0307416_101637009 Ga0307416_1016370092 162
43 3300045836 Ga0466958_0183534 Ga0466958_0183534_722_1231 162
44 3300046457 Ga0495590_0022794 Ga0495590_0022794_914_1414 162
45 3300049591 Ga0501075_0462029 Ga0501075_0462029_221_730 162
46 3300049741 Ga0501079_0953911 Ga0501079_0953911_11_520 162
47 3300049743 Ga0501081_0036847 Ga0501081_0036847_2402_2911 162
48 3300050512 nmdc:mga0n895_6492_c1 nmdc:mga0n895_6492_c1_4778_5278 162
49 3300053085 Ga0495619_0484821 Ga0495619_0484821_322_828 162
50 3300054114 Ga0501084_0383882 Ga0501084_0383882_159_668 162
51 3300061734 Ga0530510_0155515 Ga0530510_0155515_77_586 162
52 3300035241 Ga0373961_0004580 Ga0373961_0004580_2118_2627 164
53 3300046471 Ga0495650_0008821 Ga0495650_0008821_4223_4741 164
54 iso_pu_bacteria 2808606418 2809146566 164
55 iso_pu_bacteria 2881101125 2881103573 164
56 3300046524 Ga0495648_0013933 Ga0495648_0013933_4387_4899 165
57 3300047321 Ga0495676_0004540 Ga0495676_0004540_7960_8472 165
58 3300048913 Ga0496110_0375147 Ga0496110_0375147_349_861 165
59 3300014969 Ga0157376_10058029 Ga0157376_100580291 166
60 3300037312 Ga0395899_0013432 Ga0395899_0013432_2192_2716 166
61 3300037312 Ga0395899_0024028 Ga0395899_0024028_594_1118 166
62 3300037418 Ga0395900_0076553 Ga0395900_0076553_274_798 166
63 3300038443 Ga0395901_0007263 Ga0395901_0007263_10176_10700 166
64 3300046492 Ga0495585_0000171 Ga0495585_0000171_58666_59184 166
65 3300046506 Ga0495583_0000075 Ga0495583_0000075_53802_54314 166
66 3300048905 Ga0496102_0047407 Ga0496102_0047407_2862_3386 166
67 3300048906 Ga0496103_0133131 Ga0496103_0133131_568_1092 166
68 3300049579 Ga0501043_0751048 Ga0501043_0751048_102_638 166
69 3300049823 Ga0501044_0167175 Ga0501044_0167175_57_581 166
70 iso_pu_bacteria 2508501125 2509127347 166
71 iso_pu_bacteria 2513237151 2513959845 166
72 3300005338 Ga0068868_100555704 Ga0068868_1005557042 168
73 3300005353 Ga0070669_100064430 Ga0070669_1000644302 168
74 3300005356 Ga0070674_100751474 Ga0070674_1007514741 168
75 3300005577 Ga0068857_100033970 Ga0068857_1000339703 168
76 3300009176 Ga0105242_11679251 Ga0105242_116792511 168
77 3300011119 Ga0105246_10165185 Ga0105246_101651852 168
78 3300025923 Ga0207681_10044923 Ga0207681_100449232 168
79 3300026116 Ga0207674_10039950 Ga0207674_100399503 168
80 3300047673 Ga0495593_0048247 Ga0495593_0048247_1721_2233 168
81 iso_pu_bacteria 2842733646 2842739066 168
82 iso_pu_bacteria 8047673197 8047679506 168
83 3300031548 Ga0307408_100284942 Ga0307408_1002849422 169
84 3300031731 Ga0307405_10822417 Ga0307405_108224172 169
85 3300031911 Ga0307412_10167309 Ga0307412_101673092 169
86 3300032002 Ga0307416_100252409 Ga0307416_1002524092 169
87 3300032004 Ga0307414_11034172 Ga0307414_110341722 169
88 3300042007 Ga0439449_0239452 Ga0439449_0239452_61_588 169
89 3300009093 Ga0105240_10348774 Ga0105240_103487742 170
90 3300039438 Ga0436360_0488037 Ga0436360_0488037_36_548 170
91 3300046455 Ga0495603_0005061 Ga0495603_0005061_1552_2064 170
92 3300046472 Ga0495580_0035364 Ga0495580_0035364_121_633 170
93 3300046474 Ga0495605_0026263 Ga0495605_0026263_686_1198 170
94 3300046477 Ga0495664_0114099 Ga0495664_0114099_249_770 170
95 3300046506 Ga0495583_0004355 Ga0495583_0004355_6570_7082 170
96 3300046513 Ga0495616_0029302 Ga0495616_0029302_1803_2315 170
97 3300046516 Ga0495628_0068567 Ga0495628_0068567_1635_2156 170
98 3300046524 Ga0495648_0013768 Ga0495648_0013768_3867_4379 170
99 3300046528 Ga0495642_0047198 Ga0495642_0047198_848_1360 170
100 3300046531 Ga0495665_0025525 Ga0495665_0025525_1574_2086 170
101 3300046543 Ga0495645_0037999 Ga0495645_0037999_517_1038 170
102 3300046557 Ga0495622_0016542 Ga0495622_0016542_366_878 170
103 3300046680 Ga0495646_0189496 Ga0495646_0189496_90_611 170
104 3300046690 Ga0495624_0087784 Ga0495624_0087784_1077_1598 170
105 3300046692 Ga0495671_0069848 Ga0495671_0069848_152_664 170
106 3300046810 Ga0495660_0271865 Ga0495660_0271865_200_712 170
107 3300047317 Ga0495604_0080830 Ga0495604_0080830_260_781 170
108 3300047319 Ga0495674_0012703 Ga0495674_0012703_6557_7069 170
109 3300047320 Ga0495672_0123921 Ga0495672_0123921_258_770 170
110 3300047323 Ga0495683_0110384 Ga0495683_0110384_681_1193 170
111 3300047470 Ga0495681_0330935 Ga0495681_0330935_46_558 170
112 3300048091 Ga0495626_0027971 Ga0495626_0027971_1419_1931 170
113 3300048903 Ga0496100_0000086 Ga0496100_0000086_37165_37677 170
114 3300048904 Ga0496101_0000224 Ga0496101_0000224_34006_34518 170
115 3300048905 Ga0496102_0000520 Ga0496102_0000520_26125_26637 170
116 3300048905 Ga0496102_0520937 Ga0496102_0520937_151_663 170
117 3300048906 Ga0496103_0000532 Ga0496103_0000532_15394_15906 170
118 3300048907 Ga0496104_0028772 Ga0496104_0028772_3867_4379 170
119 3300048908 Ga0496105_0027617 Ga0496105_0027617_3039_3551 170
120 3300048908 Ga0496105_0351817 Ga0496105_0351817_425_937 170
121 3300048909 Ga0496106_0086254 Ga0496106_0086254_730_1242 170
122 3300048912 Ga0496109_1082742 Ga0496109_1082742_144_656 170
123 3300048913 Ga0496110_0738226 Ga0496110_0738226_356_868 170
124 3300048915 Ga0496112_0008709 Ga0496112_0008709_113_625 170
125 3300048916 Ga0496113_0064476 Ga0496113_0064476_1558_2070 170
126 3300048916 Ga0496113_0427067 Ga0496113_0427067_440_952 170
127 3300048919 Ga0496116_0058591 Ga0496116_0058591_1432_1944 170
128 3300048920 Ga0496117_0000098 Ga0496117_0000098_6208_6720 170
129 3300048921 Ga0496118_0000728 Ga0496118_0000728_37250_37762 170
130 3300048922 Ga0496119_0051888 Ga0496119_0051888_935_1447 170
131 3300048923 Ga0496120_0086914 Ga0496120_0086914_329_841 170
132 3300048924 Ga0496121_0001239 Ga0496121_0001239_28433_28945 170
133 3300048924 Ga0496121_0012843 Ga0496121_0012843_1230_1742 170
134 3300048927 Ga0496124_0089225 Ga0496124_0089225_162_674 170
135 3300048928 Ga0496125_0464700 Ga0496125_0464700_14_526 170
136 3300048929 Ga0496126_0154428 Ga0496126_0154428_641_1153 170
137 3300049460 Ga0495682_0021961 Ga0495682_0021961_723_1235 170
138 3300005327 Ga0070658_10000498 Ga0070658_100004987 171
139 3300005563 Ga0068855_100001573 Ga0068855_10000157317 171
140 3300009174 Ga0105241_10017623 Ga0105241_100176233 171
141 3300025909 Ga0207705_10001835 Ga0207705_1000183522 171
142 3300026142 Ga0207698_10083245 Ga0207698_100832453 171
143 3300031731 Ga0307405_10155180 Ga0307405_101551802 171
144 3300044683 Ga0466965_0134341 Ga0466965_0134341_681_1256 171
145 3300044684 Ga0466966_0094713 Ga0466966_0094713_405_980 171
146 3300044706 Ga0466964_0021906 Ga0466964_0021906_1250_1843 171
147 3300044765 Ga0466970_0076746 Ga0466970_0076746_1104_1679 171
148 3300044842 Ga0466957_0000384 Ga0466957_0000384_14946_15521 171
149 3300044901 Ga0466960_0077654 Ga0466960_0077654_67_642 171
150 3300045049 Ga0466959_0038113 Ga0466959_0038113_1609_2184 171
151 3300045836 Ga0466958_0147970 Ga0466958_0147970_535_1110 171
152 3300046452 Ga0495617_000001 Ga0495617_000001_485172_485750 171
153 3300046453 Ga0495627_000026 Ga0495627_000026_4038_4616 171
154 3300046457 Ga0495590_0000113 Ga0495590_0000113_21228_21818 171
155 3300046457 Ga0495590_0030732 Ga0495590_0030732_583_1176 171
156 3300046459 Ga0495629_0117210 Ga0495629_0117210_765_1343 171
157 3300046459 Ga0495629_0631270 Ga0495629_0631270_19_594 171
158 3300046463 Ga0495653_0009745 Ga0495653_0009745_3096_3671 171
159 3300046473 Ga0495582_0004361 Ga0495582_0004361_3925_4503 171
160 3300046473 Ga0495582_0047043 Ga0495582_0047043_1308_1883 171
161 3300046474 Ga0495605_0000004 Ga0495605_0000004_135044_135622 171
162 3300046474 Ga0495605_0011496 Ga0495605_0011496_3874_4452 171
163 3300046474 Ga0495605_0025720 Ga0495605_0025720_1285_1875 171
164 3300046474 Ga0495605_0081014 Ga0495605_0081014_577_1155 171
165 3300046492 Ga0495585_0019863 Ga0495585_0019863_1056_1634 171
166 3300046492 Ga0495585_0082974 Ga0495585_0082974_462_1040 171
167 3300046499 Ga0495594_0223969 Ga0495594_0223969_392_967 171
168 3300046500 Ga0495596_0002213 Ga0495596_0002213_4406_4984 171
169 3300046500 Ga0495596_0005125 Ga0495596_0005125_2612_3190 171
170 3300046500 Ga0495596_0012088 Ga0495596_0012088_1103_1696 171
171 3300046501 Ga0495607_0004258 Ga0495607_0004258_6088_6666 171
172 3300046501 Ga0495607_0044968 Ga0495607_0044968_926_1504 171
173 3300046506 Ga0495583_0063373 Ga0495583_0063373_687_1265 171
174 3300046506 Ga0495583_0116601 Ga0495583_0116601_343_936 171
175 3300046513 Ga0495616_0030647 Ga0495616_0030647_103_699 171
176 3300046513 Ga0495616_0034490 Ga0495616_0034490_958_1533 171
177 3300046513 Ga0495616_0041876 Ga0495616_0041876_395_973 171
178 3300046517 Ga0495630_0057889 Ga0495630_0057889_1658_2233 171
179 3300046518 Ga0495631_0107984 Ga0495631_0107984_60_638 171
180 3300046518 Ga0495631_0109364 Ga0495631_0109364_565_1143 171
181 3300046519 Ga0495632_0000012 Ga0495632_0000012_127791_128369 171
182 3300046522 Ga0495643_0000507 Ga0495643_0000507_40775_41353 171
183 3300046522 Ga0495643_0305994 Ga0495643_0305994_57_632 171
184 3300046523 Ga0495644_0013436 Ga0495644_0013436_950_1528 171
185 3300046523 Ga0495644_0020652 Ga0495644_0020652_1288_1866 171
186 3300046524 Ga0495648_0000022 Ga0495648_0000022_170374_170952 171
187 3300046524 Ga0495648_0001528 Ga0495648_0001528_21898_22488 171
188 3300046525 Ga0495663_0006925 Ga0495663_0006925_2487_3065 171
189 3300046526 Ga0495666_0097868 Ga0495666_0097868_770_1345 171
190 3300046526 Ga0495666_0112941 Ga0495666_0112941_181_756 171
191 3300046528 Ga0495642_0000001 Ga0495642_0000001_225944_226522 171
192 3300046528 Ga0495642_0007307 Ga0495642_0007307_2964_3542 171
193 3300046529 Ga0495652_0057939 Ga0495652_0057939_951_1526 171
194 3300046530 Ga0495654_0027351 Ga0495654_0027351_367_945 171
195 3300046530 Ga0495654_0042039 Ga0495654_0042039_1092_1670 171
196 3300046531 Ga0495665_0180126 Ga0495665_0180126_499_1074 171
197 3300046536 Ga0495587_0028642 Ga0495587_0028642_827_1402 171
198 3300046536 Ga0495587_0075183 Ga0495587_0075183_98_673 171
199 3300046538 Ga0495609_0000335 Ga0495609_0000335_22293_22883 171
200 3300046538 Ga0495609_0206040 Ga0495609_0206040_19_597 171
201 3300046542 Ga0495597_0000189 Ga0495597_0000189_51995_52588 171
202 3300046557 Ga0495622_0150055 Ga0495622_0150055_199_774 171
203 3300046558 Ga0495633_0024437 Ga0495633_0024437_337_915 171
204 3300046615 Ga0495656_0272442 Ga0495656_0272442_91_669 171
205 3300046616 Ga0495668_0000280 Ga0495668_0000280_65632_66210 171
206 3300046616 Ga0495668_0011400 Ga0495668_0011400_1219_1797 171
207 3300046616 Ga0495668_0162461 Ga0495668_0162461_588_1166 171
208 3300046642 Ga0495634_0032032 Ga0495634_0032032_206_781 171
209 3300046648 Ga0495611_0064548 Ga0495611_0064548_271_849 171
210 3300046660 Ga0495625_0009564 Ga0495625_0009564_844_1422 171
211 3300046665 Ga0495661_0004334 Ga0495661_0004334_2892_3470 171
212 3300046674 Ga0495588_0019041 Ga0495588_0019041_541_1116 171
213 3300046679 Ga0495623_0035698 Ga0495623_0035698_1321_1896 171
214 3300046679 Ga0495623_0094944 Ga0495623_0094944_522_1097 171
215 3300046680 Ga0495646_0122023 Ga0495646_0122023_845_1420 171
216 3300046684 Ga0495669_0000013 Ga0495669_0000013_87490_88068 171
217 3300046689 Ga0495613_0034509 Ga0495613_0034509_2193_2771 171
218 3300046691 Ga0495670_0010095 Ga0495670_0010095_3606_4184 171
219 3300046692 Ga0495671_0000197 Ga0495671_0000197_49280_49858 171
220 3300046694 Ga0495649_0031966 Ga0495649_0031966_1223_1801 171
221 3300046694 Ga0495649_0382646 Ga0495649_0382646_99_689 171
222 3300046794 Ga0495589_0000227 Ga0495589_0000227_2104_2697 171
223 3300046794 Ga0495589_0003352 Ga0495589_0003352_3827_4405 171
224 3300046794 Ga0495589_0009896 Ga0495589_0009896_2758_3348 171
225 3300046809 Ga0495600_0143862 Ga0495600_0143862_392_967 171
226 3300047315 Ga0495581_0018771 Ga0495581_0018771_2545_3123 171
227 3300047317 Ga0495604_0023274 Ga0495604_0023274_3003_3578 171
228 3300047318 Ga0495636_0094229 Ga0495636_0094229_396_974 171
229 3300047320 Ga0495672_0000530 Ga0495672_0000530_10099_10689 171
230 3300047320 Ga0495672_0002553 Ga0495672_0002553_2211_2789 171
231 3300047322 Ga0495680_0069540 Ga0495680_0069540_1406_1981 171
232 3300047323 Ga0495683_0015283 Ga0495683_0015283_2697_3287 171
233 3300047323 Ga0495683_0016326 Ga0495683_0016326_726_1304 171
234 3300047443 Ga0495687_000007 Ga0495687_000007_357886_358479 171
235 3300047444 Ga0495675_0040647 Ga0495675_0040647_478_1053 171
236 3300047444 Ga0495675_0087087 Ga0495675_0087087_517_1092 171
237 3300047445 Ga0495677_0006049 Ga0495677_0006049_2512_3090 171
238 3300047445 Ga0495677_0008201 Ga0495677_0008201_1550_2128 171
239 3300047470 Ga0495681_0044381 Ga0495681_0044381_1280_1858 171
240 3300047472 Ga0495686_0027738 Ga0495686_0027738_595_1173 171
241 3300047673 Ga0495593_0040214 Ga0495593_0040214_1810_2388 171
242 3300048088 Ga0495602_0040716 Ga0495602_0040716_668_1243 171
243 3300048089 Ga0495614_0112791 Ga0495614_0112791_447_1025 171
244 3300048091 Ga0495626_0000066 Ga0495626_0000066_52572_53150 171
245 3300048091 Ga0495626_0015603 Ga0495626_0015603_3125_3703 171
246 3300048091 Ga0495626_0017698 Ga0495626_0017698_375_953 171
247 3300048091 Ga0495626_0033317 Ga0495626_0033317_147_725 171
248 3300048091 Ga0495626_0035051 Ga0495626_0035051_1282_1890 171
249 3300048091 Ga0495626_0061299 Ga0495626_0061299_1091_1672 171
250 3300048925 Ga0496122_0000034 Ga0496122_0000034_227917_228450 171
251 3300048926 Ga0496123_0000141 Ga0496123_0000141_121204_121737 171
252 3300048926 Ga0496123_0157094 Ga0496123_0157094_176_715 171
253 3300048927 Ga0496124_0400910 Ga0496124_0400910_159_734 171
254 3300048927 Ga0496124_0427283 Ga0496124_0427283_146_679 171
255 3300048927 Ga0496124_0429200 Ga0496124_0429200_191_781 171
256 3300013105 Ga0157369_10296018 Ga0157369_102960182 172
257 3300025904 Ga0207647_10126803 Ga0207647_101268032 172
258 3300046454 Ga0495592_0058374 Ga0495592_0058374_544_1089 172
259 3300046459 Ga0495629_0001260 Ga0495629_0001260_9946_10491 172
260 3300046461 Ga0495641_0022184 Ga0495641_0022184_1962_2507 172
261 3300046463 Ga0495653_0017478 Ga0495653_0017478_704_1249 172
262 3300046471 Ga0495650_0000108 Ga0495650_0000108_124674_125288 172
263 3300046471 Ga0495650_0123211 Ga0495650_0123211_211_732 172
264 3300046472 Ga0495580_0241469 Ga0495580_0241469_64_609 172
265 3300046473 Ga0495582_0108490 Ga0495582_0108490_141_686 172
266 3300046476 Ga0495662_0046620 Ga0495662_0046620_1419_1964 172
267 3300046477 Ga0495664_0002734 Ga0495664_0002734_2629_3174 172
268 3300046500 Ga0495596_0006055 Ga0495596_0006055_3139_3753 172
269 3300046500 Ga0495596_0043113 Ga0495596_0043113_557_1102 172
270 3300046511 Ga0495608_0030313 Ga0495608_0030313_1662_2207 172
271 3300046514 Ga0495618_0008368 Ga0495618_0008368_606_1151 172
272 3300046516 Ga0495628_0096515 Ga0495628_0096515_1577_2122 172
273 3300046516 Ga0495628_0307348 Ga0495628_0307348_600_1145 172
274 3300046526 Ga0495666_0020377 Ga0495666_0020377_2606_3151 172
275 3300046529 Ga0495652_0217817 Ga0495652_0217817_844_1389 172
276 3300046531 Ga0495665_0021201 Ga0495665_0021201_1934_2455 172
277 3300046531 Ga0495665_0067388 Ga0495665_0067388_1097_1642 172
278 3300046533 Ga0495640_0320739 Ga0495640_0320739_302_823 172
279 3300046535 Ga0495586_0016355 Ga0495586_0016355_2222_2767 172
280 3300046535 Ga0495586_0109020 Ga0495586_0109020_633_1154 172
281 3300046543 Ga0495645_0025591 Ga0495645_0025591_2226_2747 172
282 3300046543 Ga0495645_0151260 Ga0495645_0151260_717_1262 172
283 3300046642 Ga0495634_0006590 Ga0495634_0006590_7266_7811 172
284 3300046642 Ga0495634_0195495 Ga0495634_0195495_516_1037 172
285 3300046663 Ga0495635_0124940 Ga0495635_0124940_917_1462 172
286 3300046675 Ga0495657_0011569 Ga0495657_0011569_5108_5653 172
287 3300046679 Ga0495623_0008585 Ga0495623_0008585_4222_4767 172
288 3300046680 Ga0495646_0042409 Ga0495646_0042409_1419_1964 172
289 3300046694 Ga0495649_0310651 Ga0495649_0310651_92_637 172
290 3300046794 Ga0495589_0251139 Ga0495589_0251139_77_622 172
291 3300046809 Ga0495600_0000585 Ga0495600_0000585_9715_10260 172
292 3300046809 Ga0495600_0305084 Ga0495600_0305084_134_655 172
293 3300047315 Ga0495581_0027791 Ga0495581_0027791_811_1356 172
294 3300047317 Ga0495604_0141193 Ga0495604_0141193_570_1115 172
295 3300047321 Ga0495676_0109737 Ga0495676_0109737_637_1182 172
296 3300047322 Ga0495680_0062084 Ga0495680_0062084_1489_2034 172
297 3300047323 Ga0495683_0098022 Ga0495683_0098022_585_1130 172
298 3300047443 Ga0495687_054215 Ga0495687_054215_226_771 172
299 3300047444 Ga0495675_0001979 Ga0495675_0001979_8287_8832 172
300 3300047673 Ga0495593_0136278 Ga0495593_0136278_255_800 172
301 3300048089 Ga0495614_0373933 Ga0495614_0373933_107_652 172
302 3300048913 Ga0496110_0734758 Ga0496110_0734758_355_876 172
303 3300048920 Ga0496117_0216394 Ga0496117_0216394_359_904 172
304 3300048921 Ga0496118_0216570 Ga0496118_0216570_269_814 172
305 3300013306 Ga0163162_10008204 Ga0163162_100082046 173
306 3300013306 Ga0163162_10204456 Ga0163162_102044562 173
307 3300044656 Ga0466969_0114846 Ga0466969_0114846_551_1135 173
308 3300044684 Ga0466966_0003675 Ga0466966_0003675_3808_4392 173
309 3300044693 Ga0466961_0011395 Ga0466961_0011395_2856_3440 173
310 3300044765 Ga0466970_0015839 Ga0466970_0015839_955_1539 173
311 3300045049 Ga0466959_0003358 Ga0466959_0003358_9090_9674 173
312 3300046474 Ga0495605_0170824 Ga0495605_0170824_91_621 173
313 3300046694 Ga0495649_0110451 Ga0495649_0110451_655_1185 173
314 3300046794 Ga0495589_0098404 Ga0495589_0098404_436_984 173
315 3300047319 Ga0495674_0012890 Ga0495674_0012890_4781_5305 173
316 3300047443 Ga0495687_053426 Ga0495687_053426_13_543 173
317 3300047472 Ga0495686_0000021 Ga0495686_0000021_331393_331941 173
318 3300048910 Ga0496107_0795199 Ga0496107_0795199_127_657 173
319 3300049571 Ga0501034_0000050 Ga0501034_0000050_60732_61286 173
320 iso_pu_bacteria 2738541296 2738820238 173
321 iso_pu_bacteria 2738541298 2738832718 173
322 iso_pu_bacteria 2738541306 2738874245 173
323 iso_pu_bacteria 2738543002 2739185875 173
324 iso_pu_bacteria 2738543008 2739220843 173
325 iso_pu_bacteria 2842324504 2842327987 173
326 iso_pu_bacteria 2842348783 2842352304 173
327 iso_pu_bacteria 2842454564 2842458540 173
328 iso_pu_bacteria 2945934425 2945938991 173
329 iso_pu_bacteria 2990703756 2990708993 173
330 iso_pu_bacteria 641736151 642421225 173
331 3300037312 Ga0395899_0008222 Ga0395899_0008222_2546_3073 174
332 3300037418 Ga0395900_0000389 Ga0395900_0000389_14997_15524 174
333 3300037466 Ga0395898_0000866 Ga0395898_0000866_19782_20309 174
334 3300037471 Ga0395905_0207038 Ga0395905_0207038_1249_1776 174
335 3300038443 Ga0395901_0000164 Ga0395901_0000164_33964_34491 174
336 3300046454 Ga0495592_0283194 Ga0495592_0283194_246_773 174
337 3300046458 Ga0495591_000435 Ga0495591_000435_12841_13368 174
338 3300046459 Ga0495629_0189073 Ga0495629_0189073_803_1330 174
339 3300046462 Ga0495651_0005717 Ga0495651_0005717_7639_8166 174
340 3300046463 Ga0495653_0041012 Ga0495653_0041012_1918_2445 174
341 3300046463 Ga0495653_0067263 Ga0495653_0067263_1918_2445 174
342 3300046472 Ga0495580_0022292 Ga0495580_0022292_3059_3586 174
343 3300046473 Ga0495582_0001985 Ga0495582_0001985_6859_7386 174
344 3300046476 Ga0495662_0050819 Ga0495662_0050819_640_1167 174
345 3300046477 Ga0495664_0001481 Ga0495664_0001481_1439_1966 174
346 3300046500 Ga0495596_0002760 Ga0495596_0002760_3294_3821 174
347 3300046507 Ga0495606_0106284 Ga0495606_0106284_189_716 174
348 3300046511 Ga0495608_0070854 Ga0495608_0070854_984_1511 174
349 3300046514 Ga0495618_0005736 Ga0495618_0005736_570_1097 174
350 3300046516 Ga0495628_0087665 Ga0495628_0087665_1043_1570 174
351 3300046517 Ga0495630_0177323 Ga0495630_0177323_991_1518 174
352 3300046524 Ga0495648_0030148 Ga0495648_0030148_570_1097 174
353 3300046526 Ga0495666_0006042 Ga0495666_0006042_3187_3714 174
354 3300046529 Ga0495652_0114718 Ga0495652_0114718_1312_1839 174
355 3300046531 Ga0495665_0013162 Ga0495665_0013162_3462_3989 174
356 3300046533 Ga0495640_0003796 Ga0495640_0003796_3139_3666 174
357 3300046535 Ga0495586_0044096 Ga0495586_0044096_419_946 174
358 3300046536 Ga0495587_0001077 Ga0495587_0001077_13872_14399 174
359 3300046543 Ga0495645_0123029 Ga0495645_0123029_852_1379 174
360 3300046642 Ga0495634_0111396 Ga0495634_0111396_886_1413 174
361 3300046663 Ga0495635_0001220 Ga0495635_0001220_13703_14230 174
362 3300046665 Ga0495661_0005138 Ga0495661_0005138_641_1168 174
363 3300046678 Ga0495599_0003930 Ga0495599_0003930_5242_5769 174
364 3300046679 Ga0495623_0010755 Ga0495623_0010755_1819_2346 174
365 3300046680 Ga0495646_0252354 Ga0495646_0252354_322_849 174
366 3300046680 Ga0495646_0373292 Ga0495646_0373292_23_550 174
367 3300046689 Ga0495613_0084097 Ga0495613_0084097_843_1370 174
368 3300046690 Ga0495624_0032329 Ga0495624_0032329_2511_3038 174
369 3300046794 Ga0495589_0000897 Ga0495589_0000897_5519_6046 174
370 3300046809 Ga0495600_0143051 Ga0495600_0143051_527_1054 174
371 3300047315 Ga0495581_0003863 Ga0495581_0003863_4369_4896 174
372 3300047317 Ga0495604_0021861 Ga0495604_0021861_2669_3196 174
373 3300047317 Ga0495604_0267468 Ga0495604_0267468_301_828 174
374 3300047319 Ga0495674_0214413 Ga0495674_0214413_766_1293 174
375 3300047321 Ga0495676_0052303 Ga0495676_0052303_65_592 174
376 3300047322 Ga0495680_0041084 Ga0495680_0041084_641_1168 174
377 3300047322 Ga0495680_0083857 Ga0495680_0083857_395_922 174
378 3300047323 Ga0495683_0002895 Ga0495683_0002895_4099_4626 174
379 3300047444 Ga0495675_0015848 Ga0495675_0015848_3497_4024 174
380 3300047444 Ga0495675_0040611 Ga0495675_0040611_78_605 174
381 3300047469 Ga0495673_0058370 Ga0495673_0058370_730_1257 174
382 3300047471 Ga0495684_0418674 Ga0495684_0418674_298_825 174
383 3300047673 Ga0495593_0004995 Ga0495593_0004995_3003_3530 174
384 3300048088 Ga0495602_0106491 Ga0495602_0106491_580_1107 174
385 3300048088 Ga0495602_0128099 Ga0495602_0128099_332_859 174
386 3300048088 Ga0495602_0143668 Ga0495602_0143668_349_876 174
387 3300048089 Ga0495614_0004519 Ga0495614_0004519_5367_5894 174
388 3300048920 Ga0496117_0000449 Ga0496117_0000449_62417_62977 174
389 3300048929 Ga0496126_0000728 Ga0496126_0000728_17088_17648 174
390 3300049460 Ga0495682_0061030 Ga0495682_0061030_813_1340 174
391 iso_pu_bacteria 2512047030 2512349294 174
392 iso_pu_bacteria 2513237082 2513556622 174
393 iso_pu_bacteria 2513237083 2513562646 174
394 iso_pu_bacteria 2513237166 2514051724 174
395 iso_pu_bacteria 2526164713 2527076093 174
396 iso_pu_bacteria 2562617112 2563059892 174
397 iso_pu_bacteria 2596583598 2597031949 174
398 iso_pu_bacteria 2711768613 2713480393 174
399 iso_pu_bacteria 2885266251 2885267525 174
400 iso_pu_bacteria 2885270888 2885275994 174
401 iso_pu_bacteria 2900634093 2900634664 174
402 iso_pu_bacteria 2904483920 2904485266 174
403 iso_pu_bacteria 2919527303 2919532295 174
404 iso_pu_bacteria 642555112 642598340 174
405 iso_pu_bacteria 642555113 642621741 174
406 iso_pu_bacteria 8003955200 8003959960 174
407 iso_pu_bacteria 8055301274 8055302787 174
408 3300016635 Ga0183361_10004 Ga0183361_10004196 175
409 3300046459 Ga0495629_0000186 Ga0495629_0000186_24720_25292 175
410 3300046463 Ga0495653_0000376 Ga0495653_0000376_31549_32121 175
411 3300046471 Ga0495650_0042349 Ga0495650_0042349_750_1325 175
412 3300046472 Ga0495580_0007599 Ga0495580_0007599_5306_5878 175
413 3300046473 Ga0495582_0288010 Ga0495582_0288010_56_628 175
414 3300046477 Ga0495664_0110781 Ga0495664_0110781_357_929 175
415 3300046516 Ga0495628_0015628 Ga0495628_0015628_2530_3102 175
416 3300046524 Ga0495648_0043409 Ga0495648_0043409_694_1266 175
417 3300046526 Ga0495666_0179067 Ga0495666_0179067_142_714 175
418 3300046680 Ga0495646_0013777 Ga0495646_0013777_3875_4447 175
419 3300046689 Ga0495613_0039051 Ga0495613_0039051_719_1291 175
420 3300046690 Ga0495624_0003455 Ga0495624_0003455_2835_3407 175
421 3300047319 Ga0495674_0005299 Ga0495674_0005299_6490_7062 175
422 3300047321 Ga0495676_0049450 Ga0495676_0049450_160_732 175
423 3300048906 Ga0496103_0001352 Ga0496103_0001352_1895_2425 175
424 3300048920 Ga0496117_0091020 Ga0496117_0091020_888_1418 175
425 3300048921 Ga0496118_0061009 Ga0496118_0061009_908_1438 175
426 3300009176 Ga0105242_11049621 Ga0105242_110496212 176
427 3300025924 Ga0207694_10382069 Ga0207694_103820692 176
428 3300031548 Ga0307408_100024373 Ga0307408_1000243733 176
429 3300031731 Ga0307405_10070512 Ga0307405_100705122 176
430 3300031903 Ga0307407_10526905 Ga0307407_105269052 176
431 3300032002 Ga0307416_100244400 Ga0307416_1002444002 176
432 3300039447 Ga0436361_1020675 Ga0436361_1020675_5831_6382 176
433 3300046454 Ga0495592_0040789 Ga0495592_0040789_2842_3402 176
434 3300046459 Ga0495629_0150111 Ga0495629_0150111_846_1394 176
435 3300046477 Ga0495664_0059564 Ga0495664_0059564_334_894 176
436 3300046516 Ga0495628_0173104 Ga0495628_0173104_333_893 176
437 3300046531 Ga0495665_0097818 Ga0495665_0097818_966_1502 176
438 3300046543 Ga0495645_0000420 Ga0495645_0000420_23770_24330 176
439 3300047319 Ga0495674_0010415 Ga0495674_0010415_1980_2528 176
440 3300047319 Ga0495674_0115874 Ga0495674_0115874_1028_1576 176
441 3300048918 Ga0496115_0311314 Ga0496115_0311314_363_911 176
442 3300001979 JGI24740J21852_10003487 JGI24740J21852_100034875 177
443 3300001989 JGI24739J22299_10001991 JGI24739J22299_100019912 177
444 3300001990 JGI24737J22298_10036444 JGI24737J22298_100364443 177
445 3300002067 JGI24735J21928_10000412 JGI24735J21928_100004128 177
446 3300002067 JGI24735J21928_10001774 JGI24735J21928_100017746 177
447 3300002067 JGI24735J21928_10020237 JGI24735J21928_100202372 177
448 3300002075 JGI24738J21930_10017529 JGI24738J21930_100175292 177
449 3300002705 JGI25156J39149_1000549 JGI25156J39149_100054916 177
450 3300002705 JGI25156J39149_1000627 JGI25156J39149_100062715 177
451 3300002705 JGI25156J39149_1000829 JGI25156J39149_10008296 177
452 3300003187 JGI25151J46595_10005293 JGI25151J46595_100052934 177
453 3300003187 JGI25151J46595_10034051 JGI25151J46595_100340512 177
454 3300003214 JGI25165J46597_1001074 JGI25165J46597_10010742 177
455 3300003322 rootL2_10024132 rootL2_100241324 177
456 3300003354 JGI25160J50197_1000184 JGI25160J50197_100018433 177
457 3300003756 Ga0055533_1000123 Ga0055533_100012360 177
458 3300003756 Ga0055533_1001475 Ga0055533_10014753 177
459 3300003758 Ga0055532_1000076 Ga0055532_100007682 177
460 3300003760 Ga0055527_1000038 Ga0055527_100003882 177
461 3300003761 Ga0055535_1000060 Ga0055535_100006029 177
462 3300003762 Ga0055542_1000089 Ga0055542_100008982 177
463 3300003763 Ga0055529_1000106 Ga0055529_100010682 177
464 3300005262 Ga0065165_1000040 Ga0065165_10000409 177
465 3300005335 Ga0070666_10287294 Ga0070666_102872942 177
466 3300005339 Ga0070660_100025247 Ga0070660_1000252474 177
467 3300005344 Ga0070661_100792864 Ga0070661_1007928641 177
468 3300005455 Ga0070663_100022887 Ga0070663_1000228872 177
469 3300005563 Ga0068855_100172487 Ga0068855_1001724872 177
470 3300005842 Ga0068858_101154377 Ga0068858_1011543772 177
471 3300009011 Ga0105251_10000175 Ga0105251_100001755 177
472 3300009093 Ga0105240_10442119 Ga0105240_104421192 177
473 3300009101 Ga0105247_10075942 Ga0105247_100759422 177
474 3300009551 Ga0105238_10041130 Ga0105238_100411302 177
475 3300009551 Ga0105238_11073749 Ga0105238_110737492 177
476 3300011119 Ga0105246_10839819 Ga0105246_108398192 177
477 3300013105 Ga0157369_10290446 Ga0157369_102904462 177
478 3300013296 Ga0157374_10060973 Ga0157374_100609733 177
479 3300025206 Ga0209435_102634 Ga0209435_1026343 177
480 3300025226 Ga0209674_100005 Ga0209674_10000528 177
481 3300025226 Ga0209674_100093 Ga0209674_10009357 177
482 3300025228 Ga0209672_100001 Ga0209672_100001498 177
483 3300025229 Ga0209147_100001 Ga0209147_100001498 177
484 3300025230 Ga0209563_100758 Ga0209563_1007582 177
485 3300025231 Ga0207427_105577 Ga0207427_1055772 177
486 3300025242 Ga0209258_100001 Ga0209258_100001498 177
487 3300025254 Ga0209148_1000003 Ga0209148_1000003498 177
488 3300025256 Ga0209759_1000039 Ga0209759_1000039102 177
489 3300025256 Ga0209759_1000074 Ga0209759_1000074144 177
490 3300025256 Ga0209759_1000202 Ga0209759_100020240 177
491 3300025256 Ga0209759_1026535 Ga0209759_10265352 177
492 3300025261 Ga0209233_1000198 Ga0209233_100019829 177
493 3300025272 Ga0209455_1000001 Ga0209455_1000001498 177
494 3300025273 Ga0209673_1093259 Ga0209673_10932591 177
495 3300025284 Ga0209130_1007485 Ga0209130_10074852 177
496 3300025291 Ga0209675_1005538 Ga0209675_10055382 177
497 3300025294 Ga0209025_1000291 Ga0209025_100029129 177
498 3300025294 Ga0209025_1001868 Ga0209025_100186814 177
499 3300025295 Ga0209564_1004353 Ga0209564_10043537 177
500 3300025302 Ga0207426_1000004 Ga0207426_1000004688 177
501 3300025302 Ga0207426_1002716 Ga0207426_100271610 177
502 3300025735 Ga0207713_1013187 Ga0207713_10131874 177
503 3300025903 Ga0207680_10303364 Ga0207680_103033642 177
504 3300025904 Ga0207647_10016779 Ga0207647_100167793 177
505 3300025904 Ga0207647_10057540 Ga0207647_100575402 177
506 3300025913 Ga0207695_10212401 Ga0207695_102124012 177
507 3300025913 Ga0207695_10373428 Ga0207695_103734282 177
508 3300025913 Ga0207695_10499672 Ga0207695_104996721 177
509 3300025919 Ga0207657_10109880 Ga0207657_101098802 177
510 3300025934 Ga0207686_10832179 Ga0207686_108321791 177
511 3300025949 Ga0207667_10331258 Ga0207667_103312582 177
512 3300025960 Ga0207651_10598864 Ga0207651_105988642 177
513 3300025972 Ga0207668_10406010 Ga0207668_104060102 177
514 3300026067 Ga0207678_10129282 Ga0207678_101292822 177
515 3300028379 Ga0268266_10912865 Ga0268266_109128652 177
516 3300031911 Ga0307412_10000015 Ga0307412_1000001537 177
517 3300037471 Ga0395905_0000017 Ga0395905_0000017_164803_165363 177
518 3300039438 Ga0436360_1255352 Ga0436360_1255352_298_834 177
519 3300044684 Ga0466966_0076420 Ga0466966_0076420_68_628 177
520 3300044693 Ga0466961_0009736 Ga0466961_0009736_335_895 177
521 3300044765 Ga0466970_0025746 Ga0466970_0025746_35_595 177
522 3300044842 Ga0466957_0325617 Ga0466957_0325617_287_847 177
523 3300044901 Ga0466960_0024327 Ga0466960_0024327_1114_1710 177
524 3300045836 Ga0466958_0368219 Ga0466958_0368219_25_585 177
525 3300046457 Ga0495590_0027155 Ga0495590_0027155_646_1239 177
526 3300046459 Ga0495629_0040458 Ga0495629_0040458_2118_2687 177
527 3300046462 Ga0495651_0045524 Ga0495651_0045524_586_1167 177
528 3300046463 Ga0495653_0040785 Ga0495653_0040785_1366_1911 177
529 3300046463 Ga0495653_0176628 Ga0495653_0176628_593_1174 177
530 3300046471 Ga0495650_0002624 Ga0495650_0002624_5239_5820 177
531 3300046472 Ga0495580_0000694 Ga0495580_0000694_6446_7027 177
532 3300046472 Ga0495580_0031336 Ga0495580_0031336_2278_2856 177
533 3300046472 Ga0495580_0050990 Ga0495580_0050990_1048_1629 177
534 3300046473 Ga0495582_0018186 Ga0495582_0018186_3028_3609 177
535 3300046474 Ga0495605_0005920 Ga0495605_0005920_4363_4920 177
536 3300046474 Ga0495605_0054146 Ga0495605_0054146_347_928 177
537 3300046491 Ga0495584_0091702 Ga0495584_0091702_917_1462 177
538 3300046499 Ga0495594_0004763 Ga0495594_0004763_2413_2991 177
539 3300046500 Ga0495596_0043432 Ga0495596_0043432_792_1349 177
540 3300046500 Ga0495596_0050251 Ga0495596_0050251_782_1351 177
541 3300046500 Ga0495596_0171947 Ga0495596_0171947_246_791 177
542 3300046506 Ga0495583_0132863 Ga0495583_0132863_23_580 177
543 3300046507 Ga0495606_0007787 Ga0495606_0007787_2910_3479 177
544 3300046507 Ga0495606_0009810 Ga0495606_0009810_2095_2652 177
545 3300046507 Ga0495606_0026033 Ga0495606_0026033_415_1008 177
546 3300046507 Ga0495606_0063237 Ga0495606_0063237_151_732 177
547 3300046507 Ga0495606_0081970 Ga0495606_0081970_657_1202 177
548 3300046512 Ga0495610_0001465 Ga0495610_0001465_11800_12333 177
549 3300046515 Ga0495620_0009809 Ga0495620_0009809_303_884 177
550 3300046515 Ga0495620_0201479 Ga0495620_0201479_54_623 177
551 3300046516 Ga0495628_0073612 Ga0495628_0073612_46_627 177
552 3300046517 Ga0495630_0001317 Ga0495630_0001317_3115_3696 177
553 3300046519 Ga0495632_0111239 Ga0495632_0111239_504_1085 177
554 3300046522 Ga0495643_0217828 Ga0495643_0217828_280_837 177
555 3300046524 Ga0495648_0107439 Ga0495648_0107439_760_1317 177
556 3300046526 Ga0495666_0007191 Ga0495666_0007191_2616_3194 177
557 3300046526 Ga0495666_0037200 Ga0495666_0037200_960_1541 177
558 3300046528 Ga0495642_0044928 Ga0495642_0044928_815_1372 177
559 3300046528 Ga0495642_0153464 Ga0495642_0153464_208_768 177
560 3300046529 Ga0495652_0509686 Ga0495652_0509686_197_778 177
561 3300046530 Ga0495654_0165743 Ga0495654_0165743_287_832 177
562 3300046531 Ga0495665_0003954 Ga0495665_0003954_2278_2856 177
563 3300046531 Ga0495665_0128740 Ga0495665_0128740_114_695 177
564 3300046531 Ga0495665_0368643 Ga0495665_0368643_121_702 177
565 3300046542 Ga0495597_0062345 Ga0495597_0062345_60_605 177
566 3300046542 Ga0495597_0087208 Ga0495597_0087208_183_764 177
567 3300046665 Ga0495661_0043103 Ga0495661_0043103_1172_1753 177
568 3300046678 Ga0495599_0135050 Ga0495599_0135050_624_1205 177
569 3300046684 Ga0495669_0056910 Ga0495669_0056910_312_857 177
570 3300046684 Ga0495669_0069315 Ga0495669_0069315_805_1374 177
571 3300046690 Ga0495624_0003627 Ga0495624_0003627_2324_2905 177
572 3300046690 Ga0495624_0017587 Ga0495624_0017587_751_1329 177
573 3300046694 Ga0495649_0008562 Ga0495649_0008562_3963_4556 177
574 3300046694 Ga0495649_0018584 Ga0495649_0018584_1278_1823 177
575 3300046694 Ga0495649_0024969 Ga0495649_0024969_2256_2813 177
576 3300046694 Ga0495649_0032219 Ga0495649_0032219_568_1137 177
577 3300046794 Ga0495589_0011308 Ga0495589_0011308_2159_2716 177
578 3300046794 Ga0495589_0027433 Ga0495589_0027433_628_1197 177
579 3300046794 Ga0495589_0049074 Ga0495589_0049074_1332_1913 177
580 3300046794 Ga0495589_0146248 Ga0495589_0146248_313_873 177
581 3300046810 Ga0495660_0123931 Ga0495660_0123931_494_1087 177
582 3300046810 Ga0495660_0162941 Ga0495660_0162941_496_1053 177
583 3300047317 Ga0495604_0004713 Ga0495604_0004713_9427_10008 177
584 3300047317 Ga0495604_0043305 Ga0495604_0043305_2395_2973 177
585 3300047318 Ga0495636_0003797 Ga0495636_0003797_4929_5507 177
586 3300047319 Ga0495674_0008343 Ga0495674_0008343_5784_6365 177
587 3300047320 Ga0495672_0081415 Ga0495672_0081415_867_1412 177
588 3300047321 Ga0495676_0165929 Ga0495676_0165929_818_1375 177
589 3300047322 Ga0495680_0155200 Ga0495680_0155200_106_651 177
590 3300047323 Ga0495683_0002852 Ga0495683_0002852_4402_4995 177
591 3300047323 Ga0495683_0007903 Ga0495683_0007903_4768_5349 177
592 3300047323 Ga0495683_0015879 Ga0495683_0015879_1598_2143 177
593 3300047323 Ga0495683_0054378 Ga0495683_0054378_1285_1830 177
594 3300047323 Ga0495683_0179106 Ga0495683_0179106_276_812 177
595 3300047443 Ga0495687_000005 Ga0495687_000005_531037_531597 177
596 3300047443 Ga0495687_003923 Ga0495687_003923_8172_8729 177
597 3300047446 Ga0495679_000008 Ga0495679_000008_341200_341781 177
598 3300047469 Ga0495673_0017974 Ga0495673_0017974_997_1578 177
599 3300047471 Ga0495684_0029253 Ga0495684_0029253_166_747 177
600 3300047472 Ga0495686_0031758 Ga0495686_0031758_2513_3094 177
601 3300047673 Ga0495593_0017191 Ga0495593_0017191_2813_3394 177
602 3300047673 Ga0495593_0017395 Ga0495593_0017395_2018_2563 177
603 3300048088 Ga0495602_0013723 Ga0495602_0013723_6260_6805 177
604 3300048088 Ga0495602_0043769 Ga0495602_0043769_1135_1713 177
605 3300048091 Ga0495626_0029951 Ga0495626_0029951_1783_2364 177
606 3300048091 Ga0495626_0061873 Ga0495626_0061873_526_1083 177
607 3300048903 Ga0496100_0052934 Ga0496100_0052934_1548_2093 177
608 3300048904 Ga0496101_0036704 Ga0496101_0036704_2292_2837 177
609 3300048905 Ga0496102_0007896 Ga0496102_0007896_5424_5969 177
610 3300048905 Ga0496102_0444736 Ga0496102_0444736_253_822 177
611 3300048906 Ga0496103_0005826 Ga0496103_0005826_5486_6031 177
612 3300048908 Ga0496105_0046250 Ga0496105_0046250_1345_1890 177
613 3300048908 Ga0496105_0113900 Ga0496105_0113900_1208_1777 177
614 3300048909 Ga0496106_0007276 Ga0496106_0007276_2980_3525 177
615 3300048913 Ga0496110_0014132 Ga0496110_0014132_763_1308 177
616 3300048914 Ga0496111_0003795 Ga0496111_0003795_6264_6809 177
617 3300048916 Ga0496113_0017192 Ga0496113_0017192_3124_3669 177
618 3300048919 Ga0496116_0005841 Ga0496116_0005841_6509_7054 177
619 3300048919 Ga0496116_0231406 Ga0496116_0231406_315_872 177
620 3300048920 Ga0496117_0003202 Ga0496117_0003202_7295_7852 177
621 3300048920 Ga0496117_0018184 Ga0496117_0018184_4320_4865 177
622 3300048920 Ga0496117_0213928 Ga0496117_0213928_370_951 177
623 3300048921 Ga0496118_0007373 Ga0496118_0007373_2424_2969 177
624 3300048921 Ga0496118_0010833 Ga0496118_0010833_1770_2327 177
625 3300048922 Ga0496119_0073170 Ga0496119_0073170_123_668 177
626 3300048924 Ga0496121_0002273 Ga0496121_0002273_4584_5129 177
627 3300048924 Ga0496121_0064899 Ga0496121_0064899_1591_2172 177
628 3300048925 Ga0496122_0046803 Ga0496122_0046803_353_898 177
629 3300048926 Ga0496123_0021245 Ga0496123_0021245_2412_2957 177
630 3300048927 Ga0496124_0119263 Ga0496124_0119263_931_1476 177
631 3300048928 Ga0496125_0009973 Ga0496125_0009973_6569_7114 177
632 3300048929 Ga0496126_0001303 Ga0496126_0001303_24380_24937 177
633 3300049460 Ga0495682_0056399 Ga0495682_0056399_131_724 177
634 3300049460 Ga0495682_0144677 Ga0495682_0144677_250_831 177
635 3300049571 Ga0501034_0000489 Ga0501034_0000489_44106_44678 177
636 iso_pu_bacteria 2515154123 2515688700 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

82

161

0.91

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

14

83

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9688 7 164
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9575 14 167
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.957 14 166
1t3q-assembly1.cif.gz_D crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.9564 13 166
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9538 14 166
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9544 90 164 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9493 90 165 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9432 12 88 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9356 14 88 3.10.20.30
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9346 91 164 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A1D2SJ80-F1-model_v4 (2Fe-2S)-binding protein 0.9848 8 173 GO:0016491
GO:0046872
GO:0051537
AF-A0A522GE46-F1-model_v4 (2Fe-2S)-binding protein 0.9837 8 173 GO:0016491
GO:0046872
GO:0051537
AF-A0A562QQ08-F1-model_v4 2-furoyl-CoA dehydrogenase 2Fe-2S iron sulfur subunit 0.9828 12 165 GO:0016491
GO:0046872
GO:0051537
AF-A0A7K2AXP4-F1-model_v4 (2Fe-2S)-binding protein 0.9808 12 163 GO:0016491
GO:0046872
GO:0051537
AF-A0A1G3CPD3-F1-model_v4 (2Fe-2S)-binding protein 0.9806 12 173 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
87.31 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map