F471297
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 635 | 279 | 633 | 348 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2734482258|2735817798 |
| Length | 342 |
| Sequence | LILGVNGFIGHHLSQRILETTDWDVYGMDMSTDRIEDLIDHPRMHFTEGDITINKEWVEYYIRKCDVILPLVAIATPATYVKQPLRVFELDFEANLPIVRSAVKYHKHLVFPSTSEVYGKCEDSEFDPESSSLVYGPINKPRWIYAASKQLMDRVIWGYGMEGLNFTLFRPFNWIGPGLDSINTPKEGSSRVVTQFLGHIVRGENISLVDGGAQKRAFTDIDDGIDALMRIIENPNGIASGKIYNIGNPMNNFSVRELAQQMLTLATQFPEYATQAEKVTLLDTPSSEYYGSGYQDMQNRVPKITNTMAELNWKPTTSMEQALRKIFIAYCGHAAEVLALSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 2 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 205 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 215 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 266 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 267 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 268 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 269 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 275 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 277 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 279 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0.16 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.72 |
| Nodule | 0 |
| Rhizoplane | 4.88 |
| Rhizosphere | 89.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10000560 | 3300001991 | Bacteria | 4445 |
| 2 | JGI24751J29686_10025038 | 3300002459 | Bacteria | 1239 |
| 3 | Ga0065712_10133776 | 3300005290 | Bacteria | 1519 |
| 4 | Ga0065715_10022933 | 3300005293 | Bacteria | 1815 |
| 5 | Ga0065715_10154565 | 3300005293 | Bacteria | 1691 |
| 6 | Ga0070676_10146558 | 3300005328 | Bacteria | 1507 |
| 7 | Ga0070683_100186972 | 3300005329 | Bacteria | 1966 |
| 8 | Ga0070690_100010995 | 3300005330 | Bacteria | 5284 |
| 9 | Ga0070690_100038017 | 3300005330 | Bacteria | 3035 |
| 10 | Ga0070670_100008816 | 3300005331 | Bacteria | 8608 |
| 11 | Ga0070670_100016066 | 3300005331 | Bacteria | 6424 |
| 12 | Ga0070670_100030956 | 3300005331 | Bacteria | 4609 |
| 13 | Ga0070670_100058387 | 3300005331 | Bacteria | 3313 |
| 14 | Ga0070670_100140402 | 3300005331 | Bacteria | 2089 |
| 15 | Ga0070670_100236970 | 3300005331 | Bacteria | 1588 |
| 16 | Ga0070677_10000965 | 3300005333 | Bacteria | 9288 |
| 17 | Ga0068869_100000388 | 3300005334 | Bacteria | 23946 |
| 18 | Ga0068869_100004739 | 3300005334 | Bacteria | 8485 |
| 19 | Ga0068869_100061340 | 3300005334 | Bacteria | 2758 |
| 20 | Ga0068869_100092268 | 3300005334 | Bacteria | 2279 |
| 21 | Ga0068869_100123357 | 3300005334 | Bacteria | 1984 |
| 22 | Ga0070666_10008909 | 3300005335 | Bacteria | 6241 |
| 23 | Ga0070666_10011788 | 3300005335 | Bacteria | 5496 |
| 24 | Ga0070666_10015504 | 3300005335 | Bacteria | 4862 |
| 25 | Ga0070680_100028406 | 3300005336 | Bacteria | 4486 |
| 26 | Ga0070680_100049514 | 3300005336 | Bacteria | 3426 |
| 27 | Ga0070682_100013039 | 3300005337 | Bacteria | 4772 |
| 28 | Ga0068868_100008218 | 3300005338 | Bacteria | 7467 |
| 29 | Ga0068868_100092945 | 3300005338 | Bacteria | 2432 |
| 30 | Ga0068868_100203539 | 3300005338 | Bacteria | 1651 |
| 31 | Ga0070660_100000724 | 3300005339 | Bacteria | 21893 |
| 32 | Ga0070660_100046204 | 3300005339 | Bacteria | 3337 |
| 33 | Ga0070660_100091271 | 3300005339 | Bacteria | 2402 |
| 34 | Ga0070689_100005389 | 3300005340 | Bacteria | 8727 |
| 35 | Ga0070689_100011549 | 3300005340 | Bacteria | 6328 |
| 36 | Ga0070661_100005679 | 3300005344 | Bacteria | 8593 |
| 37 | Ga0070661_100044673 | 3300005344 | Bacteria | 3237 |
| 38 | Ga0070661_100051904 | 3300005344 | Bacteria | 3002 |
| 39 | Ga0070661_100179882 | 3300005344 | Bacteria | 1608 |
| 40 | Ga0070692_10033452 | 3300005345 | Bacteria | 2590 |
| 41 | Ga0070668_100080818 | 3300005347 | Bacteria | 2547 |
| 42 | Ga0070668_100095387 | 3300005347 | Bacteria | 2350 |
| 43 | Ga0070669_100007605 | 3300005353 | Bacteria | 7747 |
| 44 | Ga0070669_100034047 | 3300005353 | Bacteria | 3688 |
| 45 | Ga0070675_100017223 | 3300005354 | Bacteria | 5740 |
| 46 | Ga0070675_100019261 | 3300005354 | Bacteria | 5436 |
| 47 | Ga0070671_100002250 | 3300005355 | Bacteria | 14903 |
| 48 | Ga0070671_100011370 | 3300005355 | Bacteria | 7156 |
| 49 | Ga0070671_100021571 | 3300005355 | Bacteria | 5261 |
| 50 | Ga0070671_100095960 | 3300005355 | Bacteria | 2486 |
| 51 | Ga0070674_100010956 | 3300005356 | Bacteria | 5499 |
| 52 | Ga0070674_100017868 | 3300005356 | Bacteria | 4470 |
| 53 | Ga0070674_100045323 | 3300005356 | Bacteria | 3004 |
| 54 | Ga0070673_100001204 | 3300005364 | Bacteria | 14918 |
| 55 | Ga0070673_100002674 | 3300005364 | Bacteria | 10908 |
| 56 | Ga0070673_100007406 | 3300005364 | Bacteria | 7235 |
| 57 | Ga0070673_100020203 | 3300005364 | Bacteria | 4800 |
| 58 | Ga0070673_100028019 | 3300005364 | Bacteria | 4184 |
| 59 | Ga0070673_100155620 | 3300005364 | Bacteria | 1940 |
| 60 | Ga0070673_100184859 | 3300005364 | Bacteria | 1786 |
| 61 | Ga0070688_100002928 | 3300005365 | Bacteria | 8705 |
| 62 | Ga0070688_100038475 | 3300005365 | Bacteria | 2921 |
| 63 | Ga0070659_100051079 | 3300005366 | Bacteria | 3250 |
| 64 | Ga0070667_100000550 | 3300005367 | Bacteria | 37298 |
| 65 | Ga0070667_100006019 | 3300005367 | Bacteria | 10080 |
| 66 | Ga0070667_100030235 | 3300005367 | Bacteria | 4517 |
| 67 | Ga0070667_100040058 | 3300005367 | Bacteria | 3929 |
| 68 | Ga0070667_100048324 | 3300005367 | Bacteria | 3581 |
| 69 | Ga0070667_100079338 | 3300005367 | Bacteria | 2806 |
| 70 | Ga0070667_100166943 | 3300005367 | Bacteria | 1941 |
| 71 | Ga0070714_100042391 | 3300005435 | Bacteria | 3845 |
| 72 | Ga0070714_100079380 | 3300005435 | Bacteria | 2853 |
| 73 | Ga0070714_100088262 | 3300005435 | Bacteria | 2713 |
| 74 | Ga0070713_100003475 | 3300005436 | Bacteria | 10398 |
| 75 | Ga0070710_10020640 | 3300005437 | Bacteria | 3421 |
| 76 | Ga0070701_10031766 | 3300005438 | Bacteria | 2622 |
| 77 | Ga0070711_100011287 | 3300005439 | Bacteria | 5542 |
| 78 | Ga0070711_100025712 | 3300005439 | Bacteria | 3854 |
| 79 | Ga0070711_100126750 | 3300005439 | Bacteria | 1896 |
| 80 | Ga0070705_100009362 | 3300005440 | Bacteria | 4868 |
| 81 | Ga0070700_100005867 | 3300005441 | Bacteria | 6523 |
| 82 | Ga0070700_100100159 | 3300005441 | Bacteria | 1907 |
| 83 | Ga0070694_100037288 | 3300005444 | Bacteria | 3224 |
| 84 | Ga0070663_100004359 | 3300005455 | Bacteria | 8301 |
| 85 | Ga0070663_100027453 | 3300005455 | Bacteria | 3866 |
| 86 | Ga0070663_100074319 | 3300005455 | Bacteria | 2482 |
| 87 | Ga0070663_100302106 | 3300005455 | Bacteria | 1281 |
| 88 | Ga0070678_100015662 | 3300005456 | Bacteria | 4827 |
| 89 | Ga0070678_100042143 | 3300005456 | Bacteria | 3242 |
| 90 | Ga0070662_100001938 | 3300005457 | Bacteria | 12719 |
| 91 | Ga0070681_10090964 | 3300005458 | Bacteria | 3002 |
| 92 | Ga0070681_10264312 | 3300005458 | Bacteria | 1632 |
| 93 | Ga0068867_100061910 | 3300005459 | Bacteria | 2779 |
| 94 | Ga0068867_100071110 | 3300005459 | Bacteria | 2602 |
| 95 | Ga0068867_100108535 | 3300005459 | Bacteria | 2129 |
| 96 | Ga0068867_100312759 | 3300005459 | Bacteria | 1298 |
| 97 | Ga0070685_10006996 | 3300005466 | Bacteria | 5756 |
| 98 | Ga0070706_100014759 | 3300005467 | Bacteria | 7217 |
| 99 | Ga0070707_100310577 | 3300005468 | Bacteria | 1532 |
| 100 | Ga0070698_100195516 | 3300005471 | Bacteria | 1959 |
| 101 | Ga0070699_100027023 | 3300005518 | Bacteria | 4949 |
| 102 | Ga0070699_100065339 | 3300005518 | Bacteria | 3157 |
| 103 | Ga0070679_100020307 | 3300005530 | Bacteria | 6473 |
| 104 | Ga0070679_100055556 | 3300005530 | Bacteria | 3942 |
| 105 | Ga0070679_100159735 | 3300005530 | Bacteria | 2228 |
| 106 | Ga0070679_100173662 | 3300005530 | Bacteria | 2128 |
| 107 | Ga0070679_100207679 | 3300005530 | Bacteria | 1923 |
| 108 | Ga0070684_100023537 | 3300005535 | Bacteria | 5154 |
| 109 | Ga0070684_100077446 | 3300005535 | Bacteria | 2937 |
| 110 | Ga0068853_100011739 | 3300005539 | Bacteria | 7119 |
| 111 | Ga0068853_100162791 | 3300005539 | Bacteria | 2014 |
| 112 | Ga0070672_100003013 | 3300005543 | Bacteria | 10851 |
| 113 | Ga0070672_100004327 | 3300005543 | Bacteria | 9294 |
| 114 | Ga0070672_100039857 | 3300005543 | Bacteria | 3601 |
| 115 | Ga0070672_100080428 | 3300005543 | Bacteria | 2611 |
| 116 | Ga0070686_100303611 | 3300005544 | Bacteria | 1185 |
| 117 | Ga0070695_100066089 | 3300005545 | Bacteria | 2356 |
| 118 | Ga0070695_100080938 | 3300005545 | Bacteria | 2148 |
| 119 | Ga0070696_100033332 | 3300005546 | Bacteria | 3538 |
| 120 | Ga0070696_100140652 | 3300005546 | Bacteria | 1764 |
| 121 | Ga0070693_100000167 | 3300005547 | Bacteria | 30641 |
| 122 | Ga0070665_100005172 | 3300005548 | Bacteria | 13499 |
| 123 | Ga0070665_100361180 | 3300005548 | Bacteria | 1458 |
| 124 | Ga0070704_100045665 | 3300005549 | Bacteria | 3049 |
| 125 | Ga0070704_100102194 | 3300005549 | Bacteria | 2162 |
| 126 | Ga0070704_100130031 | 3300005549 | Bacteria | 1950 |
| 127 | Ga0068855_100001160 | 3300005563 | Bacteria | 32655 |
| 128 | Ga0068855_100040381 | 3300005563 | Bacteria | 5539 |
| 129 | Ga0068855_100118510 | 3300005563 | Bacteria | 3032 |
| 130 | Ga0068855_100129707 | 3300005563 | Bacteria | 2880 |
| 131 | Ga0070664_100000955 | 3300005564 | Bacteria | 22600 |
| 132 | Ga0070664_100006174 | 3300005564 | Bacteria | 9684 |
| 133 | Ga0070664_100031002 | 3300005564 | Bacteria | 4464 |
| 134 | Ga0070664_100039768 | 3300005564 | Bacteria | 3964 |
| 135 | Ga0070664_100039893 | 3300005564 | Bacteria | 3958 |
| 136 | Ga0070664_100103815 | 3300005564 | Bacteria | 2475 |
| 137 | Ga0068857_100001623 | 3300005577 | Bacteria | 18065 |
| 138 | Ga0068857_100044533 | 3300005577 | Bacteria | 3936 |
| 139 | Ga0068854_100002132 | 3300005578 | Bacteria | 12146 |
| 140 | Ga0068854_100047083 | 3300005578 | Bacteria | 3072 |
| 141 | Ga0068854_100067228 | 3300005578 | Bacteria | 2611 |
| 142 | Ga0068856_100001343 | 3300005614 | Bacteria | 25881 |
| 143 | Ga0068856_100001396 | 3300005614 | Bacteria | 25298 |
| 144 | Ga0068856_100009881 | 3300005614 | Bacteria | 9266 |
| 145 | Ga0070702_100137189 | 3300005615 | Bacteria | 1553 |
| 146 | Ga0068852_100011854 | 3300005616 | Bacteria | 6589 |
| 147 | Ga0068852_100064651 | 3300005616 | Bacteria | 3190 |
| 148 | Ga0068852_100164288 | 3300005616 | Bacteria | 2076 |
| 149 | Ga0068852_100300513 | 3300005616 | Bacteria | 1553 |
| 150 | Ga0068859_100001484 | 3300005617 | Bacteria | 23877 |
| 151 | Ga0068859_100009886 | 3300005617 | Bacteria | 9634 |
| 152 | Ga0068859_100021747 | 3300005617 | Bacteria | 6433 |
| 153 | Ga0068859_100202970 | 3300005617 | Bacteria | 2067 |
| 154 | Ga0068864_100000938 | 3300005618 | Bacteria | 24407 |
| 155 | Ga0068864_100002372 | 3300005618 | Bacteria | 15584 |
| 156 | Ga0068864_100009418 | 3300005618 | Bacteria | 8058 |
| 157 | Ga0068864_100034190 | 3300005618 | Bacteria | 4322 |
| 158 | Ga0068864_100057543 | 3300005618 | Bacteria | 3359 |
| 159 | Ga0068864_100066222 | 3300005618 | Bacteria | 3135 |
| 160 | Ga0068864_100245393 | 3300005618 | Bacteria | 1660 |
| 161 | Ga0068866_10004687 | 3300005718 | Bacteria | 5612 |
| 162 | Ga0068861_100000187 | 3300005719 | Bacteria | 33035 |
| 163 | Ga0068861_100056293 | 3300005719 | Bacteria | 3001 |
| 164 | Ga0068851_10000301 | 3300005834 | Bacteria | 22575 |
| 165 | Ga0068851_10001932 | 3300005834 | Bacteria | 9105 |
| 166 | Ga0068851_10006560 | 3300005834 | Bacteria | 5319 |
| 167 | Ga0068851_10058913 | 3300005834 | Bacteria | 1964 |
| 168 | Ga0068870_10008825 | 3300005840 | Bacteria | 4549 |
| 169 | Ga0068870_10043989 | 3300005840 | Bacteria | 2331 |
| 170 | Ga0068870_10044754 | 3300005840 | Bacteria | 2314 |
| 171 | Ga0068863_100001021 | 3300005841 | Bacteria | 28037 |
| 172 | Ga0068863_100006037 | 3300005841 | Bacteria | 11882 |
| 173 | Ga0068863_100010703 | 3300005841 | Bacteria | 8909 |
| 174 | Ga0068863_100034540 | 3300005841 | Bacteria | 4816 |
| 175 | Ga0068863_100052190 | 3300005841 | Bacteria | 3876 |
| 176 | Ga0068863_100057685 | 3300005841 | Bacteria | 3674 |
| 177 | Ga0068863_100105364 | 3300005841 | Bacteria | 2682 |
| 178 | Ga0068858_100008319 | 3300005842 | Bacteria | 9979 |
| 179 | Ga0068858_100018888 | 3300005842 | Bacteria | 6450 |
| 180 | Ga0068858_100028369 | 3300005842 | Bacteria | 5201 |
| 181 | Ga0068858_100082962 | 3300005842 | Bacteria | 2980 |
| 182 | Ga0068858_100093112 | 3300005842 | Bacteria | 2805 |
| 183 | Ga0068860_100011724 | 3300005843 | Bacteria | 8639 |
| 184 | Ga0068860_100015024 | 3300005843 | Bacteria | 7566 |
| 185 | Ga0068860_100038316 | 3300005843 | Bacteria | 4585 |
| 186 | Ga0068860_100053521 | 3300005843 | Bacteria | 3838 |
| 187 | Ga0068860_100111924 | 3300005843 | Bacteria | 2610 |
| 188 | Ga0068860_100211272 | 3300005843 | Bacteria | 1882 |
| 189 | Ga0068862_100005987 | 3300005844 | Bacteria | 10125 |
| 190 | Ga0068862_100032015 | 3300005844 | Bacteria | 4442 |
| 191 | Ga0081455_10099650 | 3300005937 | Bacteria | 2336 |
| 192 | Ga0075365_10001639 | 3300006038 | Bacteria | 10321 |
| 193 | Ga0075365_10085718 | 3300006038 | Bacteria | 2140 |
| 194 | Ga0075368_10002914 | 3300006042 | Bacteria | 5654 |
| 195 | Ga0075368_10015544 | 3300006042 | Bacteria | 2826 |
| 196 | Ga0075363_100000471 | 3300006048 | Bacteria | 12659 |
| 197 | Ga0075363_100014716 | 3300006048 | Bacteria | 3831 |
| 198 | Ga0070716_100050706 | 3300006173 | Bacteria | 2357 |
| 199 | Ga0070712_100041403 | 3300006175 | Bacteria | 3163 |
| 200 | Ga0070712_100114798 | 3300006175 | Bacteria | 2017 |
| 201 | Ga0070712_100374529 | 3300006175 | Bacteria | 1170 |
| 202 | Ga0075362_10072296 | 3300006177 | Bacteria | 1577 |
| 203 | Ga0075367_10008151 | 3300006178 | Bacteria | 5412 |
| 204 | Ga0075369_10000016 | 3300006186 | Bacteria | 52351 |
| 205 | Ga0075369_10004576 | 3300006186 | Bacteria | 5128 |
| 206 | Ga0075369_10087758 | 3300006186 | Bacteria | 1385 |
| 207 | Ga0075366_10022972 | 3300006195 | Bacteria | 3632 |
| 208 | Ga0075366_10056058 | 3300006195 | Bacteria | 2340 |
| 209 | Ga0075366_10068686 | 3300006195 | Bacteria | 2108 |
| 210 | Ga0097621_100009045 | 3300006237 | Bacteria | 7215 |
| 211 | Ga0097621_100022190 | 3300006237 | Bacteria | 4925 |
| 212 | Ga0097621_100059498 | 3300006237 | Bacteria | 3128 |
| 213 | Ga0097621_100282452 | 3300006237 | Bacteria | 1461 |
| 214 | Ga0075370_10000902 | 3300006353 | Bacteria | 12172 |
| 215 | Ga0075370_10004770 | 3300006353 | Bacteria | 6634 |
| 216 | Ga0068871_100004641 | 3300006358 | Bacteria | 9598 |
| 217 | Ga0068871_100038217 | 3300006358 | Bacteria | 3832 |
| 218 | Ga0068871_100042837 | 3300006358 | Bacteria | 3636 |
| 219 | Ga0068871_100048109 | 3300006358 | Bacteria | 3441 |
| 220 | Ga0075428_100033734 | 3300006844 | Bacteria | 5648 |
| 221 | Ga0075434_100176274 | 3300006871 | Bacteria | 2158 |
| 222 | Ga0075434_100412958 | 3300006871 | Bacteria | 1371 |
| 223 | Ga0075429_100016270 | 3300006880 | Bacteria | 6446 |
| 224 | Ga0068865_100003642 | 3300006881 | Bacteria | 9258 |
| 225 | Ga0068865_100010571 | 3300006881 | Bacteria | 5750 |
| 226 | Ga0068865_100025208 | 3300006881 | Bacteria | 3908 |
| 227 | Ga0097620_100001484 | 3300006931 | Bacteria | 23877 |
| 228 | Ga0097620_100009886 | 3300006931 | Bacteria | 9634 |
| 229 | Ga0097620_100021748 | 3300006931 | Bacteria | 6433 |
| 230 | Ga0097620_100202978 | 3300006931 | Bacteria | 2067 |
| 231 | Ga0105240_10130883 | 3300009093 | Bacteria | 3010 |
| 232 | Ga0105240_10229732 | 3300009093 | Bacteria | 2157 |
| 233 | Ga0111539_10013246 | 3300009094 | Bacteria | 10308 |
| 234 | Ga0105245_10008101 | 3300009098 | Bacteria | 9193 |
| 235 | Ga0105245_10012549 | 3300009098 | Bacteria | 7374 |
| 236 | Ga0105245_10038293 | 3300009098 | Bacteria | 4267 |
| 237 | Ga0105247_10012360 | 3300009101 | Bacteria | 5127 |
| 238 | Ga0105247_10050405 | 3300009101 | Bacteria | 2562 |
| 239 | Ga0114129_10134553 | 3300009147 | Bacteria | 3392 |
| 240 | Ga0114129_10521429 | 3300009147 | Bacteria | 1549 |
| 241 | Ga0105243_10038645 | 3300009148 | Bacteria | 3717 |
| 242 | Ga0105243_10342041 | 3300009148 | Bacteria | 1371 |
| 243 | Ga0105241_10064713 | 3300009174 | Bacteria | 2824 |
| 244 | Ga0105241_10229549 | 3300009174 | Bacteria | 1564 |
| 245 | Ga0105242_10004238 | 3300009176 | Bacteria | 11181 |
| 246 | Ga0105242_10107031 | 3300009176 | Bacteria | 2378 |
| 247 | Ga0105248_10010030 | 3300009177 | Bacteria | 10430 |
| 248 | Ga0105248_10019096 | 3300009177 | Bacteria | 7581 |
| 249 | Ga0105248_10031986 | 3300009177 | Bacteria | 5878 |
| 250 | Ga0105248_10039953 | 3300009177 | Bacteria | 5259 |
| 251 | Ga0105248_10104876 | 3300009177 | Bacteria | 3187 |
| 252 | Ga0105248_10187291 | 3300009177 | Bacteria | 2332 |
| 253 | Ga0105237_10132236 | 3300009545 | Bacteria | 2489 |
| 254 | Ga0105238_10262791 | 3300009551 | Bacteria | 1706 |
| 255 | Ga0105239_10105346 | 3300010375 | Bacteria | 3123 |
| 256 | Ga0105246_10120338 | 3300011119 | Bacteria | 1944 |
| 257 | Ga0105246_10137324 | 3300011119 | Bacteria | 1834 |
| 258 | Ga0105246_10153983 | 3300011119 | Bacteria | 1743 |
| 259 | Ga0157373_10000447 | 3300013100 | Bacteria | 32642 |
| 260 | Ga0157373_10107452 | 3300013100 | Bacteria | 1962 |
| 261 | Ga0157371_10001482 | 3300013102 | Bacteria | 24271 |
| 262 | Ga0157370_10003331 | 3300013104 | Bacteria | 18930 |
| 263 | Ga0157370_10022125 | 3300013104 | Bacteria | 6328 |
| 264 | Ga0157370_10026443 | 3300013104 | Bacteria | 5730 |
| 265 | Ga0157370_10037106 | 3300013104 | Bacteria | 4726 |
| 266 | Ga0157370_10091638 | 3300013104 | Bacteria | 2853 |
| 267 | Ga0157370_10141901 | 3300013104 | Bacteria | 2238 |
| 268 | Ga0157369_10046834 | 3300013105 | Bacteria | 4698 |
| 269 | Ga0157374_10000170 | 3300013296 | Bacteria | 60286 |
| 270 | Ga0157374_10021298 | 3300013296 | Bacteria | 5766 |
| 271 | Ga0157374_10146710 | 3300013296 | Bacteria | 2292 |
| 272 | Ga0157374_10190292 | 3300013296 | Bacteria | 2007 |
| 273 | Ga0157378_10003627 | 3300013297 | Bacteria | 13661 |
| 274 | Ga0157378_10008577 | 3300013297 | Bacteria | 8897 |
| 275 | Ga0157378_10023714 | 3300013297 | Bacteria | 5398 |
| 276 | Ga0157378_10060219 | 3300013297 | Bacteria | 3388 |
| 277 | Ga0163162_10011501 | 3300013306 | Bacteria | 8631 |
| 278 | Ga0163162_10048032 | 3300013306 | Bacteria | 4276 |
| 279 | Ga0163162_10113072 | 3300013306 | Bacteria | 2813 |
| 280 | Ga0163162_10198673 | 3300013306 | Bacteria | 2134 |
| 281 | Ga0157372_10004508 | 3300013307 | Bacteria | 14858 |
| 282 | Ga0157372_10337826 | 3300013307 | Bacteria | 1754 |
| 283 | Ga0157375_10002885 | 3300013308 | Bacteria | 14912 |
| 284 | Ga0157375_10009095 | 3300013308 | Bacteria | 8701 |
| 285 | Ga0157375_10225266 | 3300013308 | Bacteria | 2034 |
| 286 | Ga0157375_10361254 | 3300013308 | Bacteria | 1618 |
| 287 | Ga0163163_10006684 | 3300014325 | Bacteria | 10104 |
| 288 | Ga0163163_10009220 | 3300014325 | Bacteria | 8798 |
| 289 | Ga0163163_10029291 | 3300014325 | Bacteria | 5296 |
| 290 | Ga0163163_10154655 | 3300014325 | Bacteria | 2337 |
| 291 | Ga0163163_10185397 | 3300014325 | Bacteria | 2129 |
| 292 | Ga0157379_10002047 | 3300014968 | Bacteria | 16745 |
| 293 | Ga0157379_10004185 | 3300014968 | Bacteria | 12322 |
| 294 | Ga0157379_10029917 | 3300014968 | Bacteria | 4844 |
| 295 | Ga0157379_10062732 | 3300014968 | Bacteria | 3323 |
| 296 | Ga0157376_10174678 | 3300014969 | Bacteria | 1959 |
| 297 | Ga0163161_10040274 | 3300017792 | Bacteria | 3356 |
| 298 | Ga0163161_10047214 | 3300017792 | Bacteria | 3110 |
| 299 | Ga0207697_10000594 | 3300025315 | Bacteria | 20589 |
| 300 | Ga0207697_10068683 | 3300025315 | Bacteria | 1483 |
| 301 | Ga0207682_10000556 | 3300025893 | Bacteria | 17211 |
| 302 | Ga0207692_10016570 | 3300025898 | Bacteria | 3268 |
| 303 | Ga0207692_10139326 | 3300025898 | Bacteria | 1378 |
| 304 | Ga0207642_10002368 | 3300025899 | Bacteria | 5867 |
| 305 | Ga0207642_10058191 | 3300025899 | Bacteria | 1782 |
| 306 | Ga0207710_10021920 | 3300025900 | Bacteria | 2740 |
| 307 | Ga0207710_10085980 | 3300025900 | Bacteria | 1465 |
| 308 | Ga0207688_10003876 | 3300025901 | Bacteria | 8159 |
| 309 | Ga0207688_10170265 | 3300025901 | Bacteria | 1295 |
| 310 | Ga0207680_10006648 | 3300025903 | Bacteria | 5610 |
| 311 | Ga0207680_10075481 | 3300025903 | Bacteria | 2103 |
| 312 | Ga0207699_10038666 | 3300025906 | Bacteria | 2736 |
| 313 | Ga0207699_10045973 | 3300025906 | Bacteria | 2550 |
| 314 | Ga0207645_10003500 | 3300025907 | Bacteria | 11889 |
| 315 | Ga0207645_10004486 | 3300025907 | Bacteria | 10330 |
| 316 | Ga0207645_10024033 | 3300025907 | Bacteria | 3955 |
| 317 | Ga0207645_10185079 | 3300025907 | Bacteria | 1367 |
| 318 | Ga0207643_10000610 | 3300025908 | Bacteria | 22591 |
| 319 | Ga0207643_10019765 | 3300025908 | Bacteria | 3692 |
| 320 | Ga0207643_10035144 | 3300025908 | Bacteria | 2809 |
| 321 | Ga0207643_10061540 | 3300025908 | Bacteria | 2144 |
| 322 | Ga0207684_10120923 | 3300025910 | Bacteria | 2245 |
| 323 | Ga0207707_10082322 | 3300025912 | Bacteria | 2810 |
| 324 | Ga0207707_10370517 | 3300025912 | Bacteria | 1232 |
| 325 | Ga0207671_10074580 | 3300025914 | Bacteria | 2536 |
| 326 | Ga0207693_10002176 | 3300025915 | Bacteria | 17081 |
| 327 | Ga0207693_10012772 | 3300025915 | Bacteria | 6777 |
| 328 | Ga0207693_10015681 | 3300025915 | Bacteria | 6074 |
| 329 | Ga0207693_10345568 | 3300025915 | Bacteria | 1164 |
| 330 | Ga0207663_10058199 | 3300025916 | Bacteria | 2438 |
| 331 | Ga0207663_10088103 | 3300025916 | Bacteria | 2052 |
| 332 | Ga0207660_10183717 | 3300025917 | Bacteria | 1625 |
| 333 | Ga0207662_10014389 | 3300025918 | Bacteria | 4439 |
| 334 | Ga0207662_10045539 | 3300025918 | Bacteria | 2593 |
| 335 | Ga0207657_10000371 | 3300025919 | Bacteria | 47425 |
| 336 | Ga0207657_10012827 | 3300025919 | Bacteria | 8248 |
| 337 | Ga0207657_10021571 | 3300025919 | Bacteria | 6057 |
| 338 | Ga0207657_10046523 | 3300025919 | Bacteria | 3799 |
| 339 | Ga0207657_10237633 | 3300025919 | Bacteria | 1456 |
| 340 | Ga0207649_10027946 | 3300025920 | Bacteria | 3317 |
| 341 | Ga0207652_10014079 | 3300025921 | Bacteria | 6475 |
| 342 | Ga0207652_10019068 | 3300025921 | Bacteria | 5635 |
| 343 | Ga0207652_10236799 | 3300025921 | Bacteria | 1645 |
| 344 | Ga0207646_10429260 | 3300025922 | Bacteria | 1192 |
| 345 | Ga0207681_10007075 | 3300025923 | Bacteria | 6881 |
| 346 | Ga0207681_10059152 | 3300025923 | Bacteria | 2626 |
| 347 | Ga0207694_10101301 | 3300025924 | Bacteria | 2282 |
| 348 | Ga0207650_10005168 | 3300025925 | Bacteria | 8905 |
| 349 | Ga0207650_10030680 | 3300025925 | Bacteria | 3875 |
| 350 | Ga0207650_10099096 | 3300025925 | Bacteria | 2240 |
| 351 | Ga0207650_10123134 | 3300025925 | Bacteria | 2021 |
| 352 | Ga0207650_10247559 | 3300025925 | Bacteria | 1442 |
| 353 | Ga0207659_10100131 | 3300025926 | Bacteria | 2183 |
| 354 | Ga0207659_10148802 | 3300025926 | Bacteria | 1826 |
| 355 | Ga0207687_10001668 | 3300025927 | Bacteria | 15313 |
| 356 | Ga0207687_10022739 | 3300025927 | Bacteria | 4175 |
| 357 | Ga0207700_10009580 | 3300025928 | Bacteria | 6063 |
| 358 | Ga0207700_10049833 | 3300025928 | Bacteria | 3117 |
| 359 | Ga0207664_10001654 | 3300025929 | Bacteria | 14676 |
| 360 | Ga0207664_10041934 | 3300025929 | Bacteria | 3569 |
| 361 | Ga0207664_10071655 | 3300025929 | Bacteria | 2792 |
| 362 | Ga0207644_10014130 | 3300025931 | Bacteria | 5341 |
| 363 | Ga0207644_10018123 | 3300025931 | Bacteria | 4760 |
| 364 | Ga0207644_10018467 | 3300025931 | Bacteria | 4718 |
| 365 | Ga0207644_10074707 | 3300025931 | Bacteria | 2488 |
| 366 | Ga0207690_10004056 | 3300025932 | Bacteria | 8653 |
| 367 | Ga0207690_10048997 | 3300025932 | Bacteria | 2813 |
| 368 | Ga0207706_10003193 | 3300025933 | Bacteria | 15731 |
| 369 | Ga0207706_10014297 | 3300025933 | Bacteria | 7195 |
| 370 | Ga0207706_10027259 | 3300025933 | Bacteria | 5110 |
| 371 | Ga0207686_10000198 | 3300025934 | Bacteria | 46402 |
| 372 | Ga0207709_10064075 | 3300025935 | Bacteria | 2306 |
| 373 | Ga0207670_10069615 | 3300025936 | Bacteria | 2428 |
| 374 | Ga0207670_10134608 | 3300025936 | Bacteria | 1815 |
| 375 | Ga0207669_10009461 | 3300025937 | Bacteria | 4643 |
| 376 | Ga0207669_10013482 | 3300025937 | Bacteria | 4061 |
| 377 | Ga0207669_10025058 | 3300025937 | Bacteria | 3216 |
| 378 | Ga0207704_10028451 | 3300025938 | Bacteria | 3101 |
| 379 | Ga0207704_10036295 | 3300025938 | Bacteria | 2835 |
| 380 | Ga0207665_10014015 | 3300025939 | Bacteria | 5274 |
| 381 | Ga0207665_10043053 | 3300025939 | Bacteria | 3018 |
| 382 | Ga0207691_10000006 | 3300025940 | Bacteria | 161922 |
| 383 | Ga0207691_10003579 | 3300025940 | Bacteria | 15124 |
| 384 | Ga0207691_10004159 | 3300025940 | Bacteria | 14058 |
| 385 | Ga0207691_10004308 | 3300025940 | Bacteria | 13821 |
| 386 | Ga0207691_10009490 | 3300025940 | Bacteria | 9343 |
| 387 | Ga0207691_10013381 | 3300025940 | Bacteria | 7856 |
| 388 | Ga0207691_10043503 | 3300025940 | Bacteria | 4139 |
| 389 | Ga0207691_10073185 | 3300025940 | Bacteria | 3090 |
| 390 | Ga0207691_10116874 | 3300025940 | Bacteria | 2367 |
| 391 | Ga0207711_10003428 | 3300025941 | Bacteria | 13714 |
| 392 | Ga0207711_10004968 | 3300025941 | Bacteria | 11289 |
| 393 | Ga0207711_10095093 | 3300025941 | Bacteria | 2627 |
| 394 | Ga0207689_10000042 | 3300025942 | Bacteria | 93077 |
| 395 | Ga0207689_10004105 | 3300025942 | Bacteria | 13242 |
| 396 | Ga0207689_10005585 | 3300025942 | Bacteria | 11211 |
| 397 | Ga0207689_10008507 | 3300025942 | Bacteria | 8946 |
| 398 | Ga0207689_10040648 | 3300025942 | Bacteria | 3848 |
| 399 | Ga0207661_10036439 | 3300025944 | Bacteria | 3840 |
| 400 | Ga0207679_10001683 | 3300025945 | Bacteria | 13764 |
| 401 | Ga0207679_10012878 | 3300025945 | Bacteria | 5470 |
| 402 | Ga0207679_10022820 | 3300025945 | Bacteria | 4267 |
| 403 | Ga0207679_10032598 | 3300025945 | Bacteria | 3660 |
| 404 | Ga0207679_10086697 | 3300025945 | Bacteria | 2409 |
| 405 | Ga0207679_10154821 | 3300025945 | Bacteria | 1870 |
| 406 | Ga0207667_10003619 | 3300025949 | Bacteria | 19070 |
| 407 | Ga0207667_10044359 | 3300025949 | Bacteria | 4712 |
| 408 | Ga0207667_10068970 | 3300025949 | Bacteria | 3680 |
| 409 | Ga0207667_10178312 | 3300025949 | Bacteria | 2182 |
| 410 | Ga0207651_10001393 | 3300025960 | Bacteria | 10955 |
| 411 | Ga0207651_10028614 | 3300025960 | Bacteria | 3518 |
| 412 | Ga0207651_10068222 | 3300025960 | Bacteria | 2506 |
| 413 | Ga0207651_10122548 | 3300025960 | Bacteria | 1974 |
| 414 | Ga0207668_10009587 | 3300025972 | Bacteria | 5812 |
| 415 | Ga0207668_10037112 | 3300025972 | Bacteria | 3259 |
| 416 | Ga0207668_10124429 | 3300025972 | Bacteria | 1958 |
| 417 | Ga0207640_10020279 | 3300025981 | Bacteria | 3945 |
| 418 | Ga0207640_10062757 | 3300025981 | Bacteria | 2466 |
| 419 | Ga0207640_10148844 | 3300025981 | Bacteria | 1717 |
| 420 | Ga0207640_10294478 | 3300025981 | Bacteria | 1281 |
| 421 | Ga0207658_10006384 | 3300025986 | Bacteria | 8050 |
| 422 | Ga0207658_10010407 | 3300025986 | Bacteria | 6318 |
| 423 | Ga0207658_10051451 | 3300025986 | Bacteria | 3036 |
| 424 | Ga0207658_10073152 | 3300025986 | Bacteria | 2601 |
| 425 | Ga0207658_10093581 | 3300025986 | Bacteria | 2337 |
| 426 | Ga0207658_10171676 | 3300025986 | Bacteria | 1787 |
| 427 | Ga0207658_10232392 | 3300025986 | Bacteria | 1557 |
| 428 | Ga0207658_10361530 | 3300025986 | Bacteria | 1266 |
| 429 | Ga0207677_10000799 | 3300026023 | Bacteria | 18068 |
| 430 | Ga0207677_10269557 | 3300026023 | Bacteria | 1392 |
| 431 | Ga0207703_10000143 | 3300026035 | Bacteria | 84508 |
| 432 | Ga0207703_10009453 | 3300026035 | Bacteria | 7655 |
| 433 | Ga0207703_10042736 | 3300026035 | Bacteria | 3636 |
| 434 | Ga0207703_10049361 | 3300026035 | Bacteria | 3402 |
| 435 | Ga0207703_10066887 | 3300026035 | Bacteria | 2957 |
| 436 | Ga0207703_10109175 | 3300026035 | Bacteria | 2357 |
| 437 | Ga0207639_10024584 | 3300026041 | Bacteria | 4362 |
| 438 | Ga0207639_10131012 | 3300026041 | Bacteria | 2076 |
| 439 | Ga0207639_10227959 | 3300026041 | Bacteria | 1613 |
| 440 | Ga0207678_10009805 | 3300026067 | Bacteria | 8421 |
| 441 | Ga0207678_10022877 | 3300026067 | Bacteria | 5471 |
| 442 | Ga0207678_10034156 | 3300026067 | Bacteria | 4430 |
| 443 | Ga0207678_10117246 | 3300026067 | Bacteria | 2272 |
| 444 | Ga0207678_10202717 | 3300026067 | Bacteria | 1696 |
| 445 | Ga0207702_10003083 | 3300026078 | Bacteria | 15461 |
| 446 | Ga0207702_10021898 | 3300026078 | Bacteria | 5294 |
| 447 | Ga0207641_10007742 | 3300026088 | Bacteria | 8928 |
| 448 | Ga0207641_10009450 | 3300026088 | Bacteria | 8034 |
| 449 | Ga0207641_10023159 | 3300026088 | Bacteria | 5117 |
| 450 | Ga0207641_10025174 | 3300026088 | Bacteria | 4907 |
| 451 | Ga0207641_10092470 | 3300026088 | Bacteria | 2649 |
| 452 | Ga0207648_10002730 | 3300026089 | Bacteria | 18749 |
| 453 | Ga0207648_10010928 | 3300026089 | Bacteria | 8579 |
| 454 | Ga0207648_10050141 | 3300026089 | Bacteria | 3650 |
| 455 | Ga0207648_10065770 | 3300026089 | Bacteria | 3161 |
| 456 | Ga0207648_10130003 | 3300026089 | Bacteria | 2216 |
| 457 | Ga0207648_10250674 | 3300026089 | Bacteria | 1578 |
| 458 | Ga0207676_10000837 | 3300026095 | Bacteria | 23871 |
| 459 | Ga0207676_10003209 | 3300026095 | Bacteria | 11650 |
| 460 | Ga0207676_10004178 | 3300026095 | Bacteria | 10207 |
| 461 | Ga0207676_10007434 | 3300026095 | Bacteria | 7769 |
| 462 | Ga0207676_10121414 | 3300026095 | Bacteria | 2204 |
| 463 | Ga0207676_10125971 | 3300026095 | Bacteria | 2169 |
| 464 | Ga0207676_10348973 | 3300026095 | Bacteria | 1368 |
| 465 | Ga0207676_10415460 | 3300026095 | Bacteria | 1260 |
| 466 | Ga0207674_10003466 | 3300026116 | Bacteria | 19294 |
| 467 | Ga0207674_10022069 | 3300026116 | Bacteria | 6844 |
| 468 | Ga0207674_10049033 | 3300026116 | Bacteria | 4320 |
| 469 | Ga0207675_100000517 | 3300026118 | Bacteria | 37526 |
| 470 | Ga0207675_100007054 | 3300026118 | Bacteria | 10616 |
| 471 | Ga0207675_100017152 | 3300026118 | Bacteria | 6762 |
| 472 | Ga0207675_100029559 | 3300026118 | Bacteria | 5105 |
| 473 | Ga0207683_10002753 | 3300026121 | Bacteria | 15353 |
| 474 | Ga0207683_10020492 | 3300026121 | Bacteria | 5655 |
| 475 | Ga0207683_10022316 | 3300026121 | Bacteria | 5432 |
| 476 | Ga0207683_10240338 | 3300026121 | Bacteria | 1652 |
| 477 | Ga0207683_10350272 | 3300026121 | Bacteria | 1355 |
| 478 | Ga0207698_10128374 | 3300026142 | Bacteria | 2161 |
| 479 | Ga0207698_10178858 | 3300026142 | Bacteria | 1877 |
| 480 | Ga0207698_10440975 | 3300026142 | Bacteria | 1254 |
| 481 | Ga0209971_1003509 | 3300027682 | Bacteria | 3711 |
| 482 | Ga0209971_1005384 | 3300027682 | Bacteria | 3043 |
| 483 | Ga0209998_10002641 | 3300027717 | Bacteria | 4056 |
| 484 | Ga0209813_10001896 | 3300027866 | Bacteria | 4714 |
| 485 | Ga0209974_10033915 | 3300027876 | Bacteria | 1695 |
| 486 | Ga0268266_10002385 | 3300028379 | Bacteria | 20297 |
| 487 | Ga0268266_10140837 | 3300028379 | Bacteria | 2164 |
| 488 | Ga0268265_10019444 | 3300028380 | Bacteria | 4721 |
| 489 | Ga0268264_10000641 | 3300028381 | Bacteria | 41364 |
| 490 | Ga0268264_10025067 | 3300028381 | Bacteria | 4874 |
| 491 | Ga0268264_10032340 | 3300028381 | Bacteria | 4292 |
| 492 | Ga0268264_10083699 | 3300028381 | Bacteria | 2733 |
| 493 | Ga0268264_10434735 | 3300028381 | Bacteria | 1268 |
| 494 | Ga0265334_10000010 | 3300028573 | Bacteria | 188179 |
| 495 | Ga0265338_10028579 | 3300028800 | Bacteria | 5556 |
| 496 | Ga0307511_10006365 | 3300030521 | Bacteria | 11902 |
| 497 | Ga0265332_10001333 | 3300031238 | Bacteria | 14001 |
| 498 | Ga0265325_10000877 | 3300031241 | Bacteria | 21725 |
| 499 | Ga0265331_10000310 | 3300031250 | Bacteria | 53265 |
| 500 | Ga0265327_10000572 | 3300031251 | Bacteria | 62611 |
| 501 | Ga0265327_10001730 | 3300031251 | Bacteria | 25883 |
| 502 | Ga0265327_10002920 | 3300031251 | Bacteria | 17116 |
| 503 | Ga0307509_10000033 | 3300031507 | Bacteria | 194363 |
| 504 | Ga0307408_100004310 | 3300031548 | Bacteria | 9653 |
| 505 | Ga0307408_100141027 | 3300031548 | Bacteria | 1892 |
| 506 | Ga0265313_10000068 | 3300031595 | Bacteria | 100563 |
| 507 | Ga0265313_10006502 | 3300031595 | Bacteria | 8260 |
| 508 | Ga0265314_10003412 | 3300031711 | Bacteria | 15382 |
| 509 | Ga0265342_10072046 | 3300031712 | Bacteria | 2012 |
| 510 | Ga0307405_10001513 | 3300031731 | Bacteria | 9845 |
| 511 | Ga0307410_10008880 | 3300031852 | Bacteria | 5606 |
| 512 | Ga0307406_10025843 | 3300031901 | Bacteria | 3519 |
| 513 | Ga0307407_10010883 | 3300031903 | Bacteria | 4309 |
| 514 | Ga0307412_10025410 | 3300031911 | Bacteria | 3669 |
| 515 | Ga0307409_100012433 | 3300031995 | Bacteria | 5424 |
| 516 | Ga0307411_10000280 | 3300032005 | Bacteria | 16974 |
| 517 | Ga0307411_10207499 | 3300032005 | Bacteria | 1510 |
| 518 | Ga0316583_10000196 | 3300032133 | Bacteria | 15776 |
| 519 | Ga0316593_10002321 | 3300032168 | Bacteria | 4472 |
| 520 | Ga0373953_0005869 | 3300035117 | Bacteria | 4012 |
| 521 | Ga0373954_0055406 | 3300035118 | Bacteria | 1865 |
| 522 | Ga0373956_0018705 | 3300035119 | Bacteria | 2935 |
| 523 | Ga0373956_0027005 | 3300035119 | Bacteria | 2489 |
| 524 | Ga0373957_0022658 | 3300035120 | Bacteria | 2239 |
| 525 | Ga0373955_0039541 | 3300035172 | Bacteria | 2518 |
| 526 | Ga0373955_0120592 | 3300035172 | Bacteria | 1524 |
| 527 | Ga0373935_0054736 | 3300035692 | Bacteria | 2542 |
| 528 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 529 | Ga0373927_0009964 | 3300035695 | Bacteria | 6368 |
| 530 | Ga0373927_0071122 | 3300035695 | Bacteria | 2252 |
| 531 | Ga0373927_0158677 | 3300035695 | Bacteria | 1482 |
| 532 | Ga0373937_0025706 | 3300036401 | Bacteria | 5317 |
| 533 | Ga0373937_0034356 | 3300036401 | Bacteria | 4612 |
| 534 | Ga0316582_0050906 | 3300036647 | Bacteria | 2626 |
| 535 | Ga0316584_0019586 | 3300036712 | Bacteria | 4893 |
| 536 | Ga0373925_0037859 | 3300037068 | Bacteria | 3562 |
| 537 | Ga0436361_0989378 | 3300039447 | Bacteria | 2213 |
| 538 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 539 | Ga0451577_0000384 | 3300042876 | Bacteria | 82022 |
| 540 | Ga0451577_0010249 | 3300042876 | Bacteria | 8975 |
| 541 | Ga0466972_0000070 | 3300044658 | Bacteria | 100242 |
| 542 | Ga0453683_0000003 | 3300044673 | Bacteria | 942572 |
| 543 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 544 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 545 | Ga0453684_0000292 | 3300044712 | Bacteria | 213050 |
| 546 | Ga0453684_0000511 | 3300044712 | Bacteria | 150804 |
| 547 | Ga0453684_0001222 | 3300044712 | Bacteria | 78832 |
| 548 | Ga0453684_0003022 | 3300044712 | Bacteria | 39115 |
| 549 | Ga0451576_0000034 | 3300045051 | Bacteria | 390778 |
| 550 | Ga0451576_0000266 | 3300045051 | Bacteria | 127813 |
| 551 | Ga0451576_0000533 | 3300045051 | Bacteria | 82000 |
| 552 | Ga0451576_0050342 | 3300045051 | Bacteria | 4368 |
| 553 | Ga0495629_0008490 | 3300046459 | Bacteria | 7563 |
| 554 | Ga0495580_0025942 | 3300046472 | Bacteria | 4277 |
| 555 | Ga0495639_0010739 | 3300046475 | Bacteria | 3940 |
| 556 | Ga0495630_0055951 | 3300046517 | Bacteria | 2956 |
| 557 | Ga0495642_0052845 | 3300046528 | Bacteria | 1674 |
| 558 | Ga0495640_0016426 | 3300046533 | Bacteria | 5536 |
| 559 | Ga0495645_0027599 | 3300046543 | Bacteria | 4125 |
| 560 | Ga0495645_0120892 | 3300046543 | Bacteria | 1844 |
| 561 | Ga0495667_0048450 | 3300046559 | Bacteria | 2806 |
| 562 | Ga0495656_0000664 | 3300046615 | Bacteria | 10991 |
| 563 | Ga0495635_0035566 | 3300046663 | Bacteria | 3453 |
| 564 | Ga0495659_0039370 | 3300046664 | Bacteria | 1681 |
| 565 | Ga0495588_0092966 | 3300046674 | Bacteria | 1581 |
| 566 | Ga0495599_0037574 | 3300046678 | Bacteria | 3042 |
| 567 | Ga0495658_0156323 | 3300046683 | Bacteria | 1403 |
| 568 | Ga0495613_0007994 | 3300046689 | Bacteria | 7866 |
| 569 | Ga0495600_0012682 | 3300046809 | Bacteria | 5276 |
| 570 | Ga0495581_0001341 | 3300047315 | Bacteria | 13603 |
| 571 | Ga0495593_0026218 | 3300047673 | Bacteria | 3220 |
| 572 | Ga0495602_0134349 | 3300048088 | Bacteria | 1968 |
| 573 | Ga0496100_0171382 | 3300048903 | Bacteria | 1563 |
| 574 | Ga0496101_0062927 | 3300048904 | Bacteria | 2699 |
| 575 | Ga0496101_0191640 | 3300048904 | Bacteria | 1578 |
| 576 | Ga0496102_0004733 | 3300048905 | Bacteria | 11528 |
| 577 | Ga0496102_0049371 | 3300048905 | Bacteria | 3828 |
| 578 | Ga0496102_0061780 | 3300048905 | Bacteria | 3430 |
| 579 | Ga0496102_0093460 | 3300048905 | Bacteria | 2786 |
| 580 | Ga0496103_0157305 | 3300048906 | Bacteria | 1457 |
| 581 | Ga0496103_0214268 | 3300048906 | Bacteria | 1238 |
| 582 | Ga0496104_0008261 | 3300048907 | Bacteria | 9243 |
| 583 | Ga0496104_0076399 | 3300048907 | Bacteria | 3190 |
| 584 | Ga0496105_0043192 | 3300048908 | Bacteria | 3717 |
| 585 | Ga0496106_0000409 | 3300048909 | Bacteria | 30485 |
| 586 | Ga0496106_0022995 | 3300048909 | Bacteria | 4630 |
| 587 | Ga0496106_0262728 | 3300048909 | Bacteria | 1381 |
| 588 | Ga0496107_0040266 | 3300048910 | Bacteria | 3354 |
| 589 | Ga0496107_0123366 | 3300048910 | Bacteria | 1909 |
| 590 | Ga0496108_0004995 | 3300048911 | Bacteria | 10716 |
| 591 | Ga0496108_0011989 | 3300048911 | Bacteria | 7053 |
| 592 | Ga0496108_0063178 | 3300048911 | Bacteria | 3118 |
| 593 | Ga0496109_0086713 | 3300048912 | Bacteria | 2891 |
| 594 | Ga0496109_0133532 | 3300048912 | Bacteria | 2318 |
| 595 | Ga0496109_0340921 | 3300048912 | Bacteria | 1415 |
| 596 | Ga0496110_0004341 | 3300048913 | Bacteria | 10976 |
| 597 | Ga0496110_0021483 | 3300048913 | Bacteria | 5466 |
| 598 | Ga0496111_0051530 | 3300048914 | Bacteria | 2971 |
| 599 | Ga0496112_0002525 | 3300048915 | Bacteria | 14775 |
| 600 | Ga0496112_0017345 | 3300048915 | Bacteria | 6763 |
| 601 | Ga0496112_0108435 | 3300048915 | Bacteria | 2747 |
| 602 | Ga0496113_0109534 | 3300048916 | Bacteria | 2148 |
| 603 | Ga0496114_0028019 | 3300048917 | Bacteria | 4619 |
| 604 | Ga0495678_004540 | 3300049459 | Bacteria | 7994 |
| 605 | Ga0501034_0127116 | 3300049571 | Bacteria | 2534 |
| 606 | Ga0501047_0113584 | 3300049581 | Bacteria | 2591 |
| 607 | Ga0501070_0006738 | 3300049586 | Bacteria | 9783 |
| 608 | Ga0501072_0059746 | 3300049588 | Bacteria | 3006 |
| 609 | Ga0501073_0009180 | 3300049589 | Bacteria | 7295 |
| 610 | Ga0501083_0230722 | 3300049744 | Bacteria | 1205 |
| 611 | nmdc:mga00v17_13237_c1 | 3300050491 | Bacteria | 4573 |
| 612 | nmdc:mga0k408_108603_c1 | 3300050493 | Bacteria | 1639 |
| 613 | nmdc:mga0k408_52447_c1 | 3300050493 | Bacteria | 2364 |
| 614 | nmdc:mga0k408_70923_c1 | 3300050493 | Bacteria | 2033 |
| 615 | nmdc:mga06z11_22316_c1 | 3300050494 | Bacteria | 2955 |
| 616 | nmdc:mga04h51_2776_c1 | 3300050495 | Bacteria | 4178 |
| 617 | nmdc:mga07m45_115_c1 | 3300050496 | Bacteria | 32090 |
| 618 | nmdc:mga07m45_21330_c1 | 3300050496 | Bacteria | 3526 |
| 619 | nmdc:mga05p37_332983_c1 | 3300050507 | Bacteria | 1792 |
| 620 | nmdc:mga05p37_80753_c1 | 3300050507 | Bacteria | 4005 |
| 621 | nmdc:mga09592_246778_c1 | 3300050508 | Bacteria | 1547 |
| 622 | nmdc:mga09592_7835_c1 | 3300050508 | Bacteria | 8682 |
| 623 | nmdc:mga08y16_206864_c1 | 3300050511 | Bacteria | 2033 |
| 624 | nmdc:mga0n895_131243_c1 | 3300050512 | Bacteria | 2530 |
| 625 | nmdc:mga0n895_212344_c1 | 3300050512 | Bacteria | 1965 |
| 626 | nmdc:mga0rr50_219760_c1 | 3300050513 | Bacteria | 1568 |
| 627 | nmdc:mga0rr50_41538_c1 | 3300050513 | Bacteria | 3352 |
| 628 | nmdc:mga0sz30_22_c3 | 3300050516 | Bacteria | 64467 |
| 629 | Ga0495595_0093117 | 3300053084 | Bacteria | 1448 |
| 630 | Ga0500646_0002660 | 3300053090 | Bacteria | 4624 |
| 631 | Ga0500636_0000406 | 3300053177 | Bacteria | 23697 |
| 632 | Ga0500637_0002477 | 3300053178 | Bacteria | 8220 |
| 633 | Ga0500625_020075 | 3300053729 | Bacteria | 3143 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036647 | Ga0316582_0050906 | Ga0316582_0050906_686_1675 | 326 |
| 2 | 3300036712 | Ga0316584_0019586 | Ga0316584_0019586_1354_2343 | 326 |
| 3 | 3300005530 | Ga0070679_100055556 | Ga0070679_1000555564 | 331 |
| 4 | 3300013104 | Ga0157370_10022125 | Ga0157370_100221256 | 331 |
| 5 | 3300025921 | Ga0207652_10019068 | Ga0207652_100190685 | 331 |
| 6 | 3300026116 | Ga0207674_10022069 | Ga0207674_100220695 | 331 |
| 7 | 3300026088 | Ga0207641_10025174 | Ga0207641_100251746 | 334 |
| 8 | 3300009551 | Ga0105238_10262791 | Ga0105238_102627912 | 335 |
| 9 | 3300006038 | Ga0075365_10001639 | Ga0075365_100016394 | 338 |
| 10 | 3300006042 | Ga0075368_10015544 | Ga0075368_100155442 | 338 |
| 11 | 3300006048 | Ga0075363_100014716 | Ga0075363_1000147163 | 338 |
| 12 | 3300006186 | Ga0075369_10000016 | Ga0075369_1000001626 | 338 |
| 13 | 3300006353 | Ga0075370_10000902 | Ga0075370_100009028 | 338 |
| 14 | 3300006880 | Ga0075429_100016270 | Ga0075429_1000162702 | 338 |
| 15 | 3300050491 | nmdc:mga00v17_13237_c1 | nmdc:mga00v17_13237_c1_926_1945 | 338 |
| 16 | 3300050496 | nmdc:mga07m45_115_c1 | nmdc:mga07m45_115_c1_23625_24644 | 338 |
| 17 | 3300050508 | nmdc:mga09592_7835_c1 | nmdc:mga09592_7835_c1_4616_5635 | 338 |
| 18 | 3300050516 | nmdc:mga0sz30_22_c3 | nmdc:mga0sz30_22_c3_23185_24204 | 338 |
| 19 | iso_pu_bacteria | 2734482258 | 2735817798 | 342 |
| 20 | iso_pu_bacteria | 2738543013 | 2739249446 | 343 |
| 21 | 3300005618 | Ga0068864_100245393 | Ga0068864_1002453932 | 346 |
| 22 | 3300005841 | Ga0068863_100057685 | Ga0068863_1000576852 | 346 |
| 23 | 3300006358 | Ga0068871_100004641 | Ga0068871_1000046417 | 346 |
| 24 | 3300009177 | Ga0105248_10039953 | Ga0105248_100399535 | 346 |
| 25 | 3300014325 | Ga0163163_10185397 | Ga0163163_101853972 | 346 |
| 26 | 3300014969 | Ga0157376_10174678 | Ga0157376_101746782 | 346 |
| 27 | 3300017792 | Ga0163161_10040274 | Ga0163161_100402742 | 346 |
| 28 | 3300025940 | Ga0207691_10004308 | Ga0207691_1000430813 | 346 |
| 29 | 3300026088 | Ga0207641_10092470 | Ga0207641_100924702 | 346 |
| 30 | 3300026121 | Ga0207683_10350272 | Ga0207683_103502722 | 346 |
| 31 | 3300045051 | Ga0451576_0000533 | Ga0451576_0000533_71714_72781 | 346 |
| 32 | 3300048912 | Ga0496109_0340921 | Ga0496109_0340921_209_1252 | 346 |
| 33 | 3300048915 | Ga0496112_0002525 | Ga0496112_0002525_4561_5604 | 346 |
| 34 | 3300049459 | Ga0495678_004540 | Ga0495678_004540_4103_5143 | 346 |
| 35 | 3300001991 | JGI24743J22301_10000560 | JGI24743J22301_100005602 | 347 |
| 36 | 3300002459 | JGI24751J29686_10025038 | JGI24751J29686_100250381 | 347 |
| 37 | 3300005290 | Ga0065712_10133776 | Ga0065712_101337761 | 347 |
| 38 | 3300005293 | Ga0065715_10022933 | Ga0065715_100229332 | 347 |
| 39 | 3300005293 | Ga0065715_10154565 | Ga0065715_101545651 | 347 |
| 40 | 3300005328 | Ga0070676_10146558 | Ga0070676_101465582 | 347 |
| 41 | 3300005329 | Ga0070683_100186972 | Ga0070683_1001869721 | 347 |
| 42 | 3300005330 | Ga0070690_100010995 | Ga0070690_1000109953 | 347 |
| 43 | 3300005330 | Ga0070690_100038017 | Ga0070690_1000380172 | 347 |
| 44 | 3300005331 | Ga0070670_100008816 | Ga0070670_1000088167 | 347 |
| 45 | 3300005331 | Ga0070670_100016066 | Ga0070670_1000160662 | 347 |
| 46 | 3300005331 | Ga0070670_100030956 | Ga0070670_1000309562 | 347 |
| 47 | 3300005331 | Ga0070670_100058387 | Ga0070670_1000583874 | 347 |
| 48 | 3300005331 | Ga0070670_100140402 | Ga0070670_1001404022 | 347 |
| 49 | 3300005331 | Ga0070670_100236970 | Ga0070670_1002369701 | 347 |
| 50 | 3300005333 | Ga0070677_10000965 | Ga0070677_100009657 | 347 |
| 51 | 3300005334 | Ga0068869_100000388 | Ga0068869_10000038822 | 347 |
| 52 | 3300005334 | Ga0068869_100004739 | Ga0068869_1000047392 | 347 |
| 53 | 3300005334 | Ga0068869_100061340 | Ga0068869_1000613402 | 347 |
| 54 | 3300005334 | Ga0068869_100092268 | Ga0068869_1000922682 | 347 |
| 55 | 3300005334 | Ga0068869_100123357 | Ga0068869_1001233572 | 347 |
| 56 | 3300005335 | Ga0070666_10008909 | Ga0070666_100089096 | 347 |
| 57 | 3300005335 | Ga0070666_10011788 | Ga0070666_100117882 | 347 |
| 58 | 3300005335 | Ga0070666_10015504 | Ga0070666_100155044 | 347 |
| 59 | 3300005336 | Ga0070680_100028406 | Ga0070680_1000284063 | 347 |
| 60 | 3300005336 | Ga0070680_100049514 | Ga0070680_1000495141 | 347 |
| 61 | 3300005337 | Ga0070682_100013039 | Ga0070682_1000130393 | 347 |
| 62 | 3300005338 | Ga0068868_100008218 | Ga0068868_1000082182 | 347 |
| 63 | 3300005338 | Ga0068868_100092945 | Ga0068868_1000929452 | 347 |
| 64 | 3300005338 | Ga0068868_100203539 | Ga0068868_1002035392 | 347 |
| 65 | 3300005339 | Ga0070660_100000724 | Ga0070660_1000007244 | 347 |
| 66 | 3300005339 | Ga0070660_100046204 | Ga0070660_1000462042 | 347 |
| 67 | 3300005339 | Ga0070660_100091271 | Ga0070660_1000912713 | 347 |
| 68 | 3300005340 | Ga0070689_100005389 | Ga0070689_1000053894 | 347 |
| 69 | 3300005340 | Ga0070689_100011549 | Ga0070689_1000115496 | 347 |
| 70 | 3300005344 | Ga0070661_100005679 | Ga0070661_1000056794 | 347 |
| 71 | 3300005344 | Ga0070661_100044673 | Ga0070661_1000446733 | 347 |
| 72 | 3300005344 | Ga0070661_100051904 | Ga0070661_1000519043 | 347 |
| 73 | 3300005344 | Ga0070661_100179882 | Ga0070661_1001798822 | 347 |
| 74 | 3300005345 | Ga0070692_10033452 | Ga0070692_100334523 | 347 |
| 75 | 3300005347 | Ga0070668_100080818 | Ga0070668_1000808182 | 347 |
| 76 | 3300005347 | Ga0070668_100095387 | Ga0070668_1000953872 | 347 |
| 77 | 3300005353 | Ga0070669_100007605 | Ga0070669_1000076052 | 347 |
| 78 | 3300005353 | Ga0070669_100034047 | Ga0070669_1000340473 | 347 |
| 79 | 3300005354 | Ga0070675_100017223 | Ga0070675_1000172231 | 347 |
| 80 | 3300005354 | Ga0070675_100019261 | Ga0070675_1000192615 | 347 |
| 81 | 3300005355 | Ga0070671_100002250 | Ga0070671_1000022504 | 347 |
| 82 | 3300005355 | Ga0070671_100011370 | Ga0070671_1000113707 | 347 |
| 83 | 3300005355 | Ga0070671_100021571 | Ga0070671_1000215714 | 347 |
| 84 | 3300005355 | Ga0070671_100095960 | Ga0070671_1000959602 | 347 |
| 85 | 3300005356 | Ga0070674_100010956 | Ga0070674_1000109562 | 347 |
| 86 | 3300005356 | Ga0070674_100017868 | Ga0070674_1000178684 | 347 |
| 87 | 3300005356 | Ga0070674_100045323 | Ga0070674_1000453233 | 347 |
| 88 | 3300005364 | Ga0070673_100001204 | Ga0070673_10000120411 | 347 |
| 89 | 3300005364 | Ga0070673_100002674 | Ga0070673_1000026748 | 347 |
| 90 | 3300005364 | Ga0070673_100007406 | Ga0070673_1000074067 | 347 |
| 91 | 3300005364 | Ga0070673_100020203 | Ga0070673_1000202034 | 347 |
| 92 | 3300005364 | Ga0070673_100028019 | Ga0070673_1000280194 | 347 |
| 93 | 3300005364 | Ga0070673_100155620 | Ga0070673_1001556202 | 347 |
| 94 | 3300005364 | Ga0070673_100184859 | Ga0070673_1001848591 | 347 |
| 95 | 3300005365 | Ga0070688_100002928 | Ga0070688_1000029284 | 347 |
| 96 | 3300005365 | Ga0070688_100038475 | Ga0070688_1000384751 | 347 |
| 97 | 3300005366 | Ga0070659_100051079 | Ga0070659_1000510792 | 347 |
| 98 | 3300005367 | Ga0070667_100000550 | Ga0070667_1000005506 | 347 |
| 99 | 3300005367 | Ga0070667_100006019 | Ga0070667_1000060197 | 347 |
| 100 | 3300005367 | Ga0070667_100030235 | Ga0070667_1000302353 | 347 |
| 101 | 3300005367 | Ga0070667_100040058 | Ga0070667_1000400585 | 347 |
| 102 | 3300005367 | Ga0070667_100048324 | Ga0070667_1000483244 | 347 |
| 103 | 3300005367 | Ga0070667_100079338 | Ga0070667_1000793382 | 347 |
| 104 | 3300005367 | Ga0070667_100166943 | Ga0070667_1001669432 | 347 |
| 105 | 3300005435 | Ga0070714_100042391 | Ga0070714_1000423913 | 347 |
| 106 | 3300005435 | Ga0070714_100079380 | Ga0070714_1000793802 | 347 |
| 107 | 3300005435 | Ga0070714_100088262 | Ga0070714_1000882623 | 347 |
| 108 | 3300005436 | Ga0070713_100003475 | Ga0070713_1000034752 | 347 |
| 109 | 3300005437 | Ga0070710_10020640 | Ga0070710_100206402 | 347 |
| 110 | 3300005438 | Ga0070701_10031766 | Ga0070701_100317661 | 347 |
| 111 | 3300005439 | Ga0070711_100011287 | Ga0070711_1000112875 | 347 |
| 112 | 3300005439 | Ga0070711_100025712 | Ga0070711_1000257125 | 347 |
| 113 | 3300005439 | Ga0070711_100126750 | Ga0070711_1001267502 | 347 |
| 114 | 3300005440 | Ga0070705_100009362 | Ga0070705_1000093624 | 347 |
| 115 | 3300005441 | Ga0070700_100005867 | Ga0070700_1000058674 | 347 |
| 116 | 3300005441 | Ga0070700_100100159 | Ga0070700_1001001591 | 347 |
| 117 | 3300005444 | Ga0070694_100037288 | Ga0070694_1000372882 | 347 |
| 118 | 3300005455 | Ga0070663_100004359 | Ga0070663_1000043593 | 347 |
| 119 | 3300005455 | Ga0070663_100027453 | Ga0070663_1000274534 | 347 |
| 120 | 3300005455 | Ga0070663_100074319 | Ga0070663_1000743192 | 347 |
| 121 | 3300005455 | Ga0070663_100302106 | Ga0070663_1003021062 | 347 |
| 122 | 3300005456 | Ga0070678_100015662 | Ga0070678_1000156624 | 347 |
| 123 | 3300005456 | Ga0070678_100042143 | Ga0070678_1000421434 | 347 |
| 124 | 3300005457 | Ga0070662_100001938 | Ga0070662_1000019384 | 347 |
| 125 | 3300005458 | Ga0070681_10090964 | Ga0070681_100909643 | 347 |
| 126 | 3300005458 | Ga0070681_10264312 | Ga0070681_102643122 | 347 |
| 127 | 3300005459 | Ga0068867_100061910 | Ga0068867_1000619102 | 347 |
| 128 | 3300005459 | Ga0068867_100071110 | Ga0068867_1000711102 | 347 |
| 129 | 3300005459 | Ga0068867_100108535 | Ga0068867_1001085352 | 347 |
| 130 | 3300005459 | Ga0068867_100312759 | Ga0068867_1003127591 | 347 |
| 131 | 3300005466 | Ga0070685_10006996 | Ga0070685_100069966 | 347 |
| 132 | 3300005467 | Ga0070706_100014759 | Ga0070706_1000147594 | 347 |
| 133 | 3300005468 | Ga0070707_100310577 | Ga0070707_1003105772 | 347 |
| 134 | 3300005471 | Ga0070698_100195516 | Ga0070698_1001955162 | 347 |
| 135 | 3300005518 | Ga0070699_100027023 | Ga0070699_1000270235 | 347 |
| 136 | 3300005518 | Ga0070699_100065339 | Ga0070699_1000653393 | 347 |
| 137 | 3300005530 | Ga0070679_100020307 | Ga0070679_1000203076 | 347 |
| 138 | 3300005530 | Ga0070679_100159735 | Ga0070679_1001597352 | 347 |
| 139 | 3300005530 | Ga0070679_100173662 | Ga0070679_1001736622 | 347 |
| 140 | 3300005530 | Ga0070679_100207679 | Ga0070679_1002076791 | 347 |
| 141 | 3300005535 | Ga0070684_100023537 | Ga0070684_1000235373 | 347 |
| 142 | 3300005535 | Ga0070684_100077446 | Ga0070684_1000774462 | 347 |
| 143 | 3300005539 | Ga0068853_100011739 | Ga0068853_1000117396 | 347 |
| 144 | 3300005539 | Ga0068853_100162791 | Ga0068853_1001627912 | 347 |
| 145 | 3300005543 | Ga0070672_100003013 | Ga0070672_1000030139 | 347 |
| 146 | 3300005543 | Ga0070672_100004327 | Ga0070672_1000043274 | 347 |
| 147 | 3300005543 | Ga0070672_100039857 | Ga0070672_1000398572 | 347 |
| 148 | 3300005543 | Ga0070672_100080428 | Ga0070672_1000804282 | 347 |
| 149 | 3300005544 | Ga0070686_100303611 | Ga0070686_1003036111 | 347 |
| 150 | 3300005545 | Ga0070695_100066089 | Ga0070695_1000660892 | 347 |
| 151 | 3300005545 | Ga0070695_100080938 | Ga0070695_1000809381 | 347 |
| 152 | 3300005546 | Ga0070696_100033332 | Ga0070696_1000333322 | 347 |
| 153 | 3300005546 | Ga0070696_100140652 | Ga0070696_1001406522 | 347 |
| 154 | 3300005547 | Ga0070693_100000167 | Ga0070693_1000001674 | 347 |
| 155 | 3300005548 | Ga0070665_100005172 | Ga0070665_1000051722 | 347 |
| 156 | 3300005548 | Ga0070665_100361180 | Ga0070665_1003611802 | 347 |
| 157 | 3300005549 | Ga0070704_100045665 | Ga0070704_1000456652 | 347 |
| 158 | 3300005549 | Ga0070704_100102194 | Ga0070704_1001021942 | 347 |
| 159 | 3300005549 | Ga0070704_100130031 | Ga0070704_1001300312 | 347 |
| 160 | 3300005563 | Ga0068855_100001160 | Ga0068855_10000116023 | 347 |
| 161 | 3300005563 | Ga0068855_100040381 | Ga0068855_1000403812 | 347 |
| 162 | 3300005563 | Ga0068855_100118510 | Ga0068855_1001185103 | 347 |
| 163 | 3300005563 | Ga0068855_100129707 | Ga0068855_1001297073 | 347 |
| 164 | 3300005564 | Ga0070664_100000955 | Ga0070664_10000095514 | 347 |
| 165 | 3300005564 | Ga0070664_100006174 | Ga0070664_1000061743 | 347 |
| 166 | 3300005564 | Ga0070664_100031002 | Ga0070664_1000310024 | 347 |
| 167 | 3300005564 | Ga0070664_100039768 | Ga0070664_1000397684 | 347 |
| 168 | 3300005564 | Ga0070664_100039893 | Ga0070664_1000398934 | 347 |
| 169 | 3300005564 | Ga0070664_100103815 | Ga0070664_1001038153 | 347 |
| 170 | 3300005577 | Ga0068857_100001623 | Ga0068857_10000162310 | 347 |
| 171 | 3300005577 | Ga0068857_100044533 | Ga0068857_1000445332 | 347 |
| 172 | 3300005578 | Ga0068854_100002132 | Ga0068854_1000021324 | 347 |
| 173 | 3300005578 | Ga0068854_100047083 | Ga0068854_1000470832 | 347 |
| 174 | 3300005578 | Ga0068854_100067228 | Ga0068854_1000672282 | 347 |
| 175 | 3300005614 | Ga0068856_100001343 | Ga0068856_10000134323 | 347 |
| 176 | 3300005614 | Ga0068856_100001396 | Ga0068856_10000139610 | 347 |
| 177 | 3300005614 | Ga0068856_100009881 | Ga0068856_1000098814 | 347 |
| 178 | 3300005615 | Ga0070702_100137189 | Ga0070702_1001371892 | 347 |
| 179 | 3300005616 | Ga0068852_100011854 | Ga0068852_1000118546 | 347 |
| 180 | 3300005616 | Ga0068852_100064651 | Ga0068852_1000646512 | 347 |
| 181 | 3300005616 | Ga0068852_100164288 | Ga0068852_1001642882 | 347 |
| 182 | 3300005616 | Ga0068852_100300513 | Ga0068852_1003005132 | 347 |
| 183 | 3300005617 | Ga0068859_100001484 | Ga0068859_10000148415 | 347 |
| 184 | 3300005617 | Ga0068859_100009886 | Ga0068859_1000098864 | 347 |
| 185 | 3300005617 | Ga0068859_100021747 | Ga0068859_1000217478 | 347 |
| 186 | 3300005617 | Ga0068859_100202970 | Ga0068859_1002029702 | 347 |
| 187 | 3300005618 | Ga0068864_100000938 | Ga0068864_1000009384 | 347 |
| 188 | 3300005618 | Ga0068864_100002372 | Ga0068864_1000023727 | 347 |
| 189 | 3300005618 | Ga0068864_100009418 | Ga0068864_1000094186 | 347 |
| 190 | 3300005618 | Ga0068864_100034190 | Ga0068864_1000341902 | 347 |
| 191 | 3300005618 | Ga0068864_100057543 | Ga0068864_1000575433 | 347 |
| 192 | 3300005618 | Ga0068864_100066222 | Ga0068864_1000662223 | 347 |
| 193 | 3300005718 | Ga0068866_10004687 | Ga0068866_100046872 | 347 |
| 194 | 3300005719 | Ga0068861_100000187 | Ga0068861_1000001875 | 347 |
| 195 | 3300005719 | Ga0068861_100056293 | Ga0068861_1000562932 | 347 |
| 196 | 3300005834 | Ga0068851_10000301 | Ga0068851_100003015 | 347 |
| 197 | 3300005834 | Ga0068851_10001932 | Ga0068851_100019323 | 347 |
| 198 | 3300005834 | Ga0068851_10006560 | Ga0068851_100065602 | 347 |
| 199 | 3300005834 | Ga0068851_10058913 | Ga0068851_100589132 | 347 |
| 200 | 3300005840 | Ga0068870_10008825 | Ga0068870_100088252 | 347 |
| 201 | 3300005840 | Ga0068870_10043989 | Ga0068870_100439892 | 347 |
| 202 | 3300005840 | Ga0068870_10044754 | Ga0068870_100447542 | 347 |
| 203 | 3300005841 | Ga0068863_100001021 | Ga0068863_10000102117 | 347 |
| 204 | 3300005841 | Ga0068863_100006037 | Ga0068863_1000060379 | 347 |
| 205 | 3300005841 | Ga0068863_100010703 | Ga0068863_1000107037 | 347 |
| 206 | 3300005841 | Ga0068863_100034540 | Ga0068863_1000345404 | 347 |
| 207 | 3300005841 | Ga0068863_100052190 | Ga0068863_1000521904 | 347 |
| 208 | 3300005841 | Ga0068863_100105364 | Ga0068863_1001053642 | 347 |
| 209 | 3300005842 | Ga0068858_100008319 | Ga0068858_1000083192 | 347 |
| 210 | 3300005842 | Ga0068858_100018888 | Ga0068858_1000188887 | 347 |
| 211 | 3300005842 | Ga0068858_100028369 | Ga0068858_1000283692 | 347 |
| 212 | 3300005842 | Ga0068858_100082962 | Ga0068858_1000829622 | 347 |
| 213 | 3300005842 | Ga0068858_100093112 | Ga0068858_1000931123 | 347 |
| 214 | 3300005843 | Ga0068860_100011724 | Ga0068860_1000117247 | 347 |
| 215 | 3300005843 | Ga0068860_100015024 | Ga0068860_1000150246 | 347 |
| 216 | 3300005843 | Ga0068860_100038316 | Ga0068860_1000383162 | 347 |
| 217 | 3300005843 | Ga0068860_100053521 | Ga0068860_1000535212 | 347 |
| 218 | 3300005843 | Ga0068860_100111924 | Ga0068860_1001119243 | 347 |
| 219 | 3300005843 | Ga0068860_100211272 | Ga0068860_1002112722 | 347 |
| 220 | 3300005844 | Ga0068862_100005987 | Ga0068862_1000059878 | 347 |
| 221 | 3300005844 | Ga0068862_100032015 | Ga0068862_1000320154 | 347 |
| 222 | 3300005937 | Ga0081455_10099650 | Ga0081455_100996503 | 347 |
| 223 | 3300006038 | Ga0075365_10085718 | Ga0075365_100857182 | 347 |
| 224 | 3300006042 | Ga0075368_10002914 | Ga0075368_100029144 | 347 |
| 225 | 3300006048 | Ga0075363_100000471 | Ga0075363_10000047111 | 347 |
| 226 | 3300006173 | Ga0070716_100050706 | Ga0070716_1000507062 | 347 |
| 227 | 3300006175 | Ga0070712_100041403 | Ga0070712_1000414032 | 347 |
| 228 | 3300006175 | Ga0070712_100114798 | Ga0070712_1001147982 | 347 |
| 229 | 3300006175 | Ga0070712_100374529 | Ga0070712_1003745292 | 347 |
| 230 | 3300006177 | Ga0075362_10072296 | Ga0075362_100722962 | 347 |
| 231 | 3300006178 | Ga0075367_10008151 | Ga0075367_100081513 | 347 |
| 232 | 3300006186 | Ga0075369_10004576 | Ga0075369_100045766 | 347 |
| 233 | 3300006186 | Ga0075369_10087758 | Ga0075369_100877582 | 347 |
| 234 | 3300006195 | Ga0075366_10022972 | Ga0075366_100229722 | 347 |
| 235 | 3300006195 | Ga0075366_10056058 | Ga0075366_100560582 | 347 |
| 236 | 3300006195 | Ga0075366_10068686 | Ga0075366_100686861 | 347 |
| 237 | 3300006237 | Ga0097621_100009045 | Ga0097621_1000090456 | 347 |
| 238 | 3300006237 | Ga0097621_100022190 | Ga0097621_1000221902 | 347 |
| 239 | 3300006237 | Ga0097621_100059498 | Ga0097621_1000594983 | 347 |
| 240 | 3300006237 | Ga0097621_100282452 | Ga0097621_1002824522 | 347 |
| 241 | 3300006353 | Ga0075370_10004770 | Ga0075370_100047706 | 347 |
| 242 | 3300006358 | Ga0068871_100038217 | Ga0068871_1000382173 | 347 |
| 243 | 3300006358 | Ga0068871_100042837 | Ga0068871_1000428372 | 347 |
| 244 | 3300006358 | Ga0068871_100048109 | Ga0068871_1000481093 | 347 |
| 245 | 3300006844 | Ga0075428_100033734 | Ga0075428_1000337344 | 347 |
| 246 | 3300006871 | Ga0075434_100176274 | Ga0075434_1001762742 | 347 |
| 247 | 3300006871 | Ga0075434_100412958 | Ga0075434_1004129582 | 347 |
| 248 | 3300006881 | Ga0068865_100003642 | Ga0068865_1000036426 | 347 |
| 249 | 3300006881 | Ga0068865_100010571 | Ga0068865_1000105714 | 347 |
| 250 | 3300006881 | Ga0068865_100025208 | Ga0068865_1000252082 | 347 |
| 251 | 3300006931 | Ga0097620_100001484 | Ga0097620_1000014849 | 347 |
| 252 | 3300006931 | Ga0097620_100009886 | Ga0097620_1000098864 | 347 |
| 253 | 3300006931 | Ga0097620_100021748 | Ga0097620_1000217488 | 347 |
| 254 | 3300006931 | Ga0097620_100202978 | Ga0097620_1002029782 | 347 |
| 255 | 3300009093 | Ga0105240_10130883 | Ga0105240_101308833 | 347 |
| 256 | 3300009093 | Ga0105240_10229732 | Ga0105240_102297322 | 347 |
| 257 | 3300009094 | Ga0111539_10013246 | Ga0111539_100132464 | 347 |
| 258 | 3300009098 | Ga0105245_10008101 | Ga0105245_100081018 | 347 |
| 259 | 3300009098 | Ga0105245_10012549 | Ga0105245_100125494 | 347 |
| 260 | 3300009098 | Ga0105245_10038293 | Ga0105245_100382934 | 347 |
| 261 | 3300009101 | Ga0105247_10012360 | Ga0105247_100123604 | 347 |
| 262 | 3300009101 | Ga0105247_10050405 | Ga0105247_100504053 | 347 |
| 263 | 3300009147 | Ga0114129_10134553 | Ga0114129_101345534 | 347 |
| 264 | 3300009147 | Ga0114129_10521429 | Ga0114129_105214292 | 347 |
| 265 | 3300009148 | Ga0105243_10038645 | Ga0105243_100386453 | 347 |
| 266 | 3300009148 | Ga0105243_10342041 | Ga0105243_103420412 | 347 |
| 267 | 3300009174 | Ga0105241_10064713 | Ga0105241_100647132 | 347 |
| 268 | 3300009174 | Ga0105241_10229549 | Ga0105241_102295492 | 347 |
| 269 | 3300009176 | Ga0105242_10004238 | Ga0105242_100042382 | 347 |
| 270 | 3300009176 | Ga0105242_10107031 | Ga0105242_101070311 | 347 |
| 271 | 3300009177 | Ga0105248_10010030 | Ga0105248_100100305 | 347 |
| 272 | 3300009177 | Ga0105248_10019096 | Ga0105248_100190963 | 347 |
| 273 | 3300009177 | Ga0105248_10031986 | Ga0105248_100319861 | 347 |
| 274 | 3300009177 | Ga0105248_10104876 | Ga0105248_101048763 | 347 |
| 275 | 3300009177 | Ga0105248_10187291 | Ga0105248_101872912 | 347 |
| 276 | 3300009545 | Ga0105237_10132236 | Ga0105237_101322363 | 347 |
| 277 | 3300010375 | Ga0105239_10105346 | Ga0105239_101053463 | 347 |
| 278 | 3300011119 | Ga0105246_10120338 | Ga0105246_101203382 | 347 |
| 279 | 3300011119 | Ga0105246_10137324 | Ga0105246_101373242 | 347 |
| 280 | 3300011119 | Ga0105246_10153983 | Ga0105246_101539832 | 347 |
| 281 | 3300013100 | Ga0157373_10000447 | Ga0157373_1000044716 | 347 |
| 282 | 3300013100 | Ga0157373_10107452 | Ga0157373_101074522 | 347 |
| 283 | 3300013102 | Ga0157371_10001482 | Ga0157371_1000148216 | 347 |
| 284 | 3300013104 | Ga0157370_10003331 | Ga0157370_1000333117 | 347 |
| 285 | 3300013104 | Ga0157370_10026443 | Ga0157370_100264433 | 347 |
| 286 | 3300013104 | Ga0157370_10037106 | Ga0157370_100371063 | 347 |
| 287 | 3300013104 | Ga0157370_10091638 | Ga0157370_100916382 | 347 |
| 288 | 3300013104 | Ga0157370_10141901 | Ga0157370_101419012 | 347 |
| 289 | 3300013105 | Ga0157369_10046834 | Ga0157369_100468343 | 347 |
| 290 | 3300013296 | Ga0157374_10000170 | Ga0157374_1000017020 | 347 |
| 291 | 3300013296 | Ga0157374_10021298 | Ga0157374_100212984 | 347 |
| 292 | 3300013296 | Ga0157374_10146710 | Ga0157374_101467103 | 347 |
| 293 | 3300013296 | Ga0157374_10190292 | Ga0157374_101902921 | 347 |
| 294 | 3300013297 | Ga0157378_10003627 | Ga0157378_1000362712 | 347 |
| 295 | 3300013297 | Ga0157378_10008577 | Ga0157378_100085775 | 347 |
| 296 | 3300013297 | Ga0157378_10023714 | Ga0157378_100237144 | 347 |
| 297 | 3300013297 | Ga0157378_10060219 | Ga0157378_100602193 | 347 |
| 298 | 3300013306 | Ga0163162_10011501 | Ga0163162_100115014 | 347 |
| 299 | 3300013306 | Ga0163162_10048032 | Ga0163162_100480322 | 347 |
| 300 | 3300013306 | Ga0163162_10113072 | Ga0163162_101130723 | 347 |
| 301 | 3300013306 | Ga0163162_10198673 | Ga0163162_101986732 | 347 |
| 302 | 3300013307 | Ga0157372_10004508 | Ga0157372_100045086 | 347 |
| 303 | 3300013307 | Ga0157372_10337826 | Ga0157372_103378262 | 347 |
| 304 | 3300013308 | Ga0157375_10002885 | Ga0157375_100028853 | 347 |
| 305 | 3300013308 | Ga0157375_10009095 | Ga0157375_100090953 | 347 |
| 306 | 3300013308 | Ga0157375_10225266 | Ga0157375_102252662 | 347 |
| 307 | 3300013308 | Ga0157375_10361254 | Ga0157375_103612542 | 347 |
| 308 | 3300014325 | Ga0163163_10006684 | Ga0163163_100066844 | 347 |
| 309 | 3300014325 | Ga0163163_10009220 | Ga0163163_100092206 | 347 |
| 310 | 3300014325 | Ga0163163_10029291 | Ga0163163_100292915 | 347 |
| 311 | 3300014325 | Ga0163163_10154655 | Ga0163163_101546551 | 347 |
| 312 | 3300014968 | Ga0157379_10002047 | Ga0157379_100020473 | 347 |
| 313 | 3300014968 | Ga0157379_10004185 | Ga0157379_100041859 | 347 |
| 314 | 3300014968 | Ga0157379_10029917 | Ga0157379_100299173 | 347 |
| 315 | 3300014968 | Ga0157379_10062732 | Ga0157379_100627323 | 347 |
| 316 | 3300017792 | Ga0163161_10047214 | Ga0163161_100472143 | 347 |
| 317 | 3300025315 | Ga0207697_10000594 | Ga0207697_1000059420 | 347 |
| 318 | 3300025315 | Ga0207697_10068683 | Ga0207697_100686832 | 347 |
| 319 | 3300025893 | Ga0207682_10000556 | Ga0207682_1000055618 | 347 |
| 320 | 3300025898 | Ga0207692_10016570 | Ga0207692_100165703 | 347 |
| 321 | 3300025898 | Ga0207692_10139326 | Ga0207692_101393262 | 347 |
| 322 | 3300025899 | Ga0207642_10002368 | Ga0207642_100023687 | 347 |
| 323 | 3300025899 | Ga0207642_10058191 | Ga0207642_100581912 | 347 |
| 324 | 3300025900 | Ga0207710_10021920 | Ga0207710_100219203 | 347 |
| 325 | 3300025900 | Ga0207710_10085980 | Ga0207710_100859802 | 347 |
| 326 | 3300025901 | Ga0207688_10003876 | Ga0207688_100038764 | 347 |
| 327 | 3300025901 | Ga0207688_10170265 | Ga0207688_101702652 | 347 |
| 328 | 3300025903 | Ga0207680_10006648 | Ga0207680_100066482 | 347 |
| 329 | 3300025903 | Ga0207680_10075481 | Ga0207680_100754812 | 347 |
| 330 | 3300025906 | Ga0207699_10038666 | Ga0207699_100386663 | 347 |
| 331 | 3300025906 | Ga0207699_10045973 | Ga0207699_100459733 | 347 |
| 332 | 3300025907 | Ga0207645_10003500 | Ga0207645_1000350011 | 347 |
| 333 | 3300025907 | Ga0207645_10004486 | Ga0207645_100044862 | 347 |
| 334 | 3300025907 | Ga0207645_10024033 | Ga0207645_100240334 | 347 |
| 335 | 3300025907 | Ga0207645_10185079 | Ga0207645_101850791 | 347 |
| 336 | 3300025908 | Ga0207643_10000610 | Ga0207643_100006109 | 347 |
| 337 | 3300025908 | Ga0207643_10019765 | Ga0207643_100197652 | 347 |
| 338 | 3300025908 | Ga0207643_10035144 | Ga0207643_100351443 | 347 |
| 339 | 3300025908 | Ga0207643_10061540 | Ga0207643_100615402 | 347 |
| 340 | 3300025910 | Ga0207684_10120923 | Ga0207684_101209232 | 347 |
| 341 | 3300025912 | Ga0207707_10082322 | Ga0207707_100823222 | 347 |
| 342 | 3300025912 | Ga0207707_10370517 | Ga0207707_103705172 | 347 |
| 343 | 3300025914 | Ga0207671_10074580 | Ga0207671_100745802 | 347 |
| 344 | 3300025915 | Ga0207693_10002176 | Ga0207693_100021765 | 347 |
| 345 | 3300025915 | Ga0207693_10012772 | Ga0207693_100127724 | 347 |
| 346 | 3300025915 | Ga0207693_10015681 | Ga0207693_100156814 | 347 |
| 347 | 3300025915 | Ga0207693_10345568 | Ga0207693_103455681 | 347 |
| 348 | 3300025916 | Ga0207663_10058199 | Ga0207663_100581993 | 347 |
| 349 | 3300025916 | Ga0207663_10088103 | Ga0207663_100881032 | 347 |
| 350 | 3300025917 | Ga0207660_10183717 | Ga0207660_101837172 | 347 |
| 351 | 3300025918 | Ga0207662_10014389 | Ga0207662_100143894 | 347 |
| 352 | 3300025918 | Ga0207662_10045539 | Ga0207662_100455392 | 347 |
| 353 | 3300025919 | Ga0207657_10000371 | Ga0207657_1000037141 | 347 |
| 354 | 3300025919 | Ga0207657_10012827 | Ga0207657_100128273 | 347 |
| 355 | 3300025919 | Ga0207657_10021571 | Ga0207657_100215713 | 347 |
| 356 | 3300025919 | Ga0207657_10046523 | Ga0207657_100465234 | 347 |
| 357 | 3300025919 | Ga0207657_10237633 | Ga0207657_102376332 | 347 |
| 358 | 3300025920 | Ga0207649_10027946 | Ga0207649_100279463 | 347 |
| 359 | 3300025921 | Ga0207652_10014079 | Ga0207652_100140792 | 347 |
| 360 | 3300025921 | Ga0207652_10236799 | Ga0207652_102367992 | 347 |
| 361 | 3300025922 | Ga0207646_10429260 | Ga0207646_104292602 | 347 |
| 362 | 3300025923 | Ga0207681_10007075 | Ga0207681_100070752 | 347 |
| 363 | 3300025923 | Ga0207681_10059152 | Ga0207681_100591521 | 347 |
| 364 | 3300025924 | Ga0207694_10101301 | Ga0207694_101013012 | 347 |
| 365 | 3300025925 | Ga0207650_10005168 | Ga0207650_100051687 | 347 |
| 366 | 3300025925 | Ga0207650_10030680 | Ga0207650_100306803 | 347 |
| 367 | 3300025925 | Ga0207650_10099096 | Ga0207650_100990962 | 347 |
| 368 | 3300025925 | Ga0207650_10123134 | Ga0207650_101231341 | 347 |
| 369 | 3300025925 | Ga0207650_10247559 | Ga0207650_102475591 | 347 |
| 370 | 3300025926 | Ga0207659_10100131 | Ga0207659_101001312 | 347 |
| 371 | 3300025926 | Ga0207659_10148802 | Ga0207659_101488021 | 347 |
| 372 | 3300025927 | Ga0207687_10001668 | Ga0207687_100016687 | 347 |
| 373 | 3300025927 | Ga0207687_10022739 | Ga0207687_100227393 | 347 |
| 374 | 3300025928 | Ga0207700_10009580 | Ga0207700_100095802 | 347 |
| 375 | 3300025928 | Ga0207700_10049833 | Ga0207700_100498332 | 347 |
| 376 | 3300025929 | Ga0207664_10001654 | Ga0207664_100016547 | 347 |
| 377 | 3300025929 | Ga0207664_10041934 | Ga0207664_100419342 | 347 |
| 378 | 3300025929 | Ga0207664_10071655 | Ga0207664_100716552 | 347 |
| 379 | 3300025931 | Ga0207644_10014130 | Ga0207644_100141304 | 347 |
| 380 | 3300025931 | Ga0207644_10018123 | Ga0207644_100181232 | 347 |
| 381 | 3300025931 | Ga0207644_10018467 | Ga0207644_100184673 | 347 |
| 382 | 3300025931 | Ga0207644_10074707 | Ga0207644_100747072 | 347 |
| 383 | 3300025932 | Ga0207690_10004056 | Ga0207690_100040566 | 347 |
| 384 | 3300025932 | Ga0207690_10048997 | Ga0207690_100489973 | 347 |
| 385 | 3300025933 | Ga0207706_10003193 | Ga0207706_1000319310 | 347 |
| 386 | 3300025933 | Ga0207706_10014297 | Ga0207706_100142973 | 347 |
| 387 | 3300025933 | Ga0207706_10027259 | Ga0207706_100272594 | 347 |
| 388 | 3300025934 | Ga0207686_10000198 | Ga0207686_100001989 | 347 |
| 389 | 3300025935 | Ga0207709_10064075 | Ga0207709_100640752 | 347 |
| 390 | 3300025936 | Ga0207670_10069615 | Ga0207670_100696152 | 347 |
| 391 | 3300025936 | Ga0207670_10134608 | Ga0207670_101346082 | 347 |
| 392 | 3300025937 | Ga0207669_10009461 | Ga0207669_100094613 | 347 |
| 393 | 3300025937 | Ga0207669_10013482 | Ga0207669_100134824 | 347 |
| 394 | 3300025937 | Ga0207669_10025058 | Ga0207669_100250583 | 347 |
| 395 | 3300025938 | Ga0207704_10028451 | Ga0207704_100284513 | 347 |
| 396 | 3300025938 | Ga0207704_10036295 | Ga0207704_100362954 | 347 |
| 397 | 3300025939 | Ga0207665_10014015 | Ga0207665_100140152 | 347 |
| 398 | 3300025939 | Ga0207665_10043053 | Ga0207665_100430532 | 347 |
| 399 | 3300025940 | Ga0207691_10000006 | Ga0207691_1000000617 | 347 |
| 400 | 3300025940 | Ga0207691_10003579 | Ga0207691_1000357912 | 347 |
| 401 | 3300025940 | Ga0207691_10004159 | Ga0207691_100041597 | 347 |
| 402 | 3300025940 | Ga0207691_10009490 | Ga0207691_100094906 | 347 |
| 403 | 3300025940 | Ga0207691_10013381 | Ga0207691_100133812 | 347 |
| 404 | 3300025940 | Ga0207691_10043503 | Ga0207691_100435033 | 347 |
| 405 | 3300025940 | Ga0207691_10073185 | Ga0207691_100731851 | 347 |
| 406 | 3300025940 | Ga0207691_10116874 | Ga0207691_101168742 | 347 |
| 407 | 3300025941 | Ga0207711_10003428 | Ga0207711_1000342811 | 347 |
| 408 | 3300025941 | Ga0207711_10004968 | Ga0207711_1000496810 | 347 |
| 409 | 3300025941 | Ga0207711_10095093 | Ga0207711_100950932 | 347 |
| 410 | 3300025942 | Ga0207689_10000042 | Ga0207689_1000004286 | 347 |
| 411 | 3300025942 | Ga0207689_10004105 | Ga0207689_1000410513 | 347 |
| 412 | 3300025942 | Ga0207689_10005585 | Ga0207689_1000558512 | 347 |
| 413 | 3300025942 | Ga0207689_10008507 | Ga0207689_100085074 | 347 |
| 414 | 3300025942 | Ga0207689_10040648 | Ga0207689_100406483 | 347 |
| 415 | 3300025944 | Ga0207661_10036439 | Ga0207661_100364392 | 347 |
| 416 | 3300025945 | Ga0207679_10001683 | Ga0207679_100016834 | 347 |
| 417 | 3300025945 | Ga0207679_10012878 | Ga0207679_100128784 | 347 |
| 418 | 3300025945 | Ga0207679_10022820 | Ga0207679_100228202 | 347 |
| 419 | 3300025945 | Ga0207679_10032598 | Ga0207679_100325984 | 347 |
| 420 | 3300025945 | Ga0207679_10086697 | Ga0207679_100866973 | 347 |
| 421 | 3300025945 | Ga0207679_10154821 | Ga0207679_101548212 | 347 |
| 422 | 3300025949 | Ga0207667_10003619 | Ga0207667_100036196 | 347 |
| 423 | 3300025949 | Ga0207667_10044359 | Ga0207667_100443595 | 347 |
| 424 | 3300025949 | Ga0207667_10068970 | Ga0207667_100689701 | 347 |
| 425 | 3300025949 | Ga0207667_10178312 | Ga0207667_101783122 | 347 |
| 426 | 3300025960 | Ga0207651_10001393 | Ga0207651_100013934 | 347 |
| 427 | 3300025960 | Ga0207651_10028614 | Ga0207651_100286142 | 347 |
| 428 | 3300025960 | Ga0207651_10068222 | Ga0207651_100682223 | 347 |
| 429 | 3300025960 | Ga0207651_10122548 | Ga0207651_101225483 | 347 |
| 430 | 3300025972 | Ga0207668_10009587 | Ga0207668_100095875 | 347 |
| 431 | 3300025972 | Ga0207668_10037112 | Ga0207668_100371123 | 347 |
| 432 | 3300025972 | Ga0207668_10124429 | Ga0207668_101244292 | 347 |
| 433 | 3300025981 | Ga0207640_10020279 | Ga0207640_100202792 | 347 |
| 434 | 3300025981 | Ga0207640_10062757 | Ga0207640_100627572 | 347 |
| 435 | 3300025981 | Ga0207640_10148844 | Ga0207640_101488442 | 347 |
| 436 | 3300025981 | Ga0207640_10294478 | Ga0207640_102944782 | 347 |
| 437 | 3300025986 | Ga0207658_10006384 | Ga0207658_100063847 | 347 |
| 438 | 3300025986 | Ga0207658_10010407 | Ga0207658_100104071 | 347 |
| 439 | 3300025986 | Ga0207658_10051451 | Ga0207658_100514512 | 347 |
| 440 | 3300025986 | Ga0207658_10073152 | Ga0207658_100731522 | 347 |
| 441 | 3300025986 | Ga0207658_10093581 | Ga0207658_100935812 | 347 |
| 442 | 3300025986 | Ga0207658_10171676 | Ga0207658_101716762 | 347 |
| 443 | 3300025986 | Ga0207658_10232392 | Ga0207658_102323922 | 347 |
| 444 | 3300025986 | Ga0207658_10361530 | Ga0207658_103615302 | 347 |
| 445 | 3300026023 | Ga0207677_10000799 | Ga0207677_100007997 | 347 |
| 446 | 3300026023 | Ga0207677_10269557 | Ga0207677_102695571 | 347 |
| 447 | 3300026035 | Ga0207703_10000143 | Ga0207703_100001437 | 347 |
| 448 | 3300026035 | Ga0207703_10009453 | Ga0207703_100094534 | 347 |
| 449 | 3300026035 | Ga0207703_10042736 | Ga0207703_100427362 | 347 |
| 450 | 3300026035 | Ga0207703_10049361 | Ga0207703_100493613 | 347 |
| 451 | 3300026035 | Ga0207703_10066887 | Ga0207703_100668872 | 347 |
| 452 | 3300026035 | Ga0207703_10109175 | Ga0207703_101091752 | 347 |
| 453 | 3300026041 | Ga0207639_10024584 | Ga0207639_100245844 | 347 |
| 454 | 3300026041 | Ga0207639_10131012 | Ga0207639_101310121 | 347 |
| 455 | 3300026041 | Ga0207639_10227959 | Ga0207639_102279592 | 347 |
| 456 | 3300026067 | Ga0207678_10009805 | Ga0207678_100098057 | 347 |
| 457 | 3300026067 | Ga0207678_10022877 | Ga0207678_100228772 | 347 |
| 458 | 3300026067 | Ga0207678_10034156 | Ga0207678_100341562 | 347 |
| 459 | 3300026067 | Ga0207678_10117246 | Ga0207678_101172462 | 347 |
| 460 | 3300026067 | Ga0207678_10202717 | Ga0207678_102027172 | 347 |
| 461 | 3300026078 | Ga0207702_10003083 | Ga0207702_100030838 | 347 |
| 462 | 3300026078 | Ga0207702_10021898 | Ga0207702_100218986 | 347 |
| 463 | 3300026088 | Ga0207641_10007742 | Ga0207641_100077428 | 347 |
| 464 | 3300026088 | Ga0207641_10009450 | Ga0207641_100094504 | 347 |
| 465 | 3300026088 | Ga0207641_10023159 | Ga0207641_100231593 | 347 |
| 466 | 3300026089 | Ga0207648_10002730 | Ga0207648_1000273016 | 347 |
| 467 | 3300026089 | Ga0207648_10010928 | Ga0207648_100109286 | 347 |
| 468 | 3300026089 | Ga0207648_10050141 | Ga0207648_100501415 | 347 |
| 469 | 3300026089 | Ga0207648_10065770 | Ga0207648_100657702 | 347 |
| 470 | 3300026089 | Ga0207648_10130003 | Ga0207648_101300032 | 347 |
| 471 | 3300026089 | Ga0207648_10250674 | Ga0207648_102506742 | 347 |
| 472 | 3300026095 | Ga0207676_10000837 | Ga0207676_1000083711 | 347 |
| 473 | 3300026095 | Ga0207676_10003209 | Ga0207676_100032098 | 347 |
| 474 | 3300026095 | Ga0207676_10004178 | Ga0207676_100041787 | 347 |
| 475 | 3300026095 | Ga0207676_10007434 | Ga0207676_100074347 | 347 |
| 476 | 3300026095 | Ga0207676_10121414 | Ga0207676_101214142 | 347 |
| 477 | 3300026095 | Ga0207676_10125971 | Ga0207676_101259712 | 347 |
| 478 | 3300026095 | Ga0207676_10348973 | Ga0207676_103489731 | 347 |
| 479 | 3300026095 | Ga0207676_10415460 | Ga0207676_104154601 | 347 |
| 480 | 3300026116 | Ga0207674_10003466 | Ga0207674_1000346610 | 347 |
| 481 | 3300026116 | Ga0207674_10049033 | Ga0207674_100490334 | 347 |
| 482 | 3300026118 | Ga0207675_100000517 | Ga0207675_10000051722 | 347 |
| 483 | 3300026118 | Ga0207675_100007054 | Ga0207675_1000070542 | 347 |
| 484 | 3300026118 | Ga0207675_100017152 | Ga0207675_1000171525 | 347 |
| 485 | 3300026118 | Ga0207675_100029559 | Ga0207675_1000295591 | 347 |
| 486 | 3300026121 | Ga0207683_10002753 | Ga0207683_100027536 | 347 |
| 487 | 3300026121 | Ga0207683_10020492 | Ga0207683_100204922 | 347 |
| 488 | 3300026121 | Ga0207683_10022316 | Ga0207683_100223162 | 347 |
| 489 | 3300026121 | Ga0207683_10240338 | Ga0207683_102403382 | 347 |
| 490 | 3300026142 | Ga0207698_10128374 | Ga0207698_101283742 | 347 |
| 491 | 3300026142 | Ga0207698_10178858 | Ga0207698_101788582 | 347 |
| 492 | 3300026142 | Ga0207698_10440975 | Ga0207698_104409751 | 347 |
| 493 | 3300027682 | Ga0209971_1003509 | Ga0209971_10035094 | 347 |
| 494 | 3300027682 | Ga0209971_1005384 | Ga0209971_10053844 | 347 |
| 495 | 3300027717 | Ga0209998_10002641 | Ga0209998_100026414 | 347 |
| 496 | 3300027866 | Ga0209813_10001896 | Ga0209813_100018965 | 347 |
| 497 | 3300027876 | Ga0209974_10033915 | Ga0209974_100339152 | 347 |
| 498 | 3300028379 | Ga0268266_10002385 | Ga0268266_100023855 | 347 |
| 499 | 3300028379 | Ga0268266_10140837 | Ga0268266_101408372 | 347 |
| 500 | 3300028380 | Ga0268265_10019444 | Ga0268265_100194444 | 347 |
| 501 | 3300028381 | Ga0268264_10000641 | Ga0268264_1000064118 | 347 |
| 502 | 3300028381 | Ga0268264_10025067 | Ga0268264_100250673 | 347 |
| 503 | 3300028381 | Ga0268264_10032340 | Ga0268264_100323404 | 347 |
| 504 | 3300028381 | Ga0268264_10083699 | Ga0268264_100836992 | 347 |
| 505 | 3300028381 | Ga0268264_10434735 | Ga0268264_104347351 | 347 |
| 506 | 3300028573 | Ga0265334_10000010 | Ga0265334_1000001050 | 347 |
| 507 | 3300028800 | Ga0265338_10028579 | Ga0265338_100285793 | 347 |
| 508 | 3300030521 | Ga0307511_10006365 | Ga0307511_100063653 | 347 |
| 509 | 3300031238 | Ga0265332_10001333 | Ga0265332_100013334 | 347 |
| 510 | 3300031241 | Ga0265325_10000877 | Ga0265325_100008779 | 347 |
| 511 | 3300031250 | Ga0265331_10000310 | Ga0265331_1000031032 | 347 |
| 512 | 3300031251 | Ga0265327_10000572 | Ga0265327_1000057220 | 347 |
| 513 | 3300031251 | Ga0265327_10001730 | Ga0265327_100017307 | 347 |
| 514 | 3300031251 | Ga0265327_10002920 | Ga0265327_100029206 | 347 |
| 515 | 3300031507 | Ga0307509_10000033 | Ga0307509_1000003344 | 347 |
| 516 | 3300031548 | Ga0307408_100004310 | Ga0307408_1000043104 | 347 |
| 517 | 3300031548 | Ga0307408_100141027 | Ga0307408_1001410272 | 347 |
| 518 | 3300031595 | Ga0265313_10000068 | Ga0265313_1000006831 | 347 |
| 519 | 3300031595 | Ga0265313_10006502 | Ga0265313_100065021 | 347 |
| 520 | 3300031711 | Ga0265314_10003412 | Ga0265314_100034125 | 347 |
| 521 | 3300031712 | Ga0265342_10072046 | Ga0265342_100720462 | 347 |
| 522 | 3300031731 | Ga0307405_10001513 | Ga0307405_100015131 | 347 |
| 523 | 3300031852 | Ga0307410_10008880 | Ga0307410_100088804 | 347 |
| 524 | 3300031901 | Ga0307406_10025843 | Ga0307406_100258434 | 347 |
| 525 | 3300031903 | Ga0307407_10010883 | Ga0307407_100108833 | 347 |
| 526 | 3300031911 | Ga0307412_10025410 | Ga0307412_100254104 | 347 |
| 527 | 3300031995 | Ga0307409_100012433 | Ga0307409_1000124334 | 347 |
| 528 | 3300032005 | Ga0307411_10000280 | Ga0307411_100002808 | 347 |
| 529 | 3300032005 | Ga0307411_10207499 | Ga0307411_102074991 | 347 |
| 530 | 3300032133 | Ga0316583_10000196 | Ga0316583_1000019611 | 347 |
| 531 | 3300032168 | Ga0316593_10002321 | Ga0316593_100023213 | 347 |
| 532 | 3300035117 | Ga0373953_0005869 | Ga0373953_0005869_320_1363 | 347 |
| 533 | 3300035118 | Ga0373954_0055406 | Ga0373954_0055406_522_1565 | 347 |
| 534 | 3300035119 | Ga0373956_0018705 | Ga0373956_0018705_649_1692 | 347 |
| 535 | 3300035119 | Ga0373956_0027005 | Ga0373956_0027005_13_1056 | 347 |
| 536 | 3300035120 | Ga0373957_0022658 | Ga0373957_0022658_1013_2056 | 347 |
| 537 | 3300035172 | Ga0373955_0039541 | Ga0373955_0039541_31_1074 | 347 |
| 538 | 3300035172 | Ga0373955_0120592 | Ga0373955_0120592_44_1087 | 347 |
| 539 | 3300035692 | Ga0373935_0054736 | Ga0373935_0054736_937_1983 | 347 |
| 540 | 3300035695 | Ga0373927_0000002 | Ga0373927_0000002_897853_898896 | 347 |
| 541 | 3300035695 | Ga0373927_0009964 | Ga0373927_0009964_3137_4180 | 347 |
| 542 | 3300035695 | Ga0373927_0071122 | Ga0373927_0071122_792_1835 | 347 |
| 543 | 3300035695 | Ga0373927_0158677 | Ga0373927_0158677_37_1080 | 347 |
| 544 | 3300036401 | Ga0373937_0025706 | Ga0373937_0025706_1732_2775 | 347 |
| 545 | 3300036401 | Ga0373937_0034356 | Ga0373937_0034356_326_1369 | 347 |
| 546 | 3300037068 | Ga0373925_0037859 | Ga0373925_0037859_1779_2822 | 347 |
| 547 | 3300039447 | Ga0436361_0989378 | Ga0436361_0989378_885_1940 | 347 |
| 548 | 3300042876 | Ga0451577_0000002 | Ga0451577_0000002_45363_46406 | 347 |
| 549 | 3300042876 | Ga0451577_0000384 | Ga0451577_0000384_51816_52859 | 347 |
| 550 | 3300042876 | Ga0451577_0010249 | Ga0451577_0010249_6509_7711 | 347 |
| 551 | 3300044658 | Ga0466972_0000070 | Ga0466972_0000070_80348_81403 | 347 |
| 552 | 3300044673 | Ga0453683_0000003 | Ga0453683_0000003_45363_46406 | 347 |
| 553 | 3300044712 | Ga0453684_0000002 | Ga0453684_0000002_1684970_1686013 | 347 |
| 554 | 3300044712 | Ga0453684_0000005 | Ga0453684_0000005_911050_912093 | 347 |
| 555 | 3300044712 | Ga0453684_0000292 | Ga0453684_0000292_186284_187327 | 347 |
| 556 | 3300044712 | Ga0453684_0000511 | Ga0453684_0000511_32745_33788 | 347 |
| 557 | 3300044712 | Ga0453684_0001222 | Ga0453684_0001222_20094_21137 | 347 |
| 558 | 3300044712 | Ga0453684_0003022 | Ga0453684_0003022_34115_35158 | 347 |
| 559 | 3300045051 | Ga0451576_0000034 | Ga0451576_0000034_65371_66414 | 347 |
| 560 | 3300045051 | Ga0451576_0000266 | Ga0451576_0000266_78230_79273 | 347 |
| 561 | 3300045051 | Ga0451576_0050342 | Ga0451576_0050342_2757_3959 | 347 |
| 562 | 3300046459 | Ga0495629_0008490 | Ga0495629_0008490_2451_3494 | 347 |
| 563 | 3300046472 | Ga0495580_0025942 | Ga0495580_0025942_1454_2497 | 347 |
| 564 | 3300046475 | Ga0495639_0010739 | Ga0495639_0010739_1251_2294 | 347 |
| 565 | 3300046517 | Ga0495630_0055951 | Ga0495630_0055951_1329_2372 | 347 |
| 566 | 3300046528 | Ga0495642_0052845 | Ga0495642_0052845_76_1119 | 347 |
| 567 | 3300046533 | Ga0495640_0016426 | Ga0495640_0016426_3190_4233 | 347 |
| 568 | 3300046543 | Ga0495645_0027599 | Ga0495645_0027599_208_1251 | 347 |
| 569 | 3300046543 | Ga0495645_0120892 | Ga0495645_0120892_82_1137 | 347 |
| 570 | 3300046559 | Ga0495667_0048450 | Ga0495667_0048450_623_1666 | 347 |
| 571 | 3300046615 | Ga0495656_0000664 | Ga0495656_0000664_8062_9105 | 347 |
| 572 | 3300046663 | Ga0495635_0035566 | Ga0495635_0035566_1809_2852 | 347 |
| 573 | 3300046664 | Ga0495659_0039370 | Ga0495659_0039370_625_1668 | 347 |
| 574 | 3300046674 | Ga0495588_0092966 | Ga0495588_0092966_407_1450 | 347 |
| 575 | 3300046678 | Ga0495599_0037574 | Ga0495599_0037574_14_1057 | 347 |
| 576 | 3300046683 | Ga0495658_0156323 | Ga0495658_0156323_249_1292 | 347 |
| 577 | 3300046689 | Ga0495613_0007994 | Ga0495613_0007994_742_1785 | 347 |
| 578 | 3300046809 | Ga0495600_0012682 | Ga0495600_0012682_2261_3304 | 347 |
| 579 | 3300047315 | Ga0495581_0001341 | Ga0495581_0001341_10147_11190 | 347 |
| 580 | 3300047673 | Ga0495593_0026218 | Ga0495593_0026218_700_1743 | 347 |
| 581 | 3300048088 | Ga0495602_0134349 | Ga0495602_0134349_138_1181 | 347 |
| 582 | 3300048903 | Ga0496100_0171382 | Ga0496100_0171382_195_1238 | 347 |
| 583 | 3300048904 | Ga0496101_0062927 | Ga0496101_0062927_318_1361 | 347 |
| 584 | 3300048904 | Ga0496101_0191640 | Ga0496101_0191640_78_1124 | 347 |
| 585 | 3300048905 | Ga0496102_0004733 | Ga0496102_0004733_3349_4392 | 347 |
| 586 | 3300048905 | Ga0496102_0049371 | Ga0496102_0049371_2768_3811 | 347 |
| 587 | 3300048905 | Ga0496102_0061780 | Ga0496102_0061780_1089_2132 | 347 |
| 588 | 3300048905 | Ga0496102_0093460 | Ga0496102_0093460_1526_2569 | 347 |
| 589 | 3300048906 | Ga0496103_0157305 | Ga0496103_0157305_115_1158 | 347 |
| 590 | 3300048906 | Ga0496103_0214268 | Ga0496103_0214268_97_1140 | 347 |
| 591 | 3300048907 | Ga0496104_0008261 | Ga0496104_0008261_5938_6981 | 347 |
| 592 | 3300048907 | Ga0496104_0076399 | Ga0496104_0076399_1798_2844 | 347 |
| 593 | 3300048908 | Ga0496105_0043192 | Ga0496105_0043192_2435_3478 | 347 |
| 594 | 3300048909 | Ga0496106_0000409 | Ga0496106_0000409_15520_16563 | 347 |
| 595 | 3300048909 | Ga0496106_0022995 | Ga0496106_0022995_1517_2560 | 347 |
| 596 | 3300048909 | Ga0496106_0262728 | Ga0496106_0262728_179_1222 | 347 |
| 597 | 3300048910 | Ga0496107_0040266 | Ga0496107_0040266_391_1434 | 347 |
| 598 | 3300048910 | Ga0496107_0123366 | Ga0496107_0123366_192_1238 | 347 |
| 599 | 3300048911 | Ga0496108_0004995 | Ga0496108_0004995_2522_3568 | 347 |
| 600 | 3300048911 | Ga0496108_0011989 | Ga0496108_0011989_682_1725 | 347 |
| 601 | 3300048911 | Ga0496108_0063178 | Ga0496108_0063178_1423_2466 | 347 |
| 602 | 3300048912 | Ga0496109_0086713 | Ga0496109_0086713_1738_2781 | 347 |
| 603 | 3300048912 | Ga0496109_0133532 | Ga0496109_0133532_214_1257 | 347 |
| 604 | 3300048913 | Ga0496110_0004341 | Ga0496110_0004341_4613_5659 | 347 |
| 605 | 3300048913 | Ga0496110_0021483 | Ga0496110_0021483_3273_4316 | 347 |
| 606 | 3300048914 | Ga0496111_0051530 | Ga0496111_0051530_636_1682 | 347 |
| 607 | 3300048915 | Ga0496112_0017345 | Ga0496112_0017345_2929_3972 | 347 |
| 608 | 3300048915 | Ga0496112_0108435 | Ga0496112_0108435_407_1453 | 347 |
| 609 | 3300048916 | Ga0496113_0109534 | Ga0496113_0109534_590_1633 | 347 |
| 610 | 3300048917 | Ga0496114_0028019 | Ga0496114_0028019_123_1166 | 347 |
| 611 | 3300049571 | Ga0501034_0127116 | Ga0501034_0127116_602_1645 | 347 |
| 612 | 3300049581 | Ga0501047_0113584 | Ga0501047_0113584_1490_2533 | 347 |
| 613 | 3300049586 | Ga0501070_0006738 | Ga0501070_0006738_2892_3935 | 347 |
| 614 | 3300049588 | Ga0501072_0059746 | Ga0501072_0059746_1191_2234 | 347 |
| 615 | 3300049589 | Ga0501073_0009180 | Ga0501073_0009180_3636_4679 | 347 |
| 616 | 3300049744 | Ga0501083_0230722 | Ga0501083_0230722_151_1194 | 347 |
| 617 | 3300050493 | nmdc:mga0k408_108603_c1 | nmdc:mga0k408_108603_c1_357_1400 | 347 |
| 618 | 3300050493 | nmdc:mga0k408_52447_c1 | nmdc:mga0k408_52447_c1_921_1964 | 347 |
| 619 | 3300050493 | nmdc:mga0k408_70923_c1 | nmdc:mga0k408_70923_c1_803_1846 | 347 |
| 620 | 3300050494 | nmdc:mga06z11_22316_c1 | nmdc:mga06z11_22316_c1_1883_2926 | 347 |
| 621 | 3300050495 | nmdc:mga04h51_2776_c1 | nmdc:mga04h51_2776_c1_3106_4149 | 347 |
| 622 | 3300050496 | nmdc:mga07m45_21330_c1 | nmdc:mga07m45_21330_c1_779_1822 | 347 |
| 623 | 3300050507 | nmdc:mga05p37_332983_c1 | nmdc:mga05p37_332983_c1_87_1130 | 347 |
| 624 | 3300050507 | nmdc:mga05p37_80753_c1 | nmdc:mga05p37_80753_c1_2625_3668 | 347 |
| 625 | 3300050508 | nmdc:mga09592_246778_c1 | nmdc:mga09592_246778_c1_381_1424 | 347 |
| 626 | 3300050511 | nmdc:mga08y16_206864_c1 | nmdc:mga08y16_206864_c1_614_1657 | 347 |
| 627 | 3300050512 | nmdc:mga0n895_131243_c1 | nmdc:mga0n895_131243_c1_79_1122 | 347 |
| 628 | 3300050512 | nmdc:mga0n895_212344_c1 | nmdc:mga0n895_212344_c1_249_1292 | 347 |
| 629 | 3300050513 | nmdc:mga0rr50_219760_c1 | nmdc:mga0rr50_219760_c1_207_1250 | 347 |
| 630 | 3300050513 | nmdc:mga0rr50_41538_c1 | nmdc:mga0rr50_41538_c1_606_1649 | 347 |
| 631 | 3300053084 | Ga0495595_0093117 | Ga0495595_0093117_350_1393 | 347 |
| 632 | 3300053090 | Ga0500646_0002660 | Ga0500646_0002660_732_1775 | 347 |
| 633 | 3300053177 | Ga0500636_0000406 | Ga0500636_0000406_18848_19891 | 347 |
| 634 | 3300053178 | Ga0500637_0002477 | Ga0500637_0002477_1531_2574 | 347 |
| 635 | 3300053729 | Ga0500625_020075 | Ga0500625_020075_2009_3052 | 347 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1z7e-assembly1.cif.gz_C | crystal structure of full length arna | 0.9617 | 2 | 338 |
| 1z7e-assembly1.cif.gz_D | crystal structure of full length arna | 0.9616 | 2 | 338 |
| 4wkg-assembly1.cif.gz_D | the crystal structure of apo arna features an unexpected central binding pocket and provides an explanation for enzymatic coop-erativity | 0.9496 | 2 | 337 |
| 3slg-assembly2.cif.gz_F | crystal structure of pbgp3 protein from burkholderia pseudomallei | 0.9485 | 2 | 343 |
| 4wkg-assembly1.cif.gz_E | the crystal structure of apo arna features an unexpected central binding pocket and provides an explanation for enzymatic coop-erativity | 0.9474 | 2 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3slgE01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9514 | 2 | 320 | 3.40.50.720 |
| 3slgE01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9399 | 2 | 320 | 3.40.50.720 |
| 4wkgA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9178 | 2 | 335 | 3.40.50.720 |
| af_I1LKW7_14_379_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9053 | 3 | 343 | 3.40.50.720 |
| 3slgE02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.8995 | 196 | 347 | 3.90.25.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A484YST3-F1-model_v4 | Bifunctional polymyxin resistance protein ArnA (EC 2.1.2.9) | 0.9776 | 2 | 175 |
GO:0004479
|
| AF-J3NHI5-F1-model_v4 | Bifunctional polymyxin resistance protein ArnA | 0.9757 | 2 | 344 |
GO:0009245
GO:0016020 GO:0016491 GO:0046677 |
| AF-K2DTL0-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9746 | 1 | 335 |
|
| AF-D2Z579-F1-model_v4 | NAD-dependent epimerase/dehydratase | 0.9737 | 3 | 335 |
|
| AF-A0A485AQD4-F1-model_v4 | Polymyxin resistance protein PmrI | 0.9703 | 24 | 155 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar