F471297

General Info

Members Datasets Scaffolds Average Seq Length
635 279 633 348

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2734482258|2735817798
Length 342
Sequence LILGVNGFIGHHLSQRILETTDWDVYGMDMSTDRIEDLIDHPRMHFTEGDITINKEWVEYYIRKCDVILPLVAIATPATYVKQPLRVFELDFEANLPIVRSAVKYHKHLVFPSTSEVYGKCEDSEFDPESSSLVYGPINKPRWIYAASKQLMDRVIWGYGMEGLNFTLFRPFNWIGPGLDSINTPKEGSSRVVTQFLGHIVRGENISLVDGGAQKRAFTDIDDGIDALMRIIENPNGIASGKIYNIGNPMNNFSVRELAQQMLTLATQFPEYATQAEKVTLLDTPSSEYYGSGYQDMQNRVPKITNTMAELNWKPTTSMEQALRKIFIAYCGHAAEVLALSE

Samples

Sample ID Description Type Environment
1 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
2 2738543013 Variovorax sp. BT01 Isolate Unclassified
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
205 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
215 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
266 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
267 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.16
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0
Rhizoplane 4.88
Rhizosphere 89.76
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10000560 3300001991 Bacteria 4445
2 JGI24751J29686_10025038 3300002459 Bacteria 1239
3 Ga0065712_10133776 3300005290 Bacteria 1519
4 Ga0065715_10022933 3300005293 Bacteria 1815
5 Ga0065715_10154565 3300005293 Bacteria 1691
6 Ga0070676_10146558 3300005328 Bacteria 1507
7 Ga0070683_100186972 3300005329 Bacteria 1966
8 Ga0070690_100010995 3300005330 Bacteria 5284
9 Ga0070690_100038017 3300005330 Bacteria 3035
10 Ga0070670_100008816 3300005331 Bacteria 8608
11 Ga0070670_100016066 3300005331 Bacteria 6424
12 Ga0070670_100030956 3300005331 Bacteria 4609
13 Ga0070670_100058387 3300005331 Bacteria 3313
14 Ga0070670_100140402 3300005331 Bacteria 2089
15 Ga0070670_100236970 3300005331 Bacteria 1588
16 Ga0070677_10000965 3300005333 Bacteria 9288
17 Ga0068869_100000388 3300005334 Bacteria 23946
18 Ga0068869_100004739 3300005334 Bacteria 8485
19 Ga0068869_100061340 3300005334 Bacteria 2758
20 Ga0068869_100092268 3300005334 Bacteria 2279
21 Ga0068869_100123357 3300005334 Bacteria 1984
22 Ga0070666_10008909 3300005335 Bacteria 6241
23 Ga0070666_10011788 3300005335 Bacteria 5496
24 Ga0070666_10015504 3300005335 Bacteria 4862
25 Ga0070680_100028406 3300005336 Bacteria 4486
26 Ga0070680_100049514 3300005336 Bacteria 3426
27 Ga0070682_100013039 3300005337 Bacteria 4772
28 Ga0068868_100008218 3300005338 Bacteria 7467
29 Ga0068868_100092945 3300005338 Bacteria 2432
30 Ga0068868_100203539 3300005338 Bacteria 1651
31 Ga0070660_100000724 3300005339 Bacteria 21893
32 Ga0070660_100046204 3300005339 Bacteria 3337
33 Ga0070660_100091271 3300005339 Bacteria 2402
34 Ga0070689_100005389 3300005340 Bacteria 8727
35 Ga0070689_100011549 3300005340 Bacteria 6328
36 Ga0070661_100005679 3300005344 Bacteria 8593
37 Ga0070661_100044673 3300005344 Bacteria 3237
38 Ga0070661_100051904 3300005344 Bacteria 3002
39 Ga0070661_100179882 3300005344 Bacteria 1608
40 Ga0070692_10033452 3300005345 Bacteria 2590
41 Ga0070668_100080818 3300005347 Bacteria 2547
42 Ga0070668_100095387 3300005347 Bacteria 2350
43 Ga0070669_100007605 3300005353 Bacteria 7747
44 Ga0070669_100034047 3300005353 Bacteria 3688
45 Ga0070675_100017223 3300005354 Bacteria 5740
46 Ga0070675_100019261 3300005354 Bacteria 5436
47 Ga0070671_100002250 3300005355 Bacteria 14903
48 Ga0070671_100011370 3300005355 Bacteria 7156
49 Ga0070671_100021571 3300005355 Bacteria 5261
50 Ga0070671_100095960 3300005355 Bacteria 2486
51 Ga0070674_100010956 3300005356 Bacteria 5499
52 Ga0070674_100017868 3300005356 Bacteria 4470
53 Ga0070674_100045323 3300005356 Bacteria 3004
54 Ga0070673_100001204 3300005364 Bacteria 14918
55 Ga0070673_100002674 3300005364 Bacteria 10908
56 Ga0070673_100007406 3300005364 Bacteria 7235
57 Ga0070673_100020203 3300005364 Bacteria 4800
58 Ga0070673_100028019 3300005364 Bacteria 4184
59 Ga0070673_100155620 3300005364 Bacteria 1940
60 Ga0070673_100184859 3300005364 Bacteria 1786
61 Ga0070688_100002928 3300005365 Bacteria 8705
62 Ga0070688_100038475 3300005365 Bacteria 2921
63 Ga0070659_100051079 3300005366 Bacteria 3250
64 Ga0070667_100000550 3300005367 Bacteria 37298
65 Ga0070667_100006019 3300005367 Bacteria 10080
66 Ga0070667_100030235 3300005367 Bacteria 4517
67 Ga0070667_100040058 3300005367 Bacteria 3929
68 Ga0070667_100048324 3300005367 Bacteria 3581
69 Ga0070667_100079338 3300005367 Bacteria 2806
70 Ga0070667_100166943 3300005367 Bacteria 1941
71 Ga0070714_100042391 3300005435 Bacteria 3845
72 Ga0070714_100079380 3300005435 Bacteria 2853
73 Ga0070714_100088262 3300005435 Bacteria 2713
74 Ga0070713_100003475 3300005436 Bacteria 10398
75 Ga0070710_10020640 3300005437 Bacteria 3421
76 Ga0070701_10031766 3300005438 Bacteria 2622
77 Ga0070711_100011287 3300005439 Bacteria 5542
78 Ga0070711_100025712 3300005439 Bacteria 3854
79 Ga0070711_100126750 3300005439 Bacteria 1896
80 Ga0070705_100009362 3300005440 Bacteria 4868
81 Ga0070700_100005867 3300005441 Bacteria 6523
82 Ga0070700_100100159 3300005441 Bacteria 1907
83 Ga0070694_100037288 3300005444 Bacteria 3224
84 Ga0070663_100004359 3300005455 Bacteria 8301
85 Ga0070663_100027453 3300005455 Bacteria 3866
86 Ga0070663_100074319 3300005455 Bacteria 2482
87 Ga0070663_100302106 3300005455 Bacteria 1281
88 Ga0070678_100015662 3300005456 Bacteria 4827
89 Ga0070678_100042143 3300005456 Bacteria 3242
90 Ga0070662_100001938 3300005457 Bacteria 12719
91 Ga0070681_10090964 3300005458 Bacteria 3002
92 Ga0070681_10264312 3300005458 Bacteria 1632
93 Ga0068867_100061910 3300005459 Bacteria 2779
94 Ga0068867_100071110 3300005459 Bacteria 2602
95 Ga0068867_100108535 3300005459 Bacteria 2129
96 Ga0068867_100312759 3300005459 Bacteria 1298
97 Ga0070685_10006996 3300005466 Bacteria 5756
98 Ga0070706_100014759 3300005467 Bacteria 7217
99 Ga0070707_100310577 3300005468 Bacteria 1532
100 Ga0070698_100195516 3300005471 Bacteria 1959
101 Ga0070699_100027023 3300005518 Bacteria 4949
102 Ga0070699_100065339 3300005518 Bacteria 3157
103 Ga0070679_100020307 3300005530 Bacteria 6473
104 Ga0070679_100055556 3300005530 Bacteria 3942
105 Ga0070679_100159735 3300005530 Bacteria 2228
106 Ga0070679_100173662 3300005530 Bacteria 2128
107 Ga0070679_100207679 3300005530 Bacteria 1923
108 Ga0070684_100023537 3300005535 Bacteria 5154
109 Ga0070684_100077446 3300005535 Bacteria 2937
110 Ga0068853_100011739 3300005539 Bacteria 7119
111 Ga0068853_100162791 3300005539 Bacteria 2014
112 Ga0070672_100003013 3300005543 Bacteria 10851
113 Ga0070672_100004327 3300005543 Bacteria 9294
114 Ga0070672_100039857 3300005543 Bacteria 3601
115 Ga0070672_100080428 3300005543 Bacteria 2611
116 Ga0070686_100303611 3300005544 Bacteria 1185
117 Ga0070695_100066089 3300005545 Bacteria 2356
118 Ga0070695_100080938 3300005545 Bacteria 2148
119 Ga0070696_100033332 3300005546 Bacteria 3538
120 Ga0070696_100140652 3300005546 Bacteria 1764
121 Ga0070693_100000167 3300005547 Bacteria 30641
122 Ga0070665_100005172 3300005548 Bacteria 13499
123 Ga0070665_100361180 3300005548 Bacteria 1458
124 Ga0070704_100045665 3300005549 Bacteria 3049
125 Ga0070704_100102194 3300005549 Bacteria 2162
126 Ga0070704_100130031 3300005549 Bacteria 1950
127 Ga0068855_100001160 3300005563 Bacteria 32655
128 Ga0068855_100040381 3300005563 Bacteria 5539
129 Ga0068855_100118510 3300005563 Bacteria 3032
130 Ga0068855_100129707 3300005563 Bacteria 2880
131 Ga0070664_100000955 3300005564 Bacteria 22600
132 Ga0070664_100006174 3300005564 Bacteria 9684
133 Ga0070664_100031002 3300005564 Bacteria 4464
134 Ga0070664_100039768 3300005564 Bacteria 3964
135 Ga0070664_100039893 3300005564 Bacteria 3958
136 Ga0070664_100103815 3300005564 Bacteria 2475
137 Ga0068857_100001623 3300005577 Bacteria 18065
138 Ga0068857_100044533 3300005577 Bacteria 3936
139 Ga0068854_100002132 3300005578 Bacteria 12146
140 Ga0068854_100047083 3300005578 Bacteria 3072
141 Ga0068854_100067228 3300005578 Bacteria 2611
142 Ga0068856_100001343 3300005614 Bacteria 25881
143 Ga0068856_100001396 3300005614 Bacteria 25298
144 Ga0068856_100009881 3300005614 Bacteria 9266
145 Ga0070702_100137189 3300005615 Bacteria 1553
146 Ga0068852_100011854 3300005616 Bacteria 6589
147 Ga0068852_100064651 3300005616 Bacteria 3190
148 Ga0068852_100164288 3300005616 Bacteria 2076
149 Ga0068852_100300513 3300005616 Bacteria 1553
150 Ga0068859_100001484 3300005617 Bacteria 23877
151 Ga0068859_100009886 3300005617 Bacteria 9634
152 Ga0068859_100021747 3300005617 Bacteria 6433
153 Ga0068859_100202970 3300005617 Bacteria 2067
154 Ga0068864_100000938 3300005618 Bacteria 24407
155 Ga0068864_100002372 3300005618 Bacteria 15584
156 Ga0068864_100009418 3300005618 Bacteria 8058
157 Ga0068864_100034190 3300005618 Bacteria 4322
158 Ga0068864_100057543 3300005618 Bacteria 3359
159 Ga0068864_100066222 3300005618 Bacteria 3135
160 Ga0068864_100245393 3300005618 Bacteria 1660
161 Ga0068866_10004687 3300005718 Bacteria 5612
162 Ga0068861_100000187 3300005719 Bacteria 33035
163 Ga0068861_100056293 3300005719 Bacteria 3001
164 Ga0068851_10000301 3300005834 Bacteria 22575
165 Ga0068851_10001932 3300005834 Bacteria 9105
166 Ga0068851_10006560 3300005834 Bacteria 5319
167 Ga0068851_10058913 3300005834 Bacteria 1964
168 Ga0068870_10008825 3300005840 Bacteria 4549
169 Ga0068870_10043989 3300005840 Bacteria 2331
170 Ga0068870_10044754 3300005840 Bacteria 2314
171 Ga0068863_100001021 3300005841 Bacteria 28037
172 Ga0068863_100006037 3300005841 Bacteria 11882
173 Ga0068863_100010703 3300005841 Bacteria 8909
174 Ga0068863_100034540 3300005841 Bacteria 4816
175 Ga0068863_100052190 3300005841 Bacteria 3876
176 Ga0068863_100057685 3300005841 Bacteria 3674
177 Ga0068863_100105364 3300005841 Bacteria 2682
178 Ga0068858_100008319 3300005842 Bacteria 9979
179 Ga0068858_100018888 3300005842 Bacteria 6450
180 Ga0068858_100028369 3300005842 Bacteria 5201
181 Ga0068858_100082962 3300005842 Bacteria 2980
182 Ga0068858_100093112 3300005842 Bacteria 2805
183 Ga0068860_100011724 3300005843 Bacteria 8639
184 Ga0068860_100015024 3300005843 Bacteria 7566
185 Ga0068860_100038316 3300005843 Bacteria 4585
186 Ga0068860_100053521 3300005843 Bacteria 3838
187 Ga0068860_100111924 3300005843 Bacteria 2610
188 Ga0068860_100211272 3300005843 Bacteria 1882
189 Ga0068862_100005987 3300005844 Bacteria 10125
190 Ga0068862_100032015 3300005844 Bacteria 4442
191 Ga0081455_10099650 3300005937 Bacteria 2336
192 Ga0075365_10001639 3300006038 Bacteria 10321
193 Ga0075365_10085718 3300006038 Bacteria 2140
194 Ga0075368_10002914 3300006042 Bacteria 5654
195 Ga0075368_10015544 3300006042 Bacteria 2826
196 Ga0075363_100000471 3300006048 Bacteria 12659
197 Ga0075363_100014716 3300006048 Bacteria 3831
198 Ga0070716_100050706 3300006173 Bacteria 2357
199 Ga0070712_100041403 3300006175 Bacteria 3163
200 Ga0070712_100114798 3300006175 Bacteria 2017
201 Ga0070712_100374529 3300006175 Bacteria 1170
202 Ga0075362_10072296 3300006177 Bacteria 1577
203 Ga0075367_10008151 3300006178 Bacteria 5412
204 Ga0075369_10000016 3300006186 Bacteria 52351
205 Ga0075369_10004576 3300006186 Bacteria 5128
206 Ga0075369_10087758 3300006186 Bacteria 1385
207 Ga0075366_10022972 3300006195 Bacteria 3632
208 Ga0075366_10056058 3300006195 Bacteria 2340
209 Ga0075366_10068686 3300006195 Bacteria 2108
210 Ga0097621_100009045 3300006237 Bacteria 7215
211 Ga0097621_100022190 3300006237 Bacteria 4925
212 Ga0097621_100059498 3300006237 Bacteria 3128
213 Ga0097621_100282452 3300006237 Bacteria 1461
214 Ga0075370_10000902 3300006353 Bacteria 12172
215 Ga0075370_10004770 3300006353 Bacteria 6634
216 Ga0068871_100004641 3300006358 Bacteria 9598
217 Ga0068871_100038217 3300006358 Bacteria 3832
218 Ga0068871_100042837 3300006358 Bacteria 3636
219 Ga0068871_100048109 3300006358 Bacteria 3441
220 Ga0075428_100033734 3300006844 Bacteria 5648
221 Ga0075434_100176274 3300006871 Bacteria 2158
222 Ga0075434_100412958 3300006871 Bacteria 1371
223 Ga0075429_100016270 3300006880 Bacteria 6446
224 Ga0068865_100003642 3300006881 Bacteria 9258
225 Ga0068865_100010571 3300006881 Bacteria 5750
226 Ga0068865_100025208 3300006881 Bacteria 3908
227 Ga0097620_100001484 3300006931 Bacteria 23877
228 Ga0097620_100009886 3300006931 Bacteria 9634
229 Ga0097620_100021748 3300006931 Bacteria 6433
230 Ga0097620_100202978 3300006931 Bacteria 2067
231 Ga0105240_10130883 3300009093 Bacteria 3010
232 Ga0105240_10229732 3300009093 Bacteria 2157
233 Ga0111539_10013246 3300009094 Bacteria 10308
234 Ga0105245_10008101 3300009098 Bacteria 9193
235 Ga0105245_10012549 3300009098 Bacteria 7374
236 Ga0105245_10038293 3300009098 Bacteria 4267
237 Ga0105247_10012360 3300009101 Bacteria 5127
238 Ga0105247_10050405 3300009101 Bacteria 2562
239 Ga0114129_10134553 3300009147 Bacteria 3392
240 Ga0114129_10521429 3300009147 Bacteria 1549
241 Ga0105243_10038645 3300009148 Bacteria 3717
242 Ga0105243_10342041 3300009148 Bacteria 1371
243 Ga0105241_10064713 3300009174 Bacteria 2824
244 Ga0105241_10229549 3300009174 Bacteria 1564
245 Ga0105242_10004238 3300009176 Bacteria 11181
246 Ga0105242_10107031 3300009176 Bacteria 2378
247 Ga0105248_10010030 3300009177 Bacteria 10430
248 Ga0105248_10019096 3300009177 Bacteria 7581
249 Ga0105248_10031986 3300009177 Bacteria 5878
250 Ga0105248_10039953 3300009177 Bacteria 5259
251 Ga0105248_10104876 3300009177 Bacteria 3187
252 Ga0105248_10187291 3300009177 Bacteria 2332
253 Ga0105237_10132236 3300009545 Bacteria 2489
254 Ga0105238_10262791 3300009551 Bacteria 1706
255 Ga0105239_10105346 3300010375 Bacteria 3123
256 Ga0105246_10120338 3300011119 Bacteria 1944
257 Ga0105246_10137324 3300011119 Bacteria 1834
258 Ga0105246_10153983 3300011119 Bacteria 1743
259 Ga0157373_10000447 3300013100 Bacteria 32642
260 Ga0157373_10107452 3300013100 Bacteria 1962
261 Ga0157371_10001482 3300013102 Bacteria 24271
262 Ga0157370_10003331 3300013104 Bacteria 18930
263 Ga0157370_10022125 3300013104 Bacteria 6328
264 Ga0157370_10026443 3300013104 Bacteria 5730
265 Ga0157370_10037106 3300013104 Bacteria 4726
266 Ga0157370_10091638 3300013104 Bacteria 2853
267 Ga0157370_10141901 3300013104 Bacteria 2238
268 Ga0157369_10046834 3300013105 Bacteria 4698
269 Ga0157374_10000170 3300013296 Bacteria 60286
270 Ga0157374_10021298 3300013296 Bacteria 5766
271 Ga0157374_10146710 3300013296 Bacteria 2292
272 Ga0157374_10190292 3300013296 Bacteria 2007
273 Ga0157378_10003627 3300013297 Bacteria 13661
274 Ga0157378_10008577 3300013297 Bacteria 8897
275 Ga0157378_10023714 3300013297 Bacteria 5398
276 Ga0157378_10060219 3300013297 Bacteria 3388
277 Ga0163162_10011501 3300013306 Bacteria 8631
278 Ga0163162_10048032 3300013306 Bacteria 4276
279 Ga0163162_10113072 3300013306 Bacteria 2813
280 Ga0163162_10198673 3300013306 Bacteria 2134
281 Ga0157372_10004508 3300013307 Bacteria 14858
282 Ga0157372_10337826 3300013307 Bacteria 1754
283 Ga0157375_10002885 3300013308 Bacteria 14912
284 Ga0157375_10009095 3300013308 Bacteria 8701
285 Ga0157375_10225266 3300013308 Bacteria 2034
286 Ga0157375_10361254 3300013308 Bacteria 1618
287 Ga0163163_10006684 3300014325 Bacteria 10104
288 Ga0163163_10009220 3300014325 Bacteria 8798
289 Ga0163163_10029291 3300014325 Bacteria 5296
290 Ga0163163_10154655 3300014325 Bacteria 2337
291 Ga0163163_10185397 3300014325 Bacteria 2129
292 Ga0157379_10002047 3300014968 Bacteria 16745
293 Ga0157379_10004185 3300014968 Bacteria 12322
294 Ga0157379_10029917 3300014968 Bacteria 4844
295 Ga0157379_10062732 3300014968 Bacteria 3323
296 Ga0157376_10174678 3300014969 Bacteria 1959
297 Ga0163161_10040274 3300017792 Bacteria 3356
298 Ga0163161_10047214 3300017792 Bacteria 3110
299 Ga0207697_10000594 3300025315 Bacteria 20589
300 Ga0207697_10068683 3300025315 Bacteria 1483
301 Ga0207682_10000556 3300025893 Bacteria 17211
302 Ga0207692_10016570 3300025898 Bacteria 3268
303 Ga0207692_10139326 3300025898 Bacteria 1378
304 Ga0207642_10002368 3300025899 Bacteria 5867
305 Ga0207642_10058191 3300025899 Bacteria 1782
306 Ga0207710_10021920 3300025900 Bacteria 2740
307 Ga0207710_10085980 3300025900 Bacteria 1465
308 Ga0207688_10003876 3300025901 Bacteria 8159
309 Ga0207688_10170265 3300025901 Bacteria 1295
310 Ga0207680_10006648 3300025903 Bacteria 5610
311 Ga0207680_10075481 3300025903 Bacteria 2103
312 Ga0207699_10038666 3300025906 Bacteria 2736
313 Ga0207699_10045973 3300025906 Bacteria 2550
314 Ga0207645_10003500 3300025907 Bacteria 11889
315 Ga0207645_10004486 3300025907 Bacteria 10330
316 Ga0207645_10024033 3300025907 Bacteria 3955
317 Ga0207645_10185079 3300025907 Bacteria 1367
318 Ga0207643_10000610 3300025908 Bacteria 22591
319 Ga0207643_10019765 3300025908 Bacteria 3692
320 Ga0207643_10035144 3300025908 Bacteria 2809
321 Ga0207643_10061540 3300025908 Bacteria 2144
322 Ga0207684_10120923 3300025910 Bacteria 2245
323 Ga0207707_10082322 3300025912 Bacteria 2810
324 Ga0207707_10370517 3300025912 Bacteria 1232
325 Ga0207671_10074580 3300025914 Bacteria 2536
326 Ga0207693_10002176 3300025915 Bacteria 17081
327 Ga0207693_10012772 3300025915 Bacteria 6777
328 Ga0207693_10015681 3300025915 Bacteria 6074
329 Ga0207693_10345568 3300025915 Bacteria 1164
330 Ga0207663_10058199 3300025916 Bacteria 2438
331 Ga0207663_10088103 3300025916 Bacteria 2052
332 Ga0207660_10183717 3300025917 Bacteria 1625
333 Ga0207662_10014389 3300025918 Bacteria 4439
334 Ga0207662_10045539 3300025918 Bacteria 2593
335 Ga0207657_10000371 3300025919 Bacteria 47425
336 Ga0207657_10012827 3300025919 Bacteria 8248
337 Ga0207657_10021571 3300025919 Bacteria 6057
338 Ga0207657_10046523 3300025919 Bacteria 3799
339 Ga0207657_10237633 3300025919 Bacteria 1456
340 Ga0207649_10027946 3300025920 Bacteria 3317
341 Ga0207652_10014079 3300025921 Bacteria 6475
342 Ga0207652_10019068 3300025921 Bacteria 5635
343 Ga0207652_10236799 3300025921 Bacteria 1645
344 Ga0207646_10429260 3300025922 Bacteria 1192
345 Ga0207681_10007075 3300025923 Bacteria 6881
346 Ga0207681_10059152 3300025923 Bacteria 2626
347 Ga0207694_10101301 3300025924 Bacteria 2282
348 Ga0207650_10005168 3300025925 Bacteria 8905
349 Ga0207650_10030680 3300025925 Bacteria 3875
350 Ga0207650_10099096 3300025925 Bacteria 2240
351 Ga0207650_10123134 3300025925 Bacteria 2021
352 Ga0207650_10247559 3300025925 Bacteria 1442
353 Ga0207659_10100131 3300025926 Bacteria 2183
354 Ga0207659_10148802 3300025926 Bacteria 1826
355 Ga0207687_10001668 3300025927 Bacteria 15313
356 Ga0207687_10022739 3300025927 Bacteria 4175
357 Ga0207700_10009580 3300025928 Bacteria 6063
358 Ga0207700_10049833 3300025928 Bacteria 3117
359 Ga0207664_10001654 3300025929 Bacteria 14676
360 Ga0207664_10041934 3300025929 Bacteria 3569
361 Ga0207664_10071655 3300025929 Bacteria 2792
362 Ga0207644_10014130 3300025931 Bacteria 5341
363 Ga0207644_10018123 3300025931 Bacteria 4760
364 Ga0207644_10018467 3300025931 Bacteria 4718
365 Ga0207644_10074707 3300025931 Bacteria 2488
366 Ga0207690_10004056 3300025932 Bacteria 8653
367 Ga0207690_10048997 3300025932 Bacteria 2813
368 Ga0207706_10003193 3300025933 Bacteria 15731
369 Ga0207706_10014297 3300025933 Bacteria 7195
370 Ga0207706_10027259 3300025933 Bacteria 5110
371 Ga0207686_10000198 3300025934 Bacteria 46402
372 Ga0207709_10064075 3300025935 Bacteria 2306
373 Ga0207670_10069615 3300025936 Bacteria 2428
374 Ga0207670_10134608 3300025936 Bacteria 1815
375 Ga0207669_10009461 3300025937 Bacteria 4643
376 Ga0207669_10013482 3300025937 Bacteria 4061
377 Ga0207669_10025058 3300025937 Bacteria 3216
378 Ga0207704_10028451 3300025938 Bacteria 3101
379 Ga0207704_10036295 3300025938 Bacteria 2835
380 Ga0207665_10014015 3300025939 Bacteria 5274
381 Ga0207665_10043053 3300025939 Bacteria 3018
382 Ga0207691_10000006 3300025940 Bacteria 161922
383 Ga0207691_10003579 3300025940 Bacteria 15124
384 Ga0207691_10004159 3300025940 Bacteria 14058
385 Ga0207691_10004308 3300025940 Bacteria 13821
386 Ga0207691_10009490 3300025940 Bacteria 9343
387 Ga0207691_10013381 3300025940 Bacteria 7856
388 Ga0207691_10043503 3300025940 Bacteria 4139
389 Ga0207691_10073185 3300025940 Bacteria 3090
390 Ga0207691_10116874 3300025940 Bacteria 2367
391 Ga0207711_10003428 3300025941 Bacteria 13714
392 Ga0207711_10004968 3300025941 Bacteria 11289
393 Ga0207711_10095093 3300025941 Bacteria 2627
394 Ga0207689_10000042 3300025942 Bacteria 93077
395 Ga0207689_10004105 3300025942 Bacteria 13242
396 Ga0207689_10005585 3300025942 Bacteria 11211
397 Ga0207689_10008507 3300025942 Bacteria 8946
398 Ga0207689_10040648 3300025942 Bacteria 3848
399 Ga0207661_10036439 3300025944 Bacteria 3840
400 Ga0207679_10001683 3300025945 Bacteria 13764
401 Ga0207679_10012878 3300025945 Bacteria 5470
402 Ga0207679_10022820 3300025945 Bacteria 4267
403 Ga0207679_10032598 3300025945 Bacteria 3660
404 Ga0207679_10086697 3300025945 Bacteria 2409
405 Ga0207679_10154821 3300025945 Bacteria 1870
406 Ga0207667_10003619 3300025949 Bacteria 19070
407 Ga0207667_10044359 3300025949 Bacteria 4712
408 Ga0207667_10068970 3300025949 Bacteria 3680
409 Ga0207667_10178312 3300025949 Bacteria 2182
410 Ga0207651_10001393 3300025960 Bacteria 10955
411 Ga0207651_10028614 3300025960 Bacteria 3518
412 Ga0207651_10068222 3300025960 Bacteria 2506
413 Ga0207651_10122548 3300025960 Bacteria 1974
414 Ga0207668_10009587 3300025972 Bacteria 5812
415 Ga0207668_10037112 3300025972 Bacteria 3259
416 Ga0207668_10124429 3300025972 Bacteria 1958
417 Ga0207640_10020279 3300025981 Bacteria 3945
418 Ga0207640_10062757 3300025981 Bacteria 2466
419 Ga0207640_10148844 3300025981 Bacteria 1717
420 Ga0207640_10294478 3300025981 Bacteria 1281
421 Ga0207658_10006384 3300025986 Bacteria 8050
422 Ga0207658_10010407 3300025986 Bacteria 6318
423 Ga0207658_10051451 3300025986 Bacteria 3036
424 Ga0207658_10073152 3300025986 Bacteria 2601
425 Ga0207658_10093581 3300025986 Bacteria 2337
426 Ga0207658_10171676 3300025986 Bacteria 1787
427 Ga0207658_10232392 3300025986 Bacteria 1557
428 Ga0207658_10361530 3300025986 Bacteria 1266
429 Ga0207677_10000799 3300026023 Bacteria 18068
430 Ga0207677_10269557 3300026023 Bacteria 1392
431 Ga0207703_10000143 3300026035 Bacteria 84508
432 Ga0207703_10009453 3300026035 Bacteria 7655
433 Ga0207703_10042736 3300026035 Bacteria 3636
434 Ga0207703_10049361 3300026035 Bacteria 3402
435 Ga0207703_10066887 3300026035 Bacteria 2957
436 Ga0207703_10109175 3300026035 Bacteria 2357
437 Ga0207639_10024584 3300026041 Bacteria 4362
438 Ga0207639_10131012 3300026041 Bacteria 2076
439 Ga0207639_10227959 3300026041 Bacteria 1613
440 Ga0207678_10009805 3300026067 Bacteria 8421
441 Ga0207678_10022877 3300026067 Bacteria 5471
442 Ga0207678_10034156 3300026067 Bacteria 4430
443 Ga0207678_10117246 3300026067 Bacteria 2272
444 Ga0207678_10202717 3300026067 Bacteria 1696
445 Ga0207702_10003083 3300026078 Bacteria 15461
446 Ga0207702_10021898 3300026078 Bacteria 5294
447 Ga0207641_10007742 3300026088 Bacteria 8928
448 Ga0207641_10009450 3300026088 Bacteria 8034
449 Ga0207641_10023159 3300026088 Bacteria 5117
450 Ga0207641_10025174 3300026088 Bacteria 4907
451 Ga0207641_10092470 3300026088 Bacteria 2649
452 Ga0207648_10002730 3300026089 Bacteria 18749
453 Ga0207648_10010928 3300026089 Bacteria 8579
454 Ga0207648_10050141 3300026089 Bacteria 3650
455 Ga0207648_10065770 3300026089 Bacteria 3161
456 Ga0207648_10130003 3300026089 Bacteria 2216
457 Ga0207648_10250674 3300026089 Bacteria 1578
458 Ga0207676_10000837 3300026095 Bacteria 23871
459 Ga0207676_10003209 3300026095 Bacteria 11650
460 Ga0207676_10004178 3300026095 Bacteria 10207
461 Ga0207676_10007434 3300026095 Bacteria 7769
462 Ga0207676_10121414 3300026095 Bacteria 2204
463 Ga0207676_10125971 3300026095 Bacteria 2169
464 Ga0207676_10348973 3300026095 Bacteria 1368
465 Ga0207676_10415460 3300026095 Bacteria 1260
466 Ga0207674_10003466 3300026116 Bacteria 19294
467 Ga0207674_10022069 3300026116 Bacteria 6844
468 Ga0207674_10049033 3300026116 Bacteria 4320
469 Ga0207675_100000517 3300026118 Bacteria 37526
470 Ga0207675_100007054 3300026118 Bacteria 10616
471 Ga0207675_100017152 3300026118 Bacteria 6762
472 Ga0207675_100029559 3300026118 Bacteria 5105
473 Ga0207683_10002753 3300026121 Bacteria 15353
474 Ga0207683_10020492 3300026121 Bacteria 5655
475 Ga0207683_10022316 3300026121 Bacteria 5432
476 Ga0207683_10240338 3300026121 Bacteria 1652
477 Ga0207683_10350272 3300026121 Bacteria 1355
478 Ga0207698_10128374 3300026142 Bacteria 2161
479 Ga0207698_10178858 3300026142 Bacteria 1877
480 Ga0207698_10440975 3300026142 Bacteria 1254
481 Ga0209971_1003509 3300027682 Bacteria 3711
482 Ga0209971_1005384 3300027682 Bacteria 3043
483 Ga0209998_10002641 3300027717 Bacteria 4056
484 Ga0209813_10001896 3300027866 Bacteria 4714
485 Ga0209974_10033915 3300027876 Bacteria 1695
486 Ga0268266_10002385 3300028379 Bacteria 20297
487 Ga0268266_10140837 3300028379 Bacteria 2164
488 Ga0268265_10019444 3300028380 Bacteria 4721
489 Ga0268264_10000641 3300028381 Bacteria 41364
490 Ga0268264_10025067 3300028381 Bacteria 4874
491 Ga0268264_10032340 3300028381 Bacteria 4292
492 Ga0268264_10083699 3300028381 Bacteria 2733
493 Ga0268264_10434735 3300028381 Bacteria 1268
494 Ga0265334_10000010 3300028573 Bacteria 188179
495 Ga0265338_10028579 3300028800 Bacteria 5556
496 Ga0307511_10006365 3300030521 Bacteria 11902
497 Ga0265332_10001333 3300031238 Bacteria 14001
498 Ga0265325_10000877 3300031241 Bacteria 21725
499 Ga0265331_10000310 3300031250 Bacteria 53265
500 Ga0265327_10000572 3300031251 Bacteria 62611
501 Ga0265327_10001730 3300031251 Bacteria 25883
502 Ga0265327_10002920 3300031251 Bacteria 17116
503 Ga0307509_10000033 3300031507 Bacteria 194363
504 Ga0307408_100004310 3300031548 Bacteria 9653
505 Ga0307408_100141027 3300031548 Bacteria 1892
506 Ga0265313_10000068 3300031595 Bacteria 100563
507 Ga0265313_10006502 3300031595 Bacteria 8260
508 Ga0265314_10003412 3300031711 Bacteria 15382
509 Ga0265342_10072046 3300031712 Bacteria 2012
510 Ga0307405_10001513 3300031731 Bacteria 9845
511 Ga0307410_10008880 3300031852 Bacteria 5606
512 Ga0307406_10025843 3300031901 Bacteria 3519
513 Ga0307407_10010883 3300031903 Bacteria 4309
514 Ga0307412_10025410 3300031911 Bacteria 3669
515 Ga0307409_100012433 3300031995 Bacteria 5424
516 Ga0307411_10000280 3300032005 Bacteria 16974
517 Ga0307411_10207499 3300032005 Bacteria 1510
518 Ga0316583_10000196 3300032133 Bacteria 15776
519 Ga0316593_10002321 3300032168 Bacteria 4472
520 Ga0373953_0005869 3300035117 Bacteria 4012
521 Ga0373954_0055406 3300035118 Bacteria 1865
522 Ga0373956_0018705 3300035119 Bacteria 2935
523 Ga0373956_0027005 3300035119 Bacteria 2489
524 Ga0373957_0022658 3300035120 Bacteria 2239
525 Ga0373955_0039541 3300035172 Bacteria 2518
526 Ga0373955_0120592 3300035172 Bacteria 1524
527 Ga0373935_0054736 3300035692 Bacteria 2542
528 Ga0373927_0000002 3300035695 Bacteria 966219
529 Ga0373927_0009964 3300035695 Bacteria 6368
530 Ga0373927_0071122 3300035695 Bacteria 2252
531 Ga0373927_0158677 3300035695 Bacteria 1482
532 Ga0373937_0025706 3300036401 Bacteria 5317
533 Ga0373937_0034356 3300036401 Bacteria 4612
534 Ga0316582_0050906 3300036647 Bacteria 2626
535 Ga0316584_0019586 3300036712 Bacteria 4893
536 Ga0373925_0037859 3300037068 Bacteria 3562
537 Ga0436361_0989378 3300039447 Bacteria 2213
538 Ga0451577_0000002 3300042876 Bacteria 1731375
539 Ga0451577_0000384 3300042876 Bacteria 82022
540 Ga0451577_0010249 3300042876 Bacteria 8975
541 Ga0466972_0000070 3300044658 Bacteria 100242
542 Ga0453683_0000003 3300044673 Bacteria 942572
543 Ga0453684_0000002 3300044712 Bacteria 1731375
544 Ga0453684_0000005 3300044712 Bacteria 1431632
545 Ga0453684_0000292 3300044712 Bacteria 213050
546 Ga0453684_0000511 3300044712 Bacteria 150804
547 Ga0453684_0001222 3300044712 Bacteria 78832
548 Ga0453684_0003022 3300044712 Bacteria 39115
549 Ga0451576_0000034 3300045051 Bacteria 390778
550 Ga0451576_0000266 3300045051 Bacteria 127813
551 Ga0451576_0000533 3300045051 Bacteria 82000
552 Ga0451576_0050342 3300045051 Bacteria 4368
553 Ga0495629_0008490 3300046459 Bacteria 7563
554 Ga0495580_0025942 3300046472 Bacteria 4277
555 Ga0495639_0010739 3300046475 Bacteria 3940
556 Ga0495630_0055951 3300046517 Bacteria 2956
557 Ga0495642_0052845 3300046528 Bacteria 1674
558 Ga0495640_0016426 3300046533 Bacteria 5536
559 Ga0495645_0027599 3300046543 Bacteria 4125
560 Ga0495645_0120892 3300046543 Bacteria 1844
561 Ga0495667_0048450 3300046559 Bacteria 2806
562 Ga0495656_0000664 3300046615 Bacteria 10991
563 Ga0495635_0035566 3300046663 Bacteria 3453
564 Ga0495659_0039370 3300046664 Bacteria 1681
565 Ga0495588_0092966 3300046674 Bacteria 1581
566 Ga0495599_0037574 3300046678 Bacteria 3042
567 Ga0495658_0156323 3300046683 Bacteria 1403
568 Ga0495613_0007994 3300046689 Bacteria 7866
569 Ga0495600_0012682 3300046809 Bacteria 5276
570 Ga0495581_0001341 3300047315 Bacteria 13603
571 Ga0495593_0026218 3300047673 Bacteria 3220
572 Ga0495602_0134349 3300048088 Bacteria 1968
573 Ga0496100_0171382 3300048903 Bacteria 1563
574 Ga0496101_0062927 3300048904 Bacteria 2699
575 Ga0496101_0191640 3300048904 Bacteria 1578
576 Ga0496102_0004733 3300048905 Bacteria 11528
577 Ga0496102_0049371 3300048905 Bacteria 3828
578 Ga0496102_0061780 3300048905 Bacteria 3430
579 Ga0496102_0093460 3300048905 Bacteria 2786
580 Ga0496103_0157305 3300048906 Bacteria 1457
581 Ga0496103_0214268 3300048906 Bacteria 1238
582 Ga0496104_0008261 3300048907 Bacteria 9243
583 Ga0496104_0076399 3300048907 Bacteria 3190
584 Ga0496105_0043192 3300048908 Bacteria 3717
585 Ga0496106_0000409 3300048909 Bacteria 30485
586 Ga0496106_0022995 3300048909 Bacteria 4630
587 Ga0496106_0262728 3300048909 Bacteria 1381
588 Ga0496107_0040266 3300048910 Bacteria 3354
589 Ga0496107_0123366 3300048910 Bacteria 1909
590 Ga0496108_0004995 3300048911 Bacteria 10716
591 Ga0496108_0011989 3300048911 Bacteria 7053
592 Ga0496108_0063178 3300048911 Bacteria 3118
593 Ga0496109_0086713 3300048912 Bacteria 2891
594 Ga0496109_0133532 3300048912 Bacteria 2318
595 Ga0496109_0340921 3300048912 Bacteria 1415
596 Ga0496110_0004341 3300048913 Bacteria 10976
597 Ga0496110_0021483 3300048913 Bacteria 5466
598 Ga0496111_0051530 3300048914 Bacteria 2971
599 Ga0496112_0002525 3300048915 Bacteria 14775
600 Ga0496112_0017345 3300048915 Bacteria 6763
601 Ga0496112_0108435 3300048915 Bacteria 2747
602 Ga0496113_0109534 3300048916 Bacteria 2148
603 Ga0496114_0028019 3300048917 Bacteria 4619
604 Ga0495678_004540 3300049459 Bacteria 7994
605 Ga0501034_0127116 3300049571 Bacteria 2534
606 Ga0501047_0113584 3300049581 Bacteria 2591
607 Ga0501070_0006738 3300049586 Bacteria 9783
608 Ga0501072_0059746 3300049588 Bacteria 3006
609 Ga0501073_0009180 3300049589 Bacteria 7295
610 Ga0501083_0230722 3300049744 Bacteria 1205
611 nmdc:mga00v17_13237_c1 3300050491 Bacteria 4573
612 nmdc:mga0k408_108603_c1 3300050493 Bacteria 1639
613 nmdc:mga0k408_52447_c1 3300050493 Bacteria 2364
614 nmdc:mga0k408_70923_c1 3300050493 Bacteria 2033
615 nmdc:mga06z11_22316_c1 3300050494 Bacteria 2955
616 nmdc:mga04h51_2776_c1 3300050495 Bacteria 4178
617 nmdc:mga07m45_115_c1 3300050496 Bacteria 32090
618 nmdc:mga07m45_21330_c1 3300050496 Bacteria 3526
619 nmdc:mga05p37_332983_c1 3300050507 Bacteria 1792
620 nmdc:mga05p37_80753_c1 3300050507 Bacteria 4005
621 nmdc:mga09592_246778_c1 3300050508 Bacteria 1547
622 nmdc:mga09592_7835_c1 3300050508 Bacteria 8682
623 nmdc:mga08y16_206864_c1 3300050511 Bacteria 2033
624 nmdc:mga0n895_131243_c1 3300050512 Bacteria 2530
625 nmdc:mga0n895_212344_c1 3300050512 Bacteria 1965
626 nmdc:mga0rr50_219760_c1 3300050513 Bacteria 1568
627 nmdc:mga0rr50_41538_c1 3300050513 Bacteria 3352
628 nmdc:mga0sz30_22_c3 3300050516 Bacteria 64467
629 Ga0495595_0093117 3300053084 Bacteria 1448
630 Ga0500646_0002660 3300053090 Bacteria 4624
631 Ga0500636_0000406 3300053177 Bacteria 23697
632 Ga0500637_0002477 3300053178 Bacteria 8220
633 Ga0500625_020075 3300053729 Bacteria 3143

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0050906 Ga0316582_0050906_686_1675 326
2 3300036712 Ga0316584_0019586 Ga0316584_0019586_1354_2343 326
3 3300005530 Ga0070679_100055556 Ga0070679_1000555564 331
4 3300013104 Ga0157370_10022125 Ga0157370_100221256 331
5 3300025921 Ga0207652_10019068 Ga0207652_100190685 331
6 3300026116 Ga0207674_10022069 Ga0207674_100220695 331
7 3300026088 Ga0207641_10025174 Ga0207641_100251746 334
8 3300009551 Ga0105238_10262791 Ga0105238_102627912 335
9 3300006038 Ga0075365_10001639 Ga0075365_100016394 338
10 3300006042 Ga0075368_10015544 Ga0075368_100155442 338
11 3300006048 Ga0075363_100014716 Ga0075363_1000147163 338
12 3300006186 Ga0075369_10000016 Ga0075369_1000001626 338
13 3300006353 Ga0075370_10000902 Ga0075370_100009028 338
14 3300006880 Ga0075429_100016270 Ga0075429_1000162702 338
15 3300050491 nmdc:mga00v17_13237_c1 nmdc:mga00v17_13237_c1_926_1945 338
16 3300050496 nmdc:mga07m45_115_c1 nmdc:mga07m45_115_c1_23625_24644 338
17 3300050508 nmdc:mga09592_7835_c1 nmdc:mga09592_7835_c1_4616_5635 338
18 3300050516 nmdc:mga0sz30_22_c3 nmdc:mga0sz30_22_c3_23185_24204 338
19 iso_pu_bacteria 2734482258 2735817798 342
20 iso_pu_bacteria 2738543013 2739249446 343
21 3300005618 Ga0068864_100245393 Ga0068864_1002453932 346
22 3300005841 Ga0068863_100057685 Ga0068863_1000576852 346
23 3300006358 Ga0068871_100004641 Ga0068871_1000046417 346
24 3300009177 Ga0105248_10039953 Ga0105248_100399535 346
25 3300014325 Ga0163163_10185397 Ga0163163_101853972 346
26 3300014969 Ga0157376_10174678 Ga0157376_101746782 346
27 3300017792 Ga0163161_10040274 Ga0163161_100402742 346
28 3300025940 Ga0207691_10004308 Ga0207691_1000430813 346
29 3300026088 Ga0207641_10092470 Ga0207641_100924702 346
30 3300026121 Ga0207683_10350272 Ga0207683_103502722 346
31 3300045051 Ga0451576_0000533 Ga0451576_0000533_71714_72781 346
32 3300048912 Ga0496109_0340921 Ga0496109_0340921_209_1252 346
33 3300048915 Ga0496112_0002525 Ga0496112_0002525_4561_5604 346
34 3300049459 Ga0495678_004540 Ga0495678_004540_4103_5143 346
35 3300001991 JGI24743J22301_10000560 JGI24743J22301_100005602 347
36 3300002459 JGI24751J29686_10025038 JGI24751J29686_100250381 347
37 3300005290 Ga0065712_10133776 Ga0065712_101337761 347
38 3300005293 Ga0065715_10022933 Ga0065715_100229332 347
39 3300005293 Ga0065715_10154565 Ga0065715_101545651 347
40 3300005328 Ga0070676_10146558 Ga0070676_101465582 347
41 3300005329 Ga0070683_100186972 Ga0070683_1001869721 347
42 3300005330 Ga0070690_100010995 Ga0070690_1000109953 347
43 3300005330 Ga0070690_100038017 Ga0070690_1000380172 347
44 3300005331 Ga0070670_100008816 Ga0070670_1000088167 347
45 3300005331 Ga0070670_100016066 Ga0070670_1000160662 347
46 3300005331 Ga0070670_100030956 Ga0070670_1000309562 347
47 3300005331 Ga0070670_100058387 Ga0070670_1000583874 347
48 3300005331 Ga0070670_100140402 Ga0070670_1001404022 347
49 3300005331 Ga0070670_100236970 Ga0070670_1002369701 347
50 3300005333 Ga0070677_10000965 Ga0070677_100009657 347
51 3300005334 Ga0068869_100000388 Ga0068869_10000038822 347
52 3300005334 Ga0068869_100004739 Ga0068869_1000047392 347
53 3300005334 Ga0068869_100061340 Ga0068869_1000613402 347
54 3300005334 Ga0068869_100092268 Ga0068869_1000922682 347
55 3300005334 Ga0068869_100123357 Ga0068869_1001233572 347
56 3300005335 Ga0070666_10008909 Ga0070666_100089096 347
57 3300005335 Ga0070666_10011788 Ga0070666_100117882 347
58 3300005335 Ga0070666_10015504 Ga0070666_100155044 347
59 3300005336 Ga0070680_100028406 Ga0070680_1000284063 347
60 3300005336 Ga0070680_100049514 Ga0070680_1000495141 347
61 3300005337 Ga0070682_100013039 Ga0070682_1000130393 347
62 3300005338 Ga0068868_100008218 Ga0068868_1000082182 347
63 3300005338 Ga0068868_100092945 Ga0068868_1000929452 347
64 3300005338 Ga0068868_100203539 Ga0068868_1002035392 347
65 3300005339 Ga0070660_100000724 Ga0070660_1000007244 347
66 3300005339 Ga0070660_100046204 Ga0070660_1000462042 347
67 3300005339 Ga0070660_100091271 Ga0070660_1000912713 347
68 3300005340 Ga0070689_100005389 Ga0070689_1000053894 347
69 3300005340 Ga0070689_100011549 Ga0070689_1000115496 347
70 3300005344 Ga0070661_100005679 Ga0070661_1000056794 347
71 3300005344 Ga0070661_100044673 Ga0070661_1000446733 347
72 3300005344 Ga0070661_100051904 Ga0070661_1000519043 347
73 3300005344 Ga0070661_100179882 Ga0070661_1001798822 347
74 3300005345 Ga0070692_10033452 Ga0070692_100334523 347
75 3300005347 Ga0070668_100080818 Ga0070668_1000808182 347
76 3300005347 Ga0070668_100095387 Ga0070668_1000953872 347
77 3300005353 Ga0070669_100007605 Ga0070669_1000076052 347
78 3300005353 Ga0070669_100034047 Ga0070669_1000340473 347
79 3300005354 Ga0070675_100017223 Ga0070675_1000172231 347
80 3300005354 Ga0070675_100019261 Ga0070675_1000192615 347
81 3300005355 Ga0070671_100002250 Ga0070671_1000022504 347
82 3300005355 Ga0070671_100011370 Ga0070671_1000113707 347
83 3300005355 Ga0070671_100021571 Ga0070671_1000215714 347
84 3300005355 Ga0070671_100095960 Ga0070671_1000959602 347
85 3300005356 Ga0070674_100010956 Ga0070674_1000109562 347
86 3300005356 Ga0070674_100017868 Ga0070674_1000178684 347
87 3300005356 Ga0070674_100045323 Ga0070674_1000453233 347
88 3300005364 Ga0070673_100001204 Ga0070673_10000120411 347
89 3300005364 Ga0070673_100002674 Ga0070673_1000026748 347
90 3300005364 Ga0070673_100007406 Ga0070673_1000074067 347
91 3300005364 Ga0070673_100020203 Ga0070673_1000202034 347
92 3300005364 Ga0070673_100028019 Ga0070673_1000280194 347
93 3300005364 Ga0070673_100155620 Ga0070673_1001556202 347
94 3300005364 Ga0070673_100184859 Ga0070673_1001848591 347
95 3300005365 Ga0070688_100002928 Ga0070688_1000029284 347
96 3300005365 Ga0070688_100038475 Ga0070688_1000384751 347
97 3300005366 Ga0070659_100051079 Ga0070659_1000510792 347
98 3300005367 Ga0070667_100000550 Ga0070667_1000005506 347
99 3300005367 Ga0070667_100006019 Ga0070667_1000060197 347
100 3300005367 Ga0070667_100030235 Ga0070667_1000302353 347
101 3300005367 Ga0070667_100040058 Ga0070667_1000400585 347
102 3300005367 Ga0070667_100048324 Ga0070667_1000483244 347
103 3300005367 Ga0070667_100079338 Ga0070667_1000793382 347
104 3300005367 Ga0070667_100166943 Ga0070667_1001669432 347
105 3300005435 Ga0070714_100042391 Ga0070714_1000423913 347
106 3300005435 Ga0070714_100079380 Ga0070714_1000793802 347
107 3300005435 Ga0070714_100088262 Ga0070714_1000882623 347
108 3300005436 Ga0070713_100003475 Ga0070713_1000034752 347
109 3300005437 Ga0070710_10020640 Ga0070710_100206402 347
110 3300005438 Ga0070701_10031766 Ga0070701_100317661 347
111 3300005439 Ga0070711_100011287 Ga0070711_1000112875 347
112 3300005439 Ga0070711_100025712 Ga0070711_1000257125 347
113 3300005439 Ga0070711_100126750 Ga0070711_1001267502 347
114 3300005440 Ga0070705_100009362 Ga0070705_1000093624 347
115 3300005441 Ga0070700_100005867 Ga0070700_1000058674 347
116 3300005441 Ga0070700_100100159 Ga0070700_1001001591 347
117 3300005444 Ga0070694_100037288 Ga0070694_1000372882 347
118 3300005455 Ga0070663_100004359 Ga0070663_1000043593 347
119 3300005455 Ga0070663_100027453 Ga0070663_1000274534 347
120 3300005455 Ga0070663_100074319 Ga0070663_1000743192 347
121 3300005455 Ga0070663_100302106 Ga0070663_1003021062 347
122 3300005456 Ga0070678_100015662 Ga0070678_1000156624 347
123 3300005456 Ga0070678_100042143 Ga0070678_1000421434 347
124 3300005457 Ga0070662_100001938 Ga0070662_1000019384 347
125 3300005458 Ga0070681_10090964 Ga0070681_100909643 347
126 3300005458 Ga0070681_10264312 Ga0070681_102643122 347
127 3300005459 Ga0068867_100061910 Ga0068867_1000619102 347
128 3300005459 Ga0068867_100071110 Ga0068867_1000711102 347
129 3300005459 Ga0068867_100108535 Ga0068867_1001085352 347
130 3300005459 Ga0068867_100312759 Ga0068867_1003127591 347
131 3300005466 Ga0070685_10006996 Ga0070685_100069966 347
132 3300005467 Ga0070706_100014759 Ga0070706_1000147594 347
133 3300005468 Ga0070707_100310577 Ga0070707_1003105772 347
134 3300005471 Ga0070698_100195516 Ga0070698_1001955162 347
135 3300005518 Ga0070699_100027023 Ga0070699_1000270235 347
136 3300005518 Ga0070699_100065339 Ga0070699_1000653393 347
137 3300005530 Ga0070679_100020307 Ga0070679_1000203076 347
138 3300005530 Ga0070679_100159735 Ga0070679_1001597352 347
139 3300005530 Ga0070679_100173662 Ga0070679_1001736622 347
140 3300005530 Ga0070679_100207679 Ga0070679_1002076791 347
141 3300005535 Ga0070684_100023537 Ga0070684_1000235373 347
142 3300005535 Ga0070684_100077446 Ga0070684_1000774462 347
143 3300005539 Ga0068853_100011739 Ga0068853_1000117396 347
144 3300005539 Ga0068853_100162791 Ga0068853_1001627912 347
145 3300005543 Ga0070672_100003013 Ga0070672_1000030139 347
146 3300005543 Ga0070672_100004327 Ga0070672_1000043274 347
147 3300005543 Ga0070672_100039857 Ga0070672_1000398572 347
148 3300005543 Ga0070672_100080428 Ga0070672_1000804282 347
149 3300005544 Ga0070686_100303611 Ga0070686_1003036111 347
150 3300005545 Ga0070695_100066089 Ga0070695_1000660892 347
151 3300005545 Ga0070695_100080938 Ga0070695_1000809381 347
152 3300005546 Ga0070696_100033332 Ga0070696_1000333322 347
153 3300005546 Ga0070696_100140652 Ga0070696_1001406522 347
154 3300005547 Ga0070693_100000167 Ga0070693_1000001674 347
155 3300005548 Ga0070665_100005172 Ga0070665_1000051722 347
156 3300005548 Ga0070665_100361180 Ga0070665_1003611802 347
157 3300005549 Ga0070704_100045665 Ga0070704_1000456652 347
158 3300005549 Ga0070704_100102194 Ga0070704_1001021942 347
159 3300005549 Ga0070704_100130031 Ga0070704_1001300312 347
160 3300005563 Ga0068855_100001160 Ga0068855_10000116023 347
161 3300005563 Ga0068855_100040381 Ga0068855_1000403812 347
162 3300005563 Ga0068855_100118510 Ga0068855_1001185103 347
163 3300005563 Ga0068855_100129707 Ga0068855_1001297073 347
164 3300005564 Ga0070664_100000955 Ga0070664_10000095514 347
165 3300005564 Ga0070664_100006174 Ga0070664_1000061743 347
166 3300005564 Ga0070664_100031002 Ga0070664_1000310024 347
167 3300005564 Ga0070664_100039768 Ga0070664_1000397684 347
168 3300005564 Ga0070664_100039893 Ga0070664_1000398934 347
169 3300005564 Ga0070664_100103815 Ga0070664_1001038153 347
170 3300005577 Ga0068857_100001623 Ga0068857_10000162310 347
171 3300005577 Ga0068857_100044533 Ga0068857_1000445332 347
172 3300005578 Ga0068854_100002132 Ga0068854_1000021324 347
173 3300005578 Ga0068854_100047083 Ga0068854_1000470832 347
174 3300005578 Ga0068854_100067228 Ga0068854_1000672282 347
175 3300005614 Ga0068856_100001343 Ga0068856_10000134323 347
176 3300005614 Ga0068856_100001396 Ga0068856_10000139610 347
177 3300005614 Ga0068856_100009881 Ga0068856_1000098814 347
178 3300005615 Ga0070702_100137189 Ga0070702_1001371892 347
179 3300005616 Ga0068852_100011854 Ga0068852_1000118546 347
180 3300005616 Ga0068852_100064651 Ga0068852_1000646512 347
181 3300005616 Ga0068852_100164288 Ga0068852_1001642882 347
182 3300005616 Ga0068852_100300513 Ga0068852_1003005132 347
183 3300005617 Ga0068859_100001484 Ga0068859_10000148415 347
184 3300005617 Ga0068859_100009886 Ga0068859_1000098864 347
185 3300005617 Ga0068859_100021747 Ga0068859_1000217478 347
186 3300005617 Ga0068859_100202970 Ga0068859_1002029702 347
187 3300005618 Ga0068864_100000938 Ga0068864_1000009384 347
188 3300005618 Ga0068864_100002372 Ga0068864_1000023727 347
189 3300005618 Ga0068864_100009418 Ga0068864_1000094186 347
190 3300005618 Ga0068864_100034190 Ga0068864_1000341902 347
191 3300005618 Ga0068864_100057543 Ga0068864_1000575433 347
192 3300005618 Ga0068864_100066222 Ga0068864_1000662223 347
193 3300005718 Ga0068866_10004687 Ga0068866_100046872 347
194 3300005719 Ga0068861_100000187 Ga0068861_1000001875 347
195 3300005719 Ga0068861_100056293 Ga0068861_1000562932 347
196 3300005834 Ga0068851_10000301 Ga0068851_100003015 347
197 3300005834 Ga0068851_10001932 Ga0068851_100019323 347
198 3300005834 Ga0068851_10006560 Ga0068851_100065602 347
199 3300005834 Ga0068851_10058913 Ga0068851_100589132 347
200 3300005840 Ga0068870_10008825 Ga0068870_100088252 347
201 3300005840 Ga0068870_10043989 Ga0068870_100439892 347
202 3300005840 Ga0068870_10044754 Ga0068870_100447542 347
203 3300005841 Ga0068863_100001021 Ga0068863_10000102117 347
204 3300005841 Ga0068863_100006037 Ga0068863_1000060379 347
205 3300005841 Ga0068863_100010703 Ga0068863_1000107037 347
206 3300005841 Ga0068863_100034540 Ga0068863_1000345404 347
207 3300005841 Ga0068863_100052190 Ga0068863_1000521904 347
208 3300005841 Ga0068863_100105364 Ga0068863_1001053642 347
209 3300005842 Ga0068858_100008319 Ga0068858_1000083192 347
210 3300005842 Ga0068858_100018888 Ga0068858_1000188887 347
211 3300005842 Ga0068858_100028369 Ga0068858_1000283692 347
212 3300005842 Ga0068858_100082962 Ga0068858_1000829622 347
213 3300005842 Ga0068858_100093112 Ga0068858_1000931123 347
214 3300005843 Ga0068860_100011724 Ga0068860_1000117247 347
215 3300005843 Ga0068860_100015024 Ga0068860_1000150246 347
216 3300005843 Ga0068860_100038316 Ga0068860_1000383162 347
217 3300005843 Ga0068860_100053521 Ga0068860_1000535212 347
218 3300005843 Ga0068860_100111924 Ga0068860_1001119243 347
219 3300005843 Ga0068860_100211272 Ga0068860_1002112722 347
220 3300005844 Ga0068862_100005987 Ga0068862_1000059878 347
221 3300005844 Ga0068862_100032015 Ga0068862_1000320154 347
222 3300005937 Ga0081455_10099650 Ga0081455_100996503 347
223 3300006038 Ga0075365_10085718 Ga0075365_100857182 347
224 3300006042 Ga0075368_10002914 Ga0075368_100029144 347
225 3300006048 Ga0075363_100000471 Ga0075363_10000047111 347
226 3300006173 Ga0070716_100050706 Ga0070716_1000507062 347
227 3300006175 Ga0070712_100041403 Ga0070712_1000414032 347
228 3300006175 Ga0070712_100114798 Ga0070712_1001147982 347
229 3300006175 Ga0070712_100374529 Ga0070712_1003745292 347
230 3300006177 Ga0075362_10072296 Ga0075362_100722962 347
231 3300006178 Ga0075367_10008151 Ga0075367_100081513 347
232 3300006186 Ga0075369_10004576 Ga0075369_100045766 347
233 3300006186 Ga0075369_10087758 Ga0075369_100877582 347
234 3300006195 Ga0075366_10022972 Ga0075366_100229722 347
235 3300006195 Ga0075366_10056058 Ga0075366_100560582 347
236 3300006195 Ga0075366_10068686 Ga0075366_100686861 347
237 3300006237 Ga0097621_100009045 Ga0097621_1000090456 347
238 3300006237 Ga0097621_100022190 Ga0097621_1000221902 347
239 3300006237 Ga0097621_100059498 Ga0097621_1000594983 347
240 3300006237 Ga0097621_100282452 Ga0097621_1002824522 347
241 3300006353 Ga0075370_10004770 Ga0075370_100047706 347
242 3300006358 Ga0068871_100038217 Ga0068871_1000382173 347
243 3300006358 Ga0068871_100042837 Ga0068871_1000428372 347
244 3300006358 Ga0068871_100048109 Ga0068871_1000481093 347
245 3300006844 Ga0075428_100033734 Ga0075428_1000337344 347
246 3300006871 Ga0075434_100176274 Ga0075434_1001762742 347
247 3300006871 Ga0075434_100412958 Ga0075434_1004129582 347
248 3300006881 Ga0068865_100003642 Ga0068865_1000036426 347
249 3300006881 Ga0068865_100010571 Ga0068865_1000105714 347
250 3300006881 Ga0068865_100025208 Ga0068865_1000252082 347
251 3300006931 Ga0097620_100001484 Ga0097620_1000014849 347
252 3300006931 Ga0097620_100009886 Ga0097620_1000098864 347
253 3300006931 Ga0097620_100021748 Ga0097620_1000217488 347
254 3300006931 Ga0097620_100202978 Ga0097620_1002029782 347
255 3300009093 Ga0105240_10130883 Ga0105240_101308833 347
256 3300009093 Ga0105240_10229732 Ga0105240_102297322 347
257 3300009094 Ga0111539_10013246 Ga0111539_100132464 347
258 3300009098 Ga0105245_10008101 Ga0105245_100081018 347
259 3300009098 Ga0105245_10012549 Ga0105245_100125494 347
260 3300009098 Ga0105245_10038293 Ga0105245_100382934 347
261 3300009101 Ga0105247_10012360 Ga0105247_100123604 347
262 3300009101 Ga0105247_10050405 Ga0105247_100504053 347
263 3300009147 Ga0114129_10134553 Ga0114129_101345534 347
264 3300009147 Ga0114129_10521429 Ga0114129_105214292 347
265 3300009148 Ga0105243_10038645 Ga0105243_100386453 347
266 3300009148 Ga0105243_10342041 Ga0105243_103420412 347
267 3300009174 Ga0105241_10064713 Ga0105241_100647132 347
268 3300009174 Ga0105241_10229549 Ga0105241_102295492 347
269 3300009176 Ga0105242_10004238 Ga0105242_100042382 347
270 3300009176 Ga0105242_10107031 Ga0105242_101070311 347
271 3300009177 Ga0105248_10010030 Ga0105248_100100305 347
272 3300009177 Ga0105248_10019096 Ga0105248_100190963 347
273 3300009177 Ga0105248_10031986 Ga0105248_100319861 347
274 3300009177 Ga0105248_10104876 Ga0105248_101048763 347
275 3300009177 Ga0105248_10187291 Ga0105248_101872912 347
276 3300009545 Ga0105237_10132236 Ga0105237_101322363 347
277 3300010375 Ga0105239_10105346 Ga0105239_101053463 347
278 3300011119 Ga0105246_10120338 Ga0105246_101203382 347
279 3300011119 Ga0105246_10137324 Ga0105246_101373242 347
280 3300011119 Ga0105246_10153983 Ga0105246_101539832 347
281 3300013100 Ga0157373_10000447 Ga0157373_1000044716 347
282 3300013100 Ga0157373_10107452 Ga0157373_101074522 347
283 3300013102 Ga0157371_10001482 Ga0157371_1000148216 347
284 3300013104 Ga0157370_10003331 Ga0157370_1000333117 347
285 3300013104 Ga0157370_10026443 Ga0157370_100264433 347
286 3300013104 Ga0157370_10037106 Ga0157370_100371063 347
287 3300013104 Ga0157370_10091638 Ga0157370_100916382 347
288 3300013104 Ga0157370_10141901 Ga0157370_101419012 347
289 3300013105 Ga0157369_10046834 Ga0157369_100468343 347
290 3300013296 Ga0157374_10000170 Ga0157374_1000017020 347
291 3300013296 Ga0157374_10021298 Ga0157374_100212984 347
292 3300013296 Ga0157374_10146710 Ga0157374_101467103 347
293 3300013296 Ga0157374_10190292 Ga0157374_101902921 347
294 3300013297 Ga0157378_10003627 Ga0157378_1000362712 347
295 3300013297 Ga0157378_10008577 Ga0157378_100085775 347
296 3300013297 Ga0157378_10023714 Ga0157378_100237144 347
297 3300013297 Ga0157378_10060219 Ga0157378_100602193 347
298 3300013306 Ga0163162_10011501 Ga0163162_100115014 347
299 3300013306 Ga0163162_10048032 Ga0163162_100480322 347
300 3300013306 Ga0163162_10113072 Ga0163162_101130723 347
301 3300013306 Ga0163162_10198673 Ga0163162_101986732 347
302 3300013307 Ga0157372_10004508 Ga0157372_100045086 347
303 3300013307 Ga0157372_10337826 Ga0157372_103378262 347
304 3300013308 Ga0157375_10002885 Ga0157375_100028853 347
305 3300013308 Ga0157375_10009095 Ga0157375_100090953 347
306 3300013308 Ga0157375_10225266 Ga0157375_102252662 347
307 3300013308 Ga0157375_10361254 Ga0157375_103612542 347
308 3300014325 Ga0163163_10006684 Ga0163163_100066844 347
309 3300014325 Ga0163163_10009220 Ga0163163_100092206 347
310 3300014325 Ga0163163_10029291 Ga0163163_100292915 347
311 3300014325 Ga0163163_10154655 Ga0163163_101546551 347
312 3300014968 Ga0157379_10002047 Ga0157379_100020473 347
313 3300014968 Ga0157379_10004185 Ga0157379_100041859 347
314 3300014968 Ga0157379_10029917 Ga0157379_100299173 347
315 3300014968 Ga0157379_10062732 Ga0157379_100627323 347
316 3300017792 Ga0163161_10047214 Ga0163161_100472143 347
317 3300025315 Ga0207697_10000594 Ga0207697_1000059420 347
318 3300025315 Ga0207697_10068683 Ga0207697_100686832 347
319 3300025893 Ga0207682_10000556 Ga0207682_1000055618 347
320 3300025898 Ga0207692_10016570 Ga0207692_100165703 347
321 3300025898 Ga0207692_10139326 Ga0207692_101393262 347
322 3300025899 Ga0207642_10002368 Ga0207642_100023687 347
323 3300025899 Ga0207642_10058191 Ga0207642_100581912 347
324 3300025900 Ga0207710_10021920 Ga0207710_100219203 347
325 3300025900 Ga0207710_10085980 Ga0207710_100859802 347
326 3300025901 Ga0207688_10003876 Ga0207688_100038764 347
327 3300025901 Ga0207688_10170265 Ga0207688_101702652 347
328 3300025903 Ga0207680_10006648 Ga0207680_100066482 347
329 3300025903 Ga0207680_10075481 Ga0207680_100754812 347
330 3300025906 Ga0207699_10038666 Ga0207699_100386663 347
331 3300025906 Ga0207699_10045973 Ga0207699_100459733 347
332 3300025907 Ga0207645_10003500 Ga0207645_1000350011 347
333 3300025907 Ga0207645_10004486 Ga0207645_100044862 347
334 3300025907 Ga0207645_10024033 Ga0207645_100240334 347
335 3300025907 Ga0207645_10185079 Ga0207645_101850791 347
336 3300025908 Ga0207643_10000610 Ga0207643_100006109 347
337 3300025908 Ga0207643_10019765 Ga0207643_100197652 347
338 3300025908 Ga0207643_10035144 Ga0207643_100351443 347
339 3300025908 Ga0207643_10061540 Ga0207643_100615402 347
340 3300025910 Ga0207684_10120923 Ga0207684_101209232 347
341 3300025912 Ga0207707_10082322 Ga0207707_100823222 347
342 3300025912 Ga0207707_10370517 Ga0207707_103705172 347
343 3300025914 Ga0207671_10074580 Ga0207671_100745802 347
344 3300025915 Ga0207693_10002176 Ga0207693_100021765 347
345 3300025915 Ga0207693_10012772 Ga0207693_100127724 347
346 3300025915 Ga0207693_10015681 Ga0207693_100156814 347
347 3300025915 Ga0207693_10345568 Ga0207693_103455681 347
348 3300025916 Ga0207663_10058199 Ga0207663_100581993 347
349 3300025916 Ga0207663_10088103 Ga0207663_100881032 347
350 3300025917 Ga0207660_10183717 Ga0207660_101837172 347
351 3300025918 Ga0207662_10014389 Ga0207662_100143894 347
352 3300025918 Ga0207662_10045539 Ga0207662_100455392 347
353 3300025919 Ga0207657_10000371 Ga0207657_1000037141 347
354 3300025919 Ga0207657_10012827 Ga0207657_100128273 347
355 3300025919 Ga0207657_10021571 Ga0207657_100215713 347
356 3300025919 Ga0207657_10046523 Ga0207657_100465234 347
357 3300025919 Ga0207657_10237633 Ga0207657_102376332 347
358 3300025920 Ga0207649_10027946 Ga0207649_100279463 347
359 3300025921 Ga0207652_10014079 Ga0207652_100140792 347
360 3300025921 Ga0207652_10236799 Ga0207652_102367992 347
361 3300025922 Ga0207646_10429260 Ga0207646_104292602 347
362 3300025923 Ga0207681_10007075 Ga0207681_100070752 347
363 3300025923 Ga0207681_10059152 Ga0207681_100591521 347
364 3300025924 Ga0207694_10101301 Ga0207694_101013012 347
365 3300025925 Ga0207650_10005168 Ga0207650_100051687 347
366 3300025925 Ga0207650_10030680 Ga0207650_100306803 347
367 3300025925 Ga0207650_10099096 Ga0207650_100990962 347
368 3300025925 Ga0207650_10123134 Ga0207650_101231341 347
369 3300025925 Ga0207650_10247559 Ga0207650_102475591 347
370 3300025926 Ga0207659_10100131 Ga0207659_101001312 347
371 3300025926 Ga0207659_10148802 Ga0207659_101488021 347
372 3300025927 Ga0207687_10001668 Ga0207687_100016687 347
373 3300025927 Ga0207687_10022739 Ga0207687_100227393 347
374 3300025928 Ga0207700_10009580 Ga0207700_100095802 347
375 3300025928 Ga0207700_10049833 Ga0207700_100498332 347
376 3300025929 Ga0207664_10001654 Ga0207664_100016547 347
377 3300025929 Ga0207664_10041934 Ga0207664_100419342 347
378 3300025929 Ga0207664_10071655 Ga0207664_100716552 347
379 3300025931 Ga0207644_10014130 Ga0207644_100141304 347
380 3300025931 Ga0207644_10018123 Ga0207644_100181232 347
381 3300025931 Ga0207644_10018467 Ga0207644_100184673 347
382 3300025931 Ga0207644_10074707 Ga0207644_100747072 347
383 3300025932 Ga0207690_10004056 Ga0207690_100040566 347
384 3300025932 Ga0207690_10048997 Ga0207690_100489973 347
385 3300025933 Ga0207706_10003193 Ga0207706_1000319310 347
386 3300025933 Ga0207706_10014297 Ga0207706_100142973 347
387 3300025933 Ga0207706_10027259 Ga0207706_100272594 347
388 3300025934 Ga0207686_10000198 Ga0207686_100001989 347
389 3300025935 Ga0207709_10064075 Ga0207709_100640752 347
390 3300025936 Ga0207670_10069615 Ga0207670_100696152 347
391 3300025936 Ga0207670_10134608 Ga0207670_101346082 347
392 3300025937 Ga0207669_10009461 Ga0207669_100094613 347
393 3300025937 Ga0207669_10013482 Ga0207669_100134824 347
394 3300025937 Ga0207669_10025058 Ga0207669_100250583 347
395 3300025938 Ga0207704_10028451 Ga0207704_100284513 347
396 3300025938 Ga0207704_10036295 Ga0207704_100362954 347
397 3300025939 Ga0207665_10014015 Ga0207665_100140152 347
398 3300025939 Ga0207665_10043053 Ga0207665_100430532 347
399 3300025940 Ga0207691_10000006 Ga0207691_1000000617 347
400 3300025940 Ga0207691_10003579 Ga0207691_1000357912 347
401 3300025940 Ga0207691_10004159 Ga0207691_100041597 347
402 3300025940 Ga0207691_10009490 Ga0207691_100094906 347
403 3300025940 Ga0207691_10013381 Ga0207691_100133812 347
404 3300025940 Ga0207691_10043503 Ga0207691_100435033 347
405 3300025940 Ga0207691_10073185 Ga0207691_100731851 347
406 3300025940 Ga0207691_10116874 Ga0207691_101168742 347
407 3300025941 Ga0207711_10003428 Ga0207711_1000342811 347
408 3300025941 Ga0207711_10004968 Ga0207711_1000496810 347
409 3300025941 Ga0207711_10095093 Ga0207711_100950932 347
410 3300025942 Ga0207689_10000042 Ga0207689_1000004286 347
411 3300025942 Ga0207689_10004105 Ga0207689_1000410513 347
412 3300025942 Ga0207689_10005585 Ga0207689_1000558512 347
413 3300025942 Ga0207689_10008507 Ga0207689_100085074 347
414 3300025942 Ga0207689_10040648 Ga0207689_100406483 347
415 3300025944 Ga0207661_10036439 Ga0207661_100364392 347
416 3300025945 Ga0207679_10001683 Ga0207679_100016834 347
417 3300025945 Ga0207679_10012878 Ga0207679_100128784 347
418 3300025945 Ga0207679_10022820 Ga0207679_100228202 347
419 3300025945 Ga0207679_10032598 Ga0207679_100325984 347
420 3300025945 Ga0207679_10086697 Ga0207679_100866973 347
421 3300025945 Ga0207679_10154821 Ga0207679_101548212 347
422 3300025949 Ga0207667_10003619 Ga0207667_100036196 347
423 3300025949 Ga0207667_10044359 Ga0207667_100443595 347
424 3300025949 Ga0207667_10068970 Ga0207667_100689701 347
425 3300025949 Ga0207667_10178312 Ga0207667_101783122 347
426 3300025960 Ga0207651_10001393 Ga0207651_100013934 347
427 3300025960 Ga0207651_10028614 Ga0207651_100286142 347
428 3300025960 Ga0207651_10068222 Ga0207651_100682223 347
429 3300025960 Ga0207651_10122548 Ga0207651_101225483 347
430 3300025972 Ga0207668_10009587 Ga0207668_100095875 347
431 3300025972 Ga0207668_10037112 Ga0207668_100371123 347
432 3300025972 Ga0207668_10124429 Ga0207668_101244292 347
433 3300025981 Ga0207640_10020279 Ga0207640_100202792 347
434 3300025981 Ga0207640_10062757 Ga0207640_100627572 347
435 3300025981 Ga0207640_10148844 Ga0207640_101488442 347
436 3300025981 Ga0207640_10294478 Ga0207640_102944782 347
437 3300025986 Ga0207658_10006384 Ga0207658_100063847 347
438 3300025986 Ga0207658_10010407 Ga0207658_100104071 347
439 3300025986 Ga0207658_10051451 Ga0207658_100514512 347
440 3300025986 Ga0207658_10073152 Ga0207658_100731522 347
441 3300025986 Ga0207658_10093581 Ga0207658_100935812 347
442 3300025986 Ga0207658_10171676 Ga0207658_101716762 347
443 3300025986 Ga0207658_10232392 Ga0207658_102323922 347
444 3300025986 Ga0207658_10361530 Ga0207658_103615302 347
445 3300026023 Ga0207677_10000799 Ga0207677_100007997 347
446 3300026023 Ga0207677_10269557 Ga0207677_102695571 347
447 3300026035 Ga0207703_10000143 Ga0207703_100001437 347
448 3300026035 Ga0207703_10009453 Ga0207703_100094534 347
449 3300026035 Ga0207703_10042736 Ga0207703_100427362 347
450 3300026035 Ga0207703_10049361 Ga0207703_100493613 347
451 3300026035 Ga0207703_10066887 Ga0207703_100668872 347
452 3300026035 Ga0207703_10109175 Ga0207703_101091752 347
453 3300026041 Ga0207639_10024584 Ga0207639_100245844 347
454 3300026041 Ga0207639_10131012 Ga0207639_101310121 347
455 3300026041 Ga0207639_10227959 Ga0207639_102279592 347
456 3300026067 Ga0207678_10009805 Ga0207678_100098057 347
457 3300026067 Ga0207678_10022877 Ga0207678_100228772 347
458 3300026067 Ga0207678_10034156 Ga0207678_100341562 347
459 3300026067 Ga0207678_10117246 Ga0207678_101172462 347
460 3300026067 Ga0207678_10202717 Ga0207678_102027172 347
461 3300026078 Ga0207702_10003083 Ga0207702_100030838 347
462 3300026078 Ga0207702_10021898 Ga0207702_100218986 347
463 3300026088 Ga0207641_10007742 Ga0207641_100077428 347
464 3300026088 Ga0207641_10009450 Ga0207641_100094504 347
465 3300026088 Ga0207641_10023159 Ga0207641_100231593 347
466 3300026089 Ga0207648_10002730 Ga0207648_1000273016 347
467 3300026089 Ga0207648_10010928 Ga0207648_100109286 347
468 3300026089 Ga0207648_10050141 Ga0207648_100501415 347
469 3300026089 Ga0207648_10065770 Ga0207648_100657702 347
470 3300026089 Ga0207648_10130003 Ga0207648_101300032 347
471 3300026089 Ga0207648_10250674 Ga0207648_102506742 347
472 3300026095 Ga0207676_10000837 Ga0207676_1000083711 347
473 3300026095 Ga0207676_10003209 Ga0207676_100032098 347
474 3300026095 Ga0207676_10004178 Ga0207676_100041787 347
475 3300026095 Ga0207676_10007434 Ga0207676_100074347 347
476 3300026095 Ga0207676_10121414 Ga0207676_101214142 347
477 3300026095 Ga0207676_10125971 Ga0207676_101259712 347
478 3300026095 Ga0207676_10348973 Ga0207676_103489731 347
479 3300026095 Ga0207676_10415460 Ga0207676_104154601 347
480 3300026116 Ga0207674_10003466 Ga0207674_1000346610 347
481 3300026116 Ga0207674_10049033 Ga0207674_100490334 347
482 3300026118 Ga0207675_100000517 Ga0207675_10000051722 347
483 3300026118 Ga0207675_100007054 Ga0207675_1000070542 347
484 3300026118 Ga0207675_100017152 Ga0207675_1000171525 347
485 3300026118 Ga0207675_100029559 Ga0207675_1000295591 347
486 3300026121 Ga0207683_10002753 Ga0207683_100027536 347
487 3300026121 Ga0207683_10020492 Ga0207683_100204922 347
488 3300026121 Ga0207683_10022316 Ga0207683_100223162 347
489 3300026121 Ga0207683_10240338 Ga0207683_102403382 347
490 3300026142 Ga0207698_10128374 Ga0207698_101283742 347
491 3300026142 Ga0207698_10178858 Ga0207698_101788582 347
492 3300026142 Ga0207698_10440975 Ga0207698_104409751 347
493 3300027682 Ga0209971_1003509 Ga0209971_10035094 347
494 3300027682 Ga0209971_1005384 Ga0209971_10053844 347
495 3300027717 Ga0209998_10002641 Ga0209998_100026414 347
496 3300027866 Ga0209813_10001896 Ga0209813_100018965 347
497 3300027876 Ga0209974_10033915 Ga0209974_100339152 347
498 3300028379 Ga0268266_10002385 Ga0268266_100023855 347
499 3300028379 Ga0268266_10140837 Ga0268266_101408372 347
500 3300028380 Ga0268265_10019444 Ga0268265_100194444 347
501 3300028381 Ga0268264_10000641 Ga0268264_1000064118 347
502 3300028381 Ga0268264_10025067 Ga0268264_100250673 347
503 3300028381 Ga0268264_10032340 Ga0268264_100323404 347
504 3300028381 Ga0268264_10083699 Ga0268264_100836992 347
505 3300028381 Ga0268264_10434735 Ga0268264_104347351 347
506 3300028573 Ga0265334_10000010 Ga0265334_1000001050 347
507 3300028800 Ga0265338_10028579 Ga0265338_100285793 347
508 3300030521 Ga0307511_10006365 Ga0307511_100063653 347
509 3300031238 Ga0265332_10001333 Ga0265332_100013334 347
510 3300031241 Ga0265325_10000877 Ga0265325_100008779 347
511 3300031250 Ga0265331_10000310 Ga0265331_1000031032 347
512 3300031251 Ga0265327_10000572 Ga0265327_1000057220 347
513 3300031251 Ga0265327_10001730 Ga0265327_100017307 347
514 3300031251 Ga0265327_10002920 Ga0265327_100029206 347
515 3300031507 Ga0307509_10000033 Ga0307509_1000003344 347
516 3300031548 Ga0307408_100004310 Ga0307408_1000043104 347
517 3300031548 Ga0307408_100141027 Ga0307408_1001410272 347
518 3300031595 Ga0265313_10000068 Ga0265313_1000006831 347
519 3300031595 Ga0265313_10006502 Ga0265313_100065021 347
520 3300031711 Ga0265314_10003412 Ga0265314_100034125 347
521 3300031712 Ga0265342_10072046 Ga0265342_100720462 347
522 3300031731 Ga0307405_10001513 Ga0307405_100015131 347
523 3300031852 Ga0307410_10008880 Ga0307410_100088804 347
524 3300031901 Ga0307406_10025843 Ga0307406_100258434 347
525 3300031903 Ga0307407_10010883 Ga0307407_100108833 347
526 3300031911 Ga0307412_10025410 Ga0307412_100254104 347
527 3300031995 Ga0307409_100012433 Ga0307409_1000124334 347
528 3300032005 Ga0307411_10000280 Ga0307411_100002808 347
529 3300032005 Ga0307411_10207499 Ga0307411_102074991 347
530 3300032133 Ga0316583_10000196 Ga0316583_1000019611 347
531 3300032168 Ga0316593_10002321 Ga0316593_100023213 347
532 3300035117 Ga0373953_0005869 Ga0373953_0005869_320_1363 347
533 3300035118 Ga0373954_0055406 Ga0373954_0055406_522_1565 347
534 3300035119 Ga0373956_0018705 Ga0373956_0018705_649_1692 347
535 3300035119 Ga0373956_0027005 Ga0373956_0027005_13_1056 347
536 3300035120 Ga0373957_0022658 Ga0373957_0022658_1013_2056 347
537 3300035172 Ga0373955_0039541 Ga0373955_0039541_31_1074 347
538 3300035172 Ga0373955_0120592 Ga0373955_0120592_44_1087 347
539 3300035692 Ga0373935_0054736 Ga0373935_0054736_937_1983 347
540 3300035695 Ga0373927_0000002 Ga0373927_0000002_897853_898896 347
541 3300035695 Ga0373927_0009964 Ga0373927_0009964_3137_4180 347
542 3300035695 Ga0373927_0071122 Ga0373927_0071122_792_1835 347
543 3300035695 Ga0373927_0158677 Ga0373927_0158677_37_1080 347
544 3300036401 Ga0373937_0025706 Ga0373937_0025706_1732_2775 347
545 3300036401 Ga0373937_0034356 Ga0373937_0034356_326_1369 347
546 3300037068 Ga0373925_0037859 Ga0373925_0037859_1779_2822 347
547 3300039447 Ga0436361_0989378 Ga0436361_0989378_885_1940 347
548 3300042876 Ga0451577_0000002 Ga0451577_0000002_45363_46406 347
549 3300042876 Ga0451577_0000384 Ga0451577_0000384_51816_52859 347
550 3300042876 Ga0451577_0010249 Ga0451577_0010249_6509_7711 347
551 3300044658 Ga0466972_0000070 Ga0466972_0000070_80348_81403 347
552 3300044673 Ga0453683_0000003 Ga0453683_0000003_45363_46406 347
553 3300044712 Ga0453684_0000002 Ga0453684_0000002_1684970_1686013 347
554 3300044712 Ga0453684_0000005 Ga0453684_0000005_911050_912093 347
555 3300044712 Ga0453684_0000292 Ga0453684_0000292_186284_187327 347
556 3300044712 Ga0453684_0000511 Ga0453684_0000511_32745_33788 347
557 3300044712 Ga0453684_0001222 Ga0453684_0001222_20094_21137 347
558 3300044712 Ga0453684_0003022 Ga0453684_0003022_34115_35158 347
559 3300045051 Ga0451576_0000034 Ga0451576_0000034_65371_66414 347
560 3300045051 Ga0451576_0000266 Ga0451576_0000266_78230_79273 347
561 3300045051 Ga0451576_0050342 Ga0451576_0050342_2757_3959 347
562 3300046459 Ga0495629_0008490 Ga0495629_0008490_2451_3494 347
563 3300046472 Ga0495580_0025942 Ga0495580_0025942_1454_2497 347
564 3300046475 Ga0495639_0010739 Ga0495639_0010739_1251_2294 347
565 3300046517 Ga0495630_0055951 Ga0495630_0055951_1329_2372 347
566 3300046528 Ga0495642_0052845 Ga0495642_0052845_76_1119 347
567 3300046533 Ga0495640_0016426 Ga0495640_0016426_3190_4233 347
568 3300046543 Ga0495645_0027599 Ga0495645_0027599_208_1251 347
569 3300046543 Ga0495645_0120892 Ga0495645_0120892_82_1137 347
570 3300046559 Ga0495667_0048450 Ga0495667_0048450_623_1666 347
571 3300046615 Ga0495656_0000664 Ga0495656_0000664_8062_9105 347
572 3300046663 Ga0495635_0035566 Ga0495635_0035566_1809_2852 347
573 3300046664 Ga0495659_0039370 Ga0495659_0039370_625_1668 347
574 3300046674 Ga0495588_0092966 Ga0495588_0092966_407_1450 347
575 3300046678 Ga0495599_0037574 Ga0495599_0037574_14_1057 347
576 3300046683 Ga0495658_0156323 Ga0495658_0156323_249_1292 347
577 3300046689 Ga0495613_0007994 Ga0495613_0007994_742_1785 347
578 3300046809 Ga0495600_0012682 Ga0495600_0012682_2261_3304 347
579 3300047315 Ga0495581_0001341 Ga0495581_0001341_10147_11190 347
580 3300047673 Ga0495593_0026218 Ga0495593_0026218_700_1743 347
581 3300048088 Ga0495602_0134349 Ga0495602_0134349_138_1181 347
582 3300048903 Ga0496100_0171382 Ga0496100_0171382_195_1238 347
583 3300048904 Ga0496101_0062927 Ga0496101_0062927_318_1361 347
584 3300048904 Ga0496101_0191640 Ga0496101_0191640_78_1124 347
585 3300048905 Ga0496102_0004733 Ga0496102_0004733_3349_4392 347
586 3300048905 Ga0496102_0049371 Ga0496102_0049371_2768_3811 347
587 3300048905 Ga0496102_0061780 Ga0496102_0061780_1089_2132 347
588 3300048905 Ga0496102_0093460 Ga0496102_0093460_1526_2569 347
589 3300048906 Ga0496103_0157305 Ga0496103_0157305_115_1158 347
590 3300048906 Ga0496103_0214268 Ga0496103_0214268_97_1140 347
591 3300048907 Ga0496104_0008261 Ga0496104_0008261_5938_6981 347
592 3300048907 Ga0496104_0076399 Ga0496104_0076399_1798_2844 347
593 3300048908 Ga0496105_0043192 Ga0496105_0043192_2435_3478 347
594 3300048909 Ga0496106_0000409 Ga0496106_0000409_15520_16563 347
595 3300048909 Ga0496106_0022995 Ga0496106_0022995_1517_2560 347
596 3300048909 Ga0496106_0262728 Ga0496106_0262728_179_1222 347
597 3300048910 Ga0496107_0040266 Ga0496107_0040266_391_1434 347
598 3300048910 Ga0496107_0123366 Ga0496107_0123366_192_1238 347
599 3300048911 Ga0496108_0004995 Ga0496108_0004995_2522_3568 347
600 3300048911 Ga0496108_0011989 Ga0496108_0011989_682_1725 347
601 3300048911 Ga0496108_0063178 Ga0496108_0063178_1423_2466 347
602 3300048912 Ga0496109_0086713 Ga0496109_0086713_1738_2781 347
603 3300048912 Ga0496109_0133532 Ga0496109_0133532_214_1257 347
604 3300048913 Ga0496110_0004341 Ga0496110_0004341_4613_5659 347
605 3300048913 Ga0496110_0021483 Ga0496110_0021483_3273_4316 347
606 3300048914 Ga0496111_0051530 Ga0496111_0051530_636_1682 347
607 3300048915 Ga0496112_0017345 Ga0496112_0017345_2929_3972 347
608 3300048915 Ga0496112_0108435 Ga0496112_0108435_407_1453 347
609 3300048916 Ga0496113_0109534 Ga0496113_0109534_590_1633 347
610 3300048917 Ga0496114_0028019 Ga0496114_0028019_123_1166 347
611 3300049571 Ga0501034_0127116 Ga0501034_0127116_602_1645 347
612 3300049581 Ga0501047_0113584 Ga0501047_0113584_1490_2533 347
613 3300049586 Ga0501070_0006738 Ga0501070_0006738_2892_3935 347
614 3300049588 Ga0501072_0059746 Ga0501072_0059746_1191_2234 347
615 3300049589 Ga0501073_0009180 Ga0501073_0009180_3636_4679 347
616 3300049744 Ga0501083_0230722 Ga0501083_0230722_151_1194 347
617 3300050493 nmdc:mga0k408_108603_c1 nmdc:mga0k408_108603_c1_357_1400 347
618 3300050493 nmdc:mga0k408_52447_c1 nmdc:mga0k408_52447_c1_921_1964 347
619 3300050493 nmdc:mga0k408_70923_c1 nmdc:mga0k408_70923_c1_803_1846 347
620 3300050494 nmdc:mga06z11_22316_c1 nmdc:mga06z11_22316_c1_1883_2926 347
621 3300050495 nmdc:mga04h51_2776_c1 nmdc:mga04h51_2776_c1_3106_4149 347
622 3300050496 nmdc:mga07m45_21330_c1 nmdc:mga07m45_21330_c1_779_1822 347
623 3300050507 nmdc:mga05p37_332983_c1 nmdc:mga05p37_332983_c1_87_1130 347
624 3300050507 nmdc:mga05p37_80753_c1 nmdc:mga05p37_80753_c1_2625_3668 347
625 3300050508 nmdc:mga09592_246778_c1 nmdc:mga09592_246778_c1_381_1424 347
626 3300050511 nmdc:mga08y16_206864_c1 nmdc:mga08y16_206864_c1_614_1657 347
627 3300050512 nmdc:mga0n895_131243_c1 nmdc:mga0n895_131243_c1_79_1122 347
628 3300050512 nmdc:mga0n895_212344_c1 nmdc:mga0n895_212344_c1_249_1292 347
629 3300050513 nmdc:mga0rr50_219760_c1 nmdc:mga0rr50_219760_c1_207_1250 347
630 3300050513 nmdc:mga0rr50_41538_c1 nmdc:mga0rr50_41538_c1_606_1649 347
631 3300053084 Ga0495595_0093117 Ga0495595_0093117_350_1393 347
632 3300053090 Ga0500646_0002660 Ga0500646_0002660_732_1775 347
633 3300053177 Ga0500636_0000406 Ga0500636_0000406_18848_19891 347
634 3300053178 Ga0500637_0002477 Ga0500637_0002477_1531_2574 347
635 3300053729 Ga0500625_020075 Ga0500625_020075_2009_3052 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

1

247

0.94

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

1

326

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z7e-assembly1.cif.gz_C crystal structure of full length arna 0.9617 2 338
1z7e-assembly1.cif.gz_D crystal structure of full length arna 0.9616 2 338
4wkg-assembly1.cif.gz_D the crystal structure of apo arna features an unexpected central binding pocket and provides an explanation for enzymatic coop-erativity 0.9496 2 337
3slg-assembly2.cif.gz_F crystal structure of pbgp3 protein from burkholderia pseudomallei 0.9485 2 343
4wkg-assembly1.cif.gz_E the crystal structure of apo arna features an unexpected central binding pocket and provides an explanation for enzymatic coop-erativity 0.9474 2 338
ID Description Score Start End Superfamily
3slgE01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9514 2 320 3.40.50.720
3slgE01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9399 2 320 3.40.50.720
4wkgA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9178 2 335 3.40.50.720
af_I1LKW7_14_379_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9053 3 343 3.40.50.720
3slgE02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.8995 196 347 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A484YST3-F1-model_v4 Bifunctional polymyxin resistance protein ArnA (EC 2.1.2.9) 0.9776 2 175 GO:0004479
AF-J3NHI5-F1-model_v4 Bifunctional polymyxin resistance protein ArnA 0.9757 2 344 GO:0009245
GO:0016020
GO:0016491
GO:0046677
AF-K2DTL0-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9746 1 335
AF-D2Z579-F1-model_v4 NAD-dependent epimerase/dehydratase 0.9737 3 335
AF-A0A485AQD4-F1-model_v4 Polymyxin resistance protein PmrI 0.9703 24 155

Feature Viewer

pLDDT pTM Quality
87.71 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map