F471238

General Info

Members Datasets Scaffolds Average Seq Length
635 462 379 328

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100427383|Ga0070699_1004273831
Length 361
Sequence MAIVKGRGFASVNYPTGMNLGGDPTQALIHCTTLGDFVITLSSVDLGQGIKTVGAQIGAETLGVPVESVRLDLGDTDTGPHCMGTFASRLTHRAGNAIIMAAKEARQTMLEVAGEELEVNATDLETDGRGSIQVVGAPSRSISVMDVALAAHFKHGRTISGRGIYMKPKSEPVPETGEMDPDSAQAHACTAADVEVDTETGEVRVVRLISAYEIGRAINPNMARQQIIGGAWMGISHTLFETTAPYYPSQEHAPRDFNEYLMPALGELTEVNGAILQRPSSTGPFGAKGLGEMTANPPIGAIANAIFNATGVRIYHLPITPERVLRGIEALAANPDRAPSRPQKSDAGIGDGVIVGQVNNF

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
13 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
14 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
15 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
16 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
17 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
18 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
19 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
20 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
21 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
22 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
23 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
24 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
25 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
26 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
27 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
28 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
29 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
30 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
31 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
32 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
33 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
34 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
35 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
36 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
37 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
38 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
39 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
40 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
41 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
42 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
43 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
44 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
45 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
46 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
47 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
48 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
49 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
50 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
51 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
52 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
53 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
54 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
55 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
56 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
57 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
58 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
59 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
60 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
61 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
62 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
63 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
64 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
65 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
66 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
67 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
68 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
69 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
70 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
71 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
72 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
73 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
74 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
75 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
76 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
77 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
78 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
79 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
80 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
81 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
82 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
83 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
84 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
85 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
86 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
87 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
88 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
89 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
90 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
91 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
92 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
93 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
94 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
95 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
96 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
97 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
98 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
99 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
100 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
101 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
102 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
103 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
104 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
105 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
106 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
107 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
108 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
109 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
110 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
111 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
112 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
113 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
114 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
115 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
116 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
117 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
118 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
119 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
120 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
121 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
122 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
123 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
124 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
125 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
126 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
127 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
128 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
129 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
130 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
131 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
132 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
133 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
134 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
135 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
136 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
137 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
138 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
139 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
140 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
141 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
142 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
143 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
144 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
145 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
146 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
147 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
148 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
149 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
150 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
151 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
152 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
153 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
154 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
155 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
156 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
157 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
158 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
159 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
160 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
161 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
162 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
163 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
164 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
165 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
166 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
167 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
168 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
169 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
170 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
171 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
172 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
173 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
174 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
175 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
176 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
177 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
178 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
179 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
180 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
181 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
182 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
183 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
184 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
185 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
186 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
187 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
188 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
189 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
190 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
191 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
192 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
193 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
194 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
195 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
196 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
197 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
198 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
199 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
200 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
201 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
202 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
203 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
204 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
205 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
206 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
207 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
208 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
209 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
210 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
211 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
212 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
213 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
214 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
215 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
216 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
217 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
218 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
219 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
220 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
221 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
222 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
223 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
224 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
225 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
226 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
227 3004167301 Mesorhizobium loti 582 Isolate Unclassified
228 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
229 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
230 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
231 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
232 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
233 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
234 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
235 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
236 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
237 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
238 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
239 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
240 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
241 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
242 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
243 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
244 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
245 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
246 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
247 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
248 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
249 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
250 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
251 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
252 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
253 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
254 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
255 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
256 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
257 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
258 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
259 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
260 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
261 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
262 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
263 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
264 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
265 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
266 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
267 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
268 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
269 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
270 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
271 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
272 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
273 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
274 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
275 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
276 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
277 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
278 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
281 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
282 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
283 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
286 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
287 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
289 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
291 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
314 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
316 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
317 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
318 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
319 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
320 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
321 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
322 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
323 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
325 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
326 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
327 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
328 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
329 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
330 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
331 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
332 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
333 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
334 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
335 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
336 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
337 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
338 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
339 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
340 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
341 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
342 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
343 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
344 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
345 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
346 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
347 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
348 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
349 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
351 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
352 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
353 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
354 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
355 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
356 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
357 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
358 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
359 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
360 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
361 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
362 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
363 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
364 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
365 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
366 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
367 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
368 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
369 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
374 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
375 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
378 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
379 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
380 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
381 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
382 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
398 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
399 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
400 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
401 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
402 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
403 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
404 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
405 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
406 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
407 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
408 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
409 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
410 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
411 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
412 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
415 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
416 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
417 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
418 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
419 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
420 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
421 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
422 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
423 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
426 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
427 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
428 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
429 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
430 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
431 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
432 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
433 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
434 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
435 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
436 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
437 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
438 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
439 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
442 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
443 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
444 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
445 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
446 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
447 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
448 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
449 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
450 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
451 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
452 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
453 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
454 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
455 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
456 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
457 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
458 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
459 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
460 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
461 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
462 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.37
Metatranscriptomes 0.31
Isolates 40.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.87
Nodule 34.49
Rhizoplane 1.26
Rhizosphere 47.24
Stem 0
Stem Tuber 0
Unclassified 9.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1008816 3300002705 Bacteria 2504
2 JGI25157J39369_1001276 3300002741 Bacteria 10204
3 JGI25406J46586_10005586 3300003203 Bacteria 5824
4 JGI25406J46586_10006298 3300003203 Bacteria 5473
5 JGI25406J46586_10007914 3300003203 Bacteria 4835
6 JGI25165J46597_1000015 3300003214 Bacteria 380891
7 JGI25153J46596_10000059 3300003215 Bacteria 131871
8 Ga0055542_1000406 3300003762 Bacteria 42163
9 Ga0055531_10014220 3300003794 Bacteria 3602
10 Ga0065712_10077926 3300005290 Bacteria 3423
11 Ga0065715_10000926 3300005293 Bacteria 7713
12 Ga0070658_10102084 3300005327 Bacteria 2371
13 Ga0068869_100114693 3300005334 Bacteria 2054
14 Ga0068869_100399907 3300005334 Bacteria 1130
15 Ga0070668_100002957 3300005347 Bacteria 12559
16 Ga0070669_100131177 3300005353 Bacteria 1923
17 Ga0070674_100158593 3300005356 Bacteria 1715
18 Ga0070659_100071379 3300005366 Bacteria 2761
19 Ga0070659_100284247 3300005366 Bacteria 1376
20 Ga0070714_100079058 3300005435 Bacteria 2859
21 Ga0068867_100067498 3300005459 Bacteria 2667
22 Ga0068867_100173398 3300005459 Bacteria 1710
23 Ga0070706_100212785 3300005467 Bacteria 1805
24 Ga0070707_100191052 3300005468 Bacteria 1997
25 Ga0070698_100002827 3300005471 Bacteria 19102
26 Ga0070699_100427383 3300005518 Unclassified 1199
27 Ga0070684_100218829 3300005535 Bacteria 1737
28 Ga0068853_100256884 3300005539 Bacteria 1605
29 Ga0070665_100106939 3300005548 Bacteria 2800
30 Ga0070665_100159725 3300005548 Bacteria 2256
31 Ga0070665_100171801 3300005548 Bacteria 2168
32 Ga0070664_100036828 3300005564 Bacteria 4111
33 Ga0070664_100139571 3300005564 Bacteria 2133
34 Ga0068862_100010968 3300005844 Bacteria 7483
35 Ga0068862_100318049 3300005844 Bacteria 1436
36 Ga0081455_10007064 3300005937 Bacteria 11914
37 Ga0081455_10035932 3300005937 Bacteria 4418
38 Ga0081455_10125372 3300005937 Bacteria 2016
39 Ga0081455_10137053 3300005937 Bacteria 1905
40 Ga0081455_10187172 3300005937 Bacteria 1563
41 Ga0081538_10005290 3300005981 Bacteria 11647
42 Ga0081538_10034084 3300005981 Bacteria 3374
43 Ga0081538_10042847 3300005981 Bacteria 2850
44 Ga0081538_10062793 3300005981 Bacteria 2115
45 Ga0081538_10107367 3300005981 Bacteria 1382
46 Ga0081540_1013759 3300005983 Bacteria 5241
47 Ga0081540_1066863 3300005983 Bacteria 1682
48 Ga0081540_1116014 3300005983 Bacteria 1121
49 Ga0081539_10000310 3300005985 Bacteria 109306
50 Ga0081539_10001609 3300005985 Bacteria 37152
51 Ga0081539_10004719 3300005985 Bacteria 14756
52 Ga0070717_10083269 3300006028 Unclassified 2690
53 Ga0075365_10106791 3300006038 Bacteria 1921
54 Ga0075364_10141628 3300006051 Bacteria 1618
55 Ga0075362_10001553 3300006177 Bacteria 7411
56 Ga0075367_10086548 3300006178 Bacteria 1902
57 Ga0111539_10329595 3300009094 Bacteria 1777
58 Ga0114129_10305234 3300009147 Bacteria 2120
59 Ga0114129_10617482 3300009147 Bacteria 1403
60 Ga0105243_10174296 3300009148 Bacteria 1865
61 Ga0105237_10320634 3300009545 Bacteria 1553
62 Ga0105238_10025302 3300009551 Bacteria 6050
63 Ga0157369_10328031 3300013105 Bacteria 1590
64 Ga0157378_10059927 3300013297 Bacteria 3397
65 Ga0157379_10485997 3300014968 Bacteria 1143
66 Ga0209026_1000025 3300025250 Bacteria 352548
67 Ga0209677_108050 3300025253 Bacteria 2114
68 Ga0209148_1000181 3300025254 Bacteria 124691
69 Ga0209759_1000226 3300025256 Bacteria 84383
70 Ga0209233_1000010 3300025261 Bacteria 1194329
71 Ga0209455_1000127 3300025272 Bacteria 162518
72 Ga0209758_1000095 3300025297 Bacteria 237870
73 Ga0209758_1009435 3300025297 Bacteria 6068
74 Ga0209758_1018447 3300025297 Bacteria 3417
75 Ga0209050_1010032 3300025298 Bacteria 4733
76 Ga0207426_1018145 3300025302 Bacteria 2485
77 Ga0209257_1001205 3300025304 Bacteria 32503
78 Ga0207643_10018461 3300025908 Bacteria 3820
79 Ga0207684_10191893 3300025910 Bacteria 1762
80 Ga0207654_10064432 3300025911 Bacteria 2154
81 Ga0207693_10178642 3300025915 Bacteria 1670
82 Ga0207657_10239167 3300025919 Bacteria 1450
83 Ga0207649_10130875 3300025920 Bacteria 1704
84 Ga0207646_10047631 3300025922 Bacteria 3844
85 Ga0207681_10177610 3300025923 Bacteria 1619
86 Ga0207681_10217637 3300025923 Bacteria 1476
87 Ga0207694_10009950 3300025924 Bacteria 7174
88 Ga0207664_10066080 3300025929 Bacteria 2898
89 Ga0207704_10298007 3300025938 Bacteria 1234
90 Ga0207665_10023588 3300025939 Bacteria 4051
91 Ga0207691_10057218 3300025940 Bacteria 3550
92 Ga0207689_10109585 3300025942 Bacteria 2269
93 Ga0207689_10286054 3300025942 Bacteria 1365
94 Ga0207661_10083755 3300025944 Bacteria 2640
95 Ga0207661_10304454 3300025944 Bacteria 1430
96 Ga0207668_10000451 3300025972 Bacteria 25967
97 Ga0207668_10288430 3300025972 Bacteria 1349
98 Ga0207640_10204095 3300025981 Bacteria 1500
99 Ga0207639_10013061 3300026041 Bacteria 5798
100 Ga0207708_10163372 3300026075 Bacteria 1759
101 Ga0207648_10188689 3300026089 Bacteria 1826
102 Ga0207698_10189682 3300026142 Bacteria 1829
103 Ga0207698_10205540 3300026142 Bacteria 1767
104 Ga0207428_10092453 3300027907 Bacteria 2347
105 Ga0207428_10201387 3300027907 Bacteria 1498
106 Ga0268265_10009849 3300028380 Bacteria 6452
107 Ga0265326_10009846 3300028558 Bacteria 2853
108 Ga0265319_1002662 3300028563 Bacteria 9592
109 Ga0265319_1003852 3300028563 Bacteria 7667
110 Ga0265334_10005152 3300028573 Bacteria 5726
111 Ga0265334_10006850 3300028573 Bacteria 4893
112 Ga0265318_10000753 3300028577 Bacteria 21576
113 Ga0265318_10011081 3300028577 Bacteria 3898
114 Ga0265318_10021909 3300028577 Bacteria 2560
115 Ga0265318_10028074 3300028577 Bacteria 2204
116 Ga0265323_10014045 3300028653 Bacteria 3181
117 Ga0307517_10024087 3300028786 Bacteria 7526
118 Ga0307515_10000950 3300028794 Bacteria 66308
119 Ga0307515_10012424 3300028794 Bacteria 16017
120 Ga0307515_10110312 3300028794 Bacteria 3222
121 Ga0307512_10006891 3300030522 Bacteria 11375
122 Ga0265760_10012252 3300031090 Bacteria 2451
123 Ga0265330_10005444 3300031235 Bacteria 6349
124 Ga0265330_10031135 3300031235 Bacteria 2392
125 Ga0265332_10029088 3300031238 Bacteria 2417
126 Ga0265332_10067365 3300031238 Bacteria 1526
127 Ga0265332_10073373 3300031238 Bacteria 1456
128 Ga0265328_10001487 3300031239 Bacteria 10815
129 Ga0265320_10007316 3300031240 Bacteria 6857
130 Ga0265320_10065163 3300031240 Bacteria 1729
131 Ga0265325_10003209 3300031241 Bacteria 10755
132 Ga0265329_10007966 3300031242 Bacteria 4056
133 Ga0265329_10008622 3300031242 Bacteria 3852
134 Ga0265340_10013058 3300031247 Bacteria 4373
135 Ga0265340_10014463 3300031247 Bacteria 4119
136 Ga0265339_10015660 3300031249 Bacteria 4539
137 Ga0265339_10110191 3300031249 Bacteria 1425
138 Ga0265339_10136082 3300031249 Bacteria 1253
139 Ga0265331_10013395 3300031250 Bacteria 4412
140 Ga0265331_10037040 3300031250 Bacteria 2390
141 Ga0265327_10013762 3300031251 Bacteria 5346
142 Ga0265316_10014087 3300031344 Bacteria 7058
143 Ga0265316_10042539 3300031344 Bacteria 3630
144 Ga0307513_10001342 3300031456 Bacteria 35584
145 Ga0307513_10025115 3300031456 Bacteria 6914
146 Ga0307513_10034954 3300031456 Bacteria 5631
147 Ga0307513_10095151 3300031456 Bacteria 3021
148 Ga0307408_100149413 3300031548 Bacteria 1843
149 Ga0307408_100431326 3300031548 Bacteria 1139
150 Ga0265313_10024901 3300031595 Bacteria 3185
151 Ga0316579_10005481 3300031691 Bacteria 5126
152 Ga0316579_10014395 3300031691 Bacteria 3418
153 Ga0265314_10016088 3300031711 Bacteria 5922
154 Ga0265314_10093386 3300031711 Bacteria 1953
155 Ga0265342_10021752 3300031712 Bacteria 4088
156 Ga0316576_10028732 3300031727 Bacteria 3923
157 Ga0316576_10134217 3300031727 Unclassified 1863
158 Ga0316578_10005462 3300031728 Bacteria 6167
159 Ga0316578_10051093 3300031728 Bacteria 2420
160 Ga0307516_10002882 3300031730 Bacteria 22605
161 Ga0307516_10012820 3300031730 Bacteria 9000
162 Ga0307516_10023146 3300031730 Bacteria 6373
163 Ga0307516_10051377 3300031730 Bacteria 4041
164 Ga0307516_10158596 3300031730 Bacteria 2015
165 Ga0316577_10012737 3300031733 Bacteria 4585
166 Ga0316577_10069853 3300031733 Bacteria 1961
167 Ga0307406_10287025 3300031901 Bacteria 1258
168 Ga0307415_100035697 3300032126 Bacteria 3249
169 Ga0307415_100041963 3300032126 Bacteria 3041
170 Ga0316585_10021224 3300032137 Bacteria 1993
171 Ga0316580_10021998 3300032139 Bacteria 1968
172 Ga0316592_1003023 3300033524 Bacteria 2975
173 Ga0316574_0038430 3300035398 Bacteria 2938
174 Ga0316574_0079962 3300035398 Bacteria 2074
175 Ga0316582_0047599 3300036647 Bacteria 2708
176 Ga0316584_0006854 3300036712 Bacteria 7737
177 Ga0395899_0127808 3300037312 Bacteria 1817
178 Ga0395900_0221391 3300037418 Bacteria 1907
179 Ga0395900_0370545 3300037418 Bacteria 1402
180 Ga0395898_0125867 3300037466 Bacteria 2455
181 Ga0395905_0178873 3300037471 Bacteria 1991
182 Ga0395905_0227281 3300037471 Bacteria 1745
183 Ga0395901_0080348 3300038443 Bacteria 3404
184 Ga0395901_0107944 3300038443 Bacteria 2922
185 Ga0395901_0175766 3300038443 Bacteria 2246
186 Ga0395901_0197332 3300038443 Bacteria 2110
187 Ga0436365_1305769 3300039437 Bacteria 1087
188 Ga0451791_1107066 3300041451 Bacteria 2031
189 Ga0451837_0747065 3300041494 Bacteria 1381
190 Ga0451837_1649215 3300041494 Bacteria 1512
191 Ga0439460_0066059 3300042461 Bacteria 1112
192 Ga0466972_0050330 3300044658 Bacteria 2011
193 Ga0466972_0067698 3300044658 Bacteria 1705
194 Ga0466965_0108998 3300044683 Bacteria 1422
195 Ga0466960_0006929 3300044901 Bacteria 4571
196 Ga0451576_0715649 3300045051 Bacteria 1052
197 Ga0495638_0023757 3300046460 Bacteria 4004
198 Ga0495638_0023898 3300046460 Bacteria 3992
199 Ga0495638_0055505 3300046460 Bacteria 2459
200 Ga0495643_0049019 3300046522 Bacteria 2279
201 Ga0495597_0047204 3300046542 Bacteria 1907
202 Ga0495633_0139264 3300046558 Bacteria 1122
203 Ga0495625_0009140 3300046660 Bacteria 8339
204 Ga0495602_0189964 3300048088 Bacteria 1576
205 Ga0496102_0264659 3300048905 Bacteria 1621
206 Ga0496108_0173314 3300048911 Bacteria 1867
207 Ga0496108_0221821 3300048911 Bacteria 1643
208 Ga0496112_0146270 3300048915 Bacteria 2332
209 Ga0496113_0357903 3300048916 Bacteria 1171
210 Ga0496115_0176301 3300048918 Bacteria 1768
211 Ga0496118_0053400 3300048921 Bacteria 3072
212 Ga0496119_0163510 3300048922 Bacteria 1181
213 Ga0496120_0004296 3300048923 Bacteria 12080
214 Ga0496121_0055037 3300048924 Bacteria 3319
215 Ga0496121_0175352 3300048924 Bacteria 1553
216 Ga0496124_0245006 3300048927 Bacteria 1330
217 Ga0501031_0032138 3300049568 Bacteria 3422
218 Ga0501031_0074474 3300049568 Bacteria 2211
219 Ga0501031_0113426 3300049568 Bacteria 1770
220 Ga0501032_0019826 3300049569 Bacteria 4695
221 Ga0501032_0020200 3300049569 Bacteria 4643
222 Ga0501032_0023569 3300049569 Bacteria 4249
223 Ga0501032_0077572 3300049569 Bacteria 2212
224 Ga0501032_0166784 3300049569 Bacteria 1445
225 Ga0501033_0001198 3300049570 Bacteria 23371
226 Ga0501033_0023960 3300049570 Bacteria 4604
227 Ga0501033_0030713 3300049570 Bacteria 4036
228 Ga0501033_0031406 3300049570 Bacteria 3991
229 Ga0501033_0218009 3300049570 Bacteria 1359
230 Ga0501034_0065517 3300049571 Bacteria 3645
231 Ga0501034_0065519 3300049571 Bacteria 3645
232 Ga0501034_0099566 3300049571 Bacteria 2901
233 Ga0501034_0210141 3300049571 Bacteria 1901
234 Ga0501034_0265952 3300049571 Bacteria 1657
235 Ga0501034_0334539 3300049571 Bacteria 1445
236 Ga0501034_0434820 3300049571 Bacteria 1231
237 Ga0501036_0018403 3300049572 Bacteria 5852
238 Ga0501036_0101184 3300049572 Bacteria 2438
239 Ga0501036_0162427 3300049572 Bacteria 1883
240 Ga0501036_0371923 3300049572 Bacteria 1193
241 Ga0501037_0000077 3300049573 Bacteria 91081
242 Ga0501037_0013496 3300049573 Bacteria 6016
243 Ga0501037_0020511 3300049573 Bacteria 4880
244 Ga0501037_0081020 3300049573 Bacteria 2354
245 Ga0501038_0022496 3300049574 Bacteria 5647
246 Ga0501038_0040409 3300049574 Bacteria 4073
247 Ga0501038_0093156 3300049574 Bacteria 2521
248 Ga0501039_0021955 3300049575 Bacteria 4898
249 Ga0501039_0044165 3300049575 Bacteria 3441
250 Ga0501040_0029079 3300049576 Bacteria 3729
251 Ga0501040_0035266 3300049576 Bacteria 3392
252 Ga0501040_0082981 3300049576 Bacteria 2222
253 Ga0501041_0025075 3300049577 Bacteria 3583
254 Ga0501041_0034173 3300049577 Bacteria 3078
255 Ga0501041_0036671 3300049577 Bacteria 2970
256 Ga0501041_0108784 3300049577 Bacteria 1719
257 Ga0501042_0022122 3300049578 Bacteria 4440
258 Ga0501042_0150798 3300049578 Bacteria 1676
259 Ga0501043_0000114 3300049579 Bacteria 75782
260 Ga0501043_0009321 3300049579 Bacteria 7712
261 Ga0501043_0010387 3300049579 Bacteria 7296
262 Ga0501043_0050591 3300049579 Bacteria 3266
263 Ga0501043_0130386 3300049579 Bacteria 1970
264 Ga0501043_0130710 3300049579 Bacteria 1968
265 Ga0501046_0070583 3300049580 Bacteria 2716
266 Ga0501046_0093446 3300049580 Bacteria 2312
267 Ga0501047_0009607 3300049581 Bacteria 9145
268 Ga0501047_0026908 3300049581 Bacteria 5537
269 Ga0501047_0036844 3300049581 Bacteria 4727
270 Ga0501047_0042753 3300049581 Bacteria 4377
271 Ga0501047_0232109 3300049581 Bacteria 1698
272 Ga0501048_0042883 3300049582 Bacteria 3239
273 Ga0501067_0019968 3300049583 Bacteria 3708
274 Ga0501067_0171497 3300049583 Bacteria 1209
275 Ga0501068_0026799 3300049584 Bacteria 3399
276 Ga0501069_0000016 3300049585 Bacteria 142565
277 Ga0501069_0122301 3300049585 Bacteria 1487
278 Ga0501070_0000450 3300049586 Bacteria 37447
279 Ga0501070_0030883 3300049586 Bacteria 4488
280 Ga0501070_0077106 3300049586 Bacteria 2759
281 Ga0501070_0115954 3300049586 Bacteria 2212
282 Ga0501071_0012836 3300049587 Bacteria 5696
283 Ga0501071_0018685 3300049587 Bacteria 4805
284 Ga0501071_0020467 3300049587 Bacteria 4598
285 Ga0501071_0032416 3300049587 Bacteria 3710
286 Ga0501071_0140404 3300049587 Bacteria 1799
287 Ga0501072_0018781 3300049588 Bacteria 5332
288 Ga0501072_0166728 3300049588 Bacteria 1757
289 Ga0501073_0004199 3300049589 Bacteria 10800
290 Ga0501073_0009138 3300049589 Bacteria 7314
291 Ga0501073_0036031 3300049589 Bacteria 3516
292 Ga0501073_0159119 3300049589 Bacteria 1565
293 Ga0501073_0196665 3300049589 Bacteria 1394
294 Ga0501074_0000067 3300049590 Bacteria 49686
295 Ga0501074_0041322 3300049590 Bacteria 3339
296 Ga0501074_0123608 3300049590 Bacteria 1851
297 Ga0501074_0139123 3300049590 Bacteria 1737
298 Ga0501074_0208151 3300049590 Bacteria 1394
299 Ga0501074_0219969 3300049590 Bacteria 1352
300 Ga0501075_0001927 3300049591 Bacteria 13685
301 Ga0501075_0037581 3300049591 Bacteria 3618
302 Ga0501075_0239803 3300049591 Bacteria 1382
303 Ga0501076_0003686 3300049592 Bacteria 10772
304 Ga0501076_0070686 3300049592 Bacteria 2791
305 Ga0501076_0243013 3300049592 Bacteria 1473
306 Ga0501076_0267605 3300049592 Bacteria 1399
307 Ga0501077_0041204 3300049593 Bacteria 2941
308 Ga0501079_0008207 3300049741 Bacteria 7915
309 Ga0501080_0000591 3300049742 Bacteria 28648
310 Ga0501080_0023439 3300049742 Bacteria 5720
311 Ga0501080_0141495 3300049742 Bacteria 2224
312 Ga0501080_0353060 3300049742 Bacteria 1327
313 Ga0501081_0192410 3300049743 Bacteria 1477
314 Ga0501081_0258514 3300049743 Bacteria 1272
315 Ga0501083_0000111 3300049744 Bacteria 55529
316 Ga0501035_0000048 3300049822 Bacteria 146466
317 Ga0501035_0102007 3300049822 Bacteria 2517
318 Ga0501035_0158962 3300049822 Bacteria 1957
319 Ga0501035_0180611 3300049822 Bacteria 1818
320 Ga0501035_0487921 3300049822 Bacteria 1015
321 Ga0501044_0000003 3300049823 Bacteria 345647
322 Ga0501044_0015064 3300049823 Bacteria 8332
323 Ga0501044_0029486 3300049823 Bacteria 5784
324 Ga0501044_0077171 3300049823 Bacteria 3379
325 Ga0501044_0123308 3300049823 Bacteria 2590
326 Ga0501044_0142450 3300049823 Bacteria 2385
327 Ga0501044_0213450 3300049823 Bacteria 1883
328 Ga0501045_0011420 3300049824 Bacteria 6239
329 Ga0501045_0112320 3300049824 Bacteria 2020
330 nmdc:mga03683_1427_c1 3300050489 Bacteria 7127
331 nmdc:mga0yw44_130703_c1 3300050492 Bacteria 1625
332 nmdc:mga0yw44_28019_c1 3300050492 Bacteria 3236
333 nmdc:mga06z11_31359_c1 3300050494 Bacteria 2582
334 nmdc:mga07m45_17984_c1 3300050496 Bacteria 3806
335 nmdc:mga05p37_338009_c1 3300050507 Bacteria 1776
336 nmdc:mga05p37_389833_c1 3300050507 Bacteria 1629
337 nmdc:mga0qj67_293944_c1 3300050509 Bacteria 1316
338 nmdc:mga06r32_390300_c1 3300050510 Bacteria 1374
339 nmdc:mga08y16_155704_c1 3300050511 Bacteria 2375
340 nmdc:mga0n895_465585_c1 3300050512 Bacteria 1275
341 Ga0495601_0280575 3300053077 Bacteria 1086
342 Ga0500610_0003387 3300053079 Bacteria 6104
343 Ga0500578_0028025 3300053086 Bacteria 3618
344 Ga0500583_0182613 3300053092 Bacteria 1045
345 Ga0500651_0002171 3300053093 Bacteria 10253
346 Ga0500651_0129202 3300053093 Bacteria 1529
347 Ga0500641_0007120 3300053096 Bacteria 3981
348 Ga0500555_014404 3300053103 Bacteria 2280
349 Ga0500556_0001237 3300053104 Bacteria 11849
350 Ga0500595_000361 3300053119 Bacteria 29468
351 Ga0500608_038170 3300053122 Bacteria 2297
352 Ga0500618_000131 3300053125 Bacteria 62441
353 Ga0500618_000229 3300053125 Bacteria 44067
354 Ga0500642_0002844 3300053130 Bacteria 5137
355 Ga0500642_0110485 3300053130 Bacteria 1283
356 Ga0500658_0016549 3300053134 Bacteria 2748
357 Ga0500568_0000019 3300053139 Bacteria 195696
358 Ga0500568_0003338 3300053139 Bacteria 9014
359 Ga0500568_0027274 3300053139 Bacteria 2391
360 Ga0500600_0025587 3300053149 Bacteria 3508
361 Ga0500604_0008420 3300053151 Bacteria 2736
362 Ga0500604_0013949 3300053151 Bacteria 2184
363 Ga0500604_0022067 3300053151 Bacteria 1804
364 Ga0500616_0000476 3300053153 Bacteria 51947
365 Ga0500616_0000746 3300053153 Bacteria 37534
366 Ga0500622_0003404 3300053156 Bacteria 10686
367 Ga0500622_0076039 3300053156 Bacteria 1689
368 Ga0500609_001312 3300053731 Bacteria 3669
369 Ga0501084_0044562 3300054114 Bacteria 3714
370 Ga0501084_0051872 3300054114 Bacteria 3433
371 Ga0501084_0095723 3300054114 Bacteria 2494
372 Ga0501084_0115201 3300054114 Bacteria 2259
373 Ga0501084_0133414 3300054114 Bacteria 2091
374 Ga0501082_0006257 3300060353 Bacteria 10333
375 Ga0501082_0208999 3300060353 Bacteria 1698
376 Ga0501082_0237992 3300060353 Bacteria 1584
377 Ga0530510_0016941 3300061734 Bacteria 5161
378 Ga0530510_0142139 3300061734 Bacteria 1769
379 Ga0530510_0341454 3300061734 Bacteria 1124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0715649 Ga0451576_0715649_181_1035 261
2 3300049822 Ga0501035_0487921 Ga0501035_0487921_13_906 272
3 3300053092 Ga0500583_0182613 Ga0500583_0182613_113_1015 275
4 3300049569 Ga0501032_0077572 Ga0501032_0077572_1300_2193 276
5 iso_pu_bacteria 2871481445 2871487220 286
6 iso_pu_bacteria 2970619444 2970623018 286
7 iso_pu_bacteria 2906386501 2906392448 288
8 3300048088 Ga0495602_0189964 Ga0495602_0189964_241_1167 290
9 3300060353 Ga0501082_0237992 Ga0501082_0237992_36_1058 291
10 iso_pu_bacteria 2924718760 2924720876 291
11 iso_pu_bacteria 2979710463 2979715384 291
12 3300013297 Ga0157378_10059927 Ga0157378_100599272 292
13 3300025915 Ga0207693_10178642 Ga0207693_101786422 292
14 3300025939 Ga0207665_10023588 Ga0207665_100235883 292
15 3300042461 Ga0439460_0066059 Ga0439460_0066059_34_1011 292
16 3300048905 Ga0496102_0264659 Ga0496102_0264659_590_1594 292
17 iso_pu_bacteria 2938014810 2938019380 292
18 3300048916 Ga0496113_0357903 Ga0496113_0357903_206_1153 294
19 iso_pu_bacteria 2977907340 2977907692 295
20 3300005937 Ga0081455_10187172 Ga0081455_101871722 297
21 3300049568 Ga0501031_0113426 Ga0501031_0113426_329_1330 297
22 3300049572 Ga0501036_0162427 Ga0501036_0162427_595_1596 297
23 3300049572 Ga0501036_0371923 Ga0501036_0371923_16_1017 297
24 3300049576 Ga0501040_0029079 Ga0501040_0029079_2177_3178 297
25 3300049576 Ga0501040_0082981 Ga0501040_0082981_349_1350 297
26 3300049577 Ga0501041_0034173 Ga0501041_0034173_351_1352 297
27 3300049577 Ga0501041_0036671 Ga0501041_0036671_575_1576 297
28 3300049579 Ga0501043_0130710 Ga0501043_0130710_480_1481 297
29 3300049587 Ga0501071_0018685 Ga0501071_0018685_3481_4482 297
30 3300049587 Ga0501071_0032416 Ga0501071_0032416_785_1786 297
31 3300049591 Ga0501075_0037581 Ga0501075_0037581_1678_2679 297
32 3300049592 Ga0501076_0070686 Ga0501076_0070686_625_1626 297
33 3300049592 Ga0501076_0267605 Ga0501076_0267605_108_1109 297
34 3300049822 Ga0501035_0158962 Ga0501035_0158962_126_1127 297
35 3300049824 Ga0501045_0112320 Ga0501045_0112320_695_1696 297
36 3300054114 Ga0501084_0051872 Ga0501084_0051872_1017_2018 297
37 3300060353 Ga0501082_0208999 Ga0501082_0208999_585_1586 297
38 3300061734 Ga0530510_0016941 Ga0530510_0016941_3024_4025 297
39 3300031238 Ga0265332_10073373 Ga0265332_100733732 298
40 3300031250 Ga0265331_10037040 Ga0265331_100370402 298
41 3300031548 Ga0307408_100431326 Ga0307408_1004313261 298
42 3300031711 Ga0265314_10093386 Ga0265314_100933862 298
43 3300061734 Ga0530510_0142139 Ga0530510_0142139_311_1315 298
44 3300005981 Ga0081538_10062793 Ga0081538_100627932 299
45 3300005981 Ga0081538_10042847 Ga0081538_100428474 300
46 3300026075 Ga0207708_10163372 Ga0207708_101633722 301
47 3300005937 Ga0081455_10007064 Ga0081455_100070649 302
48 3300009094 Ga0111539_10329595 Ga0111539_103295952 306
49 3300027907 Ga0207428_10092453 Ga0207428_100924533 306
50 3300049590 Ga0501074_0139123 Ga0501074_0139123_724_1722 306
51 3300005937 Ga0081455_10137053 Ga0081455_101370532 307
52 iso_pu_bacteria 2878781027 2878788728 307
53 3300053139 Ga0500568_0000019 Ga0500568_0000019_138474_139490 308
54 iso_pu_bacteria 8001845381 8001846540 308
55 3300005535 Ga0070684_100218829 Ga0070684_1002188292 309
56 3300013105 Ga0157369_10328031 Ga0157369_103280312 309
57 3300031691 Ga0316579_10014395 Ga0316579_100143953 309
58 3300049570 Ga0501033_0031406 Ga0501033_0031406_2759_3763 309
59 3300049571 Ga0501034_0334539 Ga0501034_0334539_126_1130 309
60 3300049823 Ga0501044_0213450 Ga0501044_0213450_681_1685 309
61 3300053125 Ga0500618_000131 Ga0500618_000131_47666_48667 309
62 iso_pu_bacteria 2508501123 2509113060 309
63 iso_pu_bacteria 2513237351 2514587907 309
64 iso_pu_bacteria 2856320880 2856327557 309
65 iso_pu_bacteria 2869278585 2869280446 309
66 iso_pu_bacteria 2874139085 2874144142 309
67 iso_pu_bacteria 2878738818 2878745137 309
68 iso_pu_bacteria 2924776078 2924783274 309
69 iso_pu_bacteria 2937877337 2937882199 309
70 iso_pu_bacteria 2937972304 2937978660 309
71 iso_pu_bacteria 2958034702 2958036316 309
72 iso_pu_bacteria 2958041894 2958045680 309
73 iso_pu_bacteria 2958064165 2958064447 309
74 iso_pu_bacteria 2958084443 2958089321 309
75 iso_pu_bacteria 2958092219 2958093933 309
76 iso_pu_bacteria 2958144490 2958146693 309
77 iso_pu_bacteria 2968016561 2968018527 309
78 iso_pu_bacteria 2970469710 2970471300 309
79 iso_pu_bacteria 2970593180 2970595043 309
80 iso_pu_bacteria 2996310559 2996316541 309
81 iso_pu_bacteria 2996336353 2996337461 309
82 iso_pu_bacteria 2996348954 2996350091 309
83 iso_pu_bacteria 3004275668 3004276790 309
84 3300003203 JGI25406J46586_10006298 JGI25406J46586_100062982 310
85 3300005353 Ga0070669_100131177 Ga0070669_1001311772 310
86 3300005548 Ga0070665_100106939 Ga0070665_1001069393 310
87 3300005985 Ga0081539_10000310 Ga0081539_1000031021 310
88 3300025972 Ga0207668_10288430 Ga0207668_102884302 310
89 3300028794 Ga0307515_10110312 Ga0307515_101103122 310
90 3300030522 Ga0307512_10006891 Ga0307512_100068913 310
91 3300031456 Ga0307513_10095151 Ga0307513_100951512 310
92 3300032126 Ga0307415_100041963 Ga0307415_1000419633 310
93 iso_pu_bacteria 2503198000 2503201456 310
94 iso_pu_bacteria 2508501127 2509143968 310
95 iso_pu_bacteria 2509276018 2509367904 310
96 iso_pu_bacteria 2509276022 2509396233 310
97 iso_pu_bacteria 2510065059 2510315586 310
98 iso_pu_bacteria 2512875016 2512931574 310
99 iso_pu_bacteria 2512875024 2512959408 310
100 iso_pu_bacteria 2513237090 2513611363 310
101 iso_pu_bacteria 2513237164 2514033536 310
102 iso_pu_bacteria 2513237305 2514419671 310
103 iso_pu_bacteria 2588253730 2588517414 310
104 iso_pu_bacteria 2597489875 2597813303 310
105 iso_pu_bacteria 2599185301 2599936826 310
106 iso_pu_bacteria 2643221595 2643986874 310
107 iso_pu_bacteria 2643221627 2644156283 310
108 iso_pu_bacteria 2675903059 2676479947 310
109 iso_pu_bacteria 2687453392 2688598367 310
110 iso_pu_bacteria 2693429783 2694631005 310
111 iso_pu_bacteria 2721755686 2723575303 310
112 iso_pu_bacteria 2756170246 2756672523 310
113 iso_pu_bacteria 2791355123 2792752715 310
114 iso_pu_bacteria 2841734538 2841739118 310
115 iso_pu_bacteria 2844002411 2844007515 310
116 iso_pu_bacteria 2844009547 2844013620 310
117 iso_pu_bacteria 2856328259 2856334485 310
118 iso_pu_bacteria 2856334872 2856338907 310
119 iso_pu_bacteria 2856342000 2856343921 310
120 iso_pu_bacteria 2856356410 2856361968 310
121 iso_pu_bacteria 2856364286 2856369388 310
122 iso_pu_bacteria 2857349434 2857351221 310
123 iso_pu_bacteria 2857367948 2857372713 310
124 iso_pu_bacteria 2868088558 2868094568 310
125 iso_pu_bacteria 2869162929 2869167415 310
126 iso_pu_bacteria 2869169390 2869172049 310
127 iso_pu_bacteria 2869234852 2869237181 310
128 iso_pu_bacteria 2869242130 2869248631 310
129 iso_pu_bacteria 2869249662 2869253287 310
130 iso_pu_bacteria 2869256925 2869260829 310
131 iso_pu_bacteria 2869264136 2869268050 310
132 iso_pu_bacteria 2869271264 2869276452 310
133 iso_pu_bacteria 2869285874 2869286539 310
134 iso_pu_bacteria 2871429161 2871434692 310
135 iso_pu_bacteria 2871435913 2871441473 310
136 iso_pu_bacteria 2871451962 2871459498 310
137 iso_pu_bacteria 2871459585 2871466788 310
138 iso_pu_bacteria 2871466892 2871473543 310
139 iso_pu_bacteria 2871474448 2871475472 310
140 iso_pu_bacteria 2871488783 2871494614 310
141 iso_pu_bacteria 2871495908 2871501471 310
142 iso_pu_bacteria 2874109183 2874112551 310
143 iso_pu_bacteria 2874116593 2874116900 310
144 iso_pu_bacteria 2874123672 2874130530 310
145 iso_pu_bacteria 2874131515 2874137350 310
146 iso_pu_bacteria 2874146452 2874149897 310
147 iso_pu_bacteria 2874155637 2874158155 310
148 iso_pu_bacteria 2874162495 2874164504 310
149 iso_pu_bacteria 2874168670 2874169776 310
150 iso_pu_bacteria 2876363079 2876368556 310
151 iso_pu_bacteria 2876369609 2876375033 310
152 iso_pu_bacteria 2876386047 2876390856 310
153 iso_pu_bacteria 2876392853 2876398366 310
154 iso_pu_bacteria 2876399893 2876403649 310
155 iso_pu_bacteria 2876406927 2876412610 310
156 iso_pu_bacteria 2876413966 2876416359 310
157 iso_pu_bacteria 2876420981 2876426917 310
158 iso_pu_bacteria 2878730984 2878738813 310
159 iso_pu_bacteria 2878745973 2878751825 310
160 iso_pu_bacteria 2878753008 2878758804 310
161 iso_pu_bacteria 2878760144 2878765451 310
162 iso_pu_bacteria 2878767105 2878773159 310
163 iso_pu_bacteria 2878774303 2878774698 310
164 iso_pu_bacteria 2881147464 2881151256 310
165 iso_pu_bacteria 2881155292 2881161731 310
166 iso_pu_bacteria 2881161766 2881167456 310
167 iso_pu_bacteria 2881845957 2881846195 310
168 iso_pu_bacteria 2881853255 2881857884 310
169 iso_pu_bacteria 2881861095 2881861736 310
170 iso_pu_bacteria 2882632389 2882636198 310
171 iso_pu_bacteria 2882912400 2882914616 310
172 iso_pu_bacteria 2884693830 2884700972 310
173 iso_pu_bacteria 2885305155 2885309353 310
174 iso_pu_bacteria 2885312484 2885318056 310
175 iso_pu_bacteria 2885318864 2885320860 310
176 iso_pu_bacteria 2885326080 2885327707 310
177 iso_pu_bacteria 2885334103 2885340419 310
178 iso_pu_bacteria 2885350715 2885357466 310
179 iso_pu_bacteria 2888337043 2888339347 310
180 iso_pu_bacteria 2888343758 2888346723 310
181 iso_pu_bacteria 2888350351 2888355688 310
182 iso_pu_bacteria 2889010040 2889010624 310
183 iso_pu_bacteria 2889016732 2889017675 310
184 iso_pu_bacteria 2889790730 2889790964 310
185 iso_pu_bacteria 2889914905 2889915347 310
186 iso_pu_bacteria 2895427314 2895436262 310
187 iso_pu_bacteria 2895442618 2895452310 310
188 iso_pu_bacteria 2903448605 2903451238 310
189 iso_pu_bacteria 2903492973 2903503957 310
190 iso_pu_bacteria 2903492973 2903504771 310
191 iso_pu_bacteria 2903521522 2903527555 310
192 iso_pu_bacteria 2903528002 2903534009 310
193 iso_pu_bacteria 2903540706 2903546282 310
194 iso_pu_bacteria 2904659560 2904664921 310
195 iso_pu_bacteria 2906308376 2906314223 310
196 iso_pu_bacteria 2906321335 2906327389 310
197 iso_pu_bacteria 2906363423 2906365636 310
198 iso_pu_bacteria 2906370794 2906374185 310
199 iso_pu_bacteria 2906378014 2906380542 310
200 iso_pu_bacteria 2906393657 2906399528 310
201 iso_pu_bacteria 2906401398 2906403799 310
202 iso_pu_bacteria 2906408224 2906408824 310
203 iso_pu_bacteria 2906427513 2906434601 310
204 iso_pu_bacteria 2922130491 2922135131 310
205 iso_pu_bacteria 2922151315 2922155348 310
206 iso_pu_bacteria 2922172374 2922175314 310
207 iso_pu_bacteria 2922178524 2922181604 310
208 iso_pu_bacteria 2922185730 2922194032 310
209 iso_pu_bacteria 2924733363 2924735859 310
210 iso_pu_bacteria 2924741084 2924746603 310
211 iso_pu_bacteria 2924748358 2924749361 310
212 iso_pu_bacteria 2924754689 2924757361 310
213 iso_pu_bacteria 2924762789 2924765036 310
214 iso_pu_bacteria 2924784321 2924789006 310
215 iso_pu_bacteria 2937813078 2937815667 310
216 iso_pu_bacteria 2937822353 2937824368 310
217 iso_pu_bacteria 2937836603 2937842086 310
218 iso_pu_bacteria 2937848649 2937854465 310
219 iso_pu_bacteria 2937861824 2937868402 310
220 iso_pu_bacteria 2937868953 2937874907 310
221 iso_pu_bacteria 2937980651 2937983328 310
222 iso_pu_bacteria 2937994558 2938000140 310
223 iso_pu_bacteria 2958071322 2958072042 310
224 iso_pu_bacteria 2958100919 2958103073 310
225 iso_pu_bacteria 2958108152 2958113321 310
226 iso_pu_bacteria 2958122699 2958124711 310
227 iso_pu_bacteria 2958130278 2958130942 310
228 iso_pu_bacteria 2958137437 2958141626 310
229 iso_pu_bacteria 2958158011 2958162212 310
230 iso_pu_bacteria 2958165035 2958170604 310
231 iso_pu_bacteria 2958172287 2958174591 310
232 iso_pu_bacteria 2958179912 2958184863 310
233 iso_pu_bacteria 2961077736 2961083030 310
234 iso_pu_bacteria 2961114664 2961119920 310
235 iso_pu_bacteria 2961127735 2961131722 310
236 iso_pu_bacteria 2961136820 2961142268 310
237 iso_pu_bacteria 2961163497 2961169059 310
238 iso_pu_bacteria 2961170736 2961176118 310
239 iso_pu_bacteria 2961183825 2961184353 310
240 iso_pu_bacteria 2963644680 2963647637 310
241 iso_pu_bacteria 2965018300 2965024346 310
242 iso_pu_bacteria 2965025482 2965031834 310
243 iso_pu_bacteria 2965040258 2965044545 310
244 iso_pu_bacteria 2965047637 2965053047 310
245 iso_pu_bacteria 2965089291 2965096013 310
246 iso_pu_bacteria 2965102966 2965108453 310
247 iso_pu_bacteria 2965110997 2965115699 310
248 iso_pu_bacteria 2965119406 2965120562 310
249 iso_pu_bacteria 2967996073 2968002005 310
250 iso_pu_bacteria 2968003550 2968008971 310
251 iso_pu_bacteria 2968083720 2968090268 310
252 iso_pu_bacteria 2968110612 2968116277 310
253 iso_pu_bacteria 2968117919 2968119881 310
254 iso_pu_bacteria 2968171901 2968177453 310
255 iso_pu_bacteria 2970489779 2970492961 310
256 iso_pu_bacteria 2970503327 2970508784 310
257 iso_pu_bacteria 2970510686 2970517391 310
258 iso_pu_bacteria 2970524798 2970528507 310
259 iso_pu_bacteria 2970532167 2970534605 310
260 iso_pu_bacteria 2970540015 2970540784 310
261 iso_pu_bacteria 2970547951 2970548926 310
262 iso_pu_bacteria 2970554993 2970560299 310
263 iso_pu_bacteria 2970627176 2970627527 310
264 iso_pu_bacteria 2977821940 2977827344 310
265 iso_pu_bacteria 2977828996 2977834454 310
266 iso_pu_bacteria 2977843712 2977845903 310
267 iso_pu_bacteria 2977851361 2977855837 310
268 iso_pu_bacteria 2977864932 2977867155 310
269 iso_pu_bacteria 2977872689 2977876878 310
270 iso_pu_bacteria 2977898635 2977899220 310
271 iso_pu_bacteria 2977915119 2977915481 310
272 iso_pu_bacteria 2977922695 2977924146 310
273 iso_pu_bacteria 2977935797 2977936095 310
274 iso_pu_bacteria 2977942078 2977942681 310
275 iso_pu_bacteria 2977950692 2977954846 310
276 iso_pu_bacteria 2977957713 2977960224 310
277 iso_pu_bacteria 2977971508 2977974891 310
278 iso_pu_bacteria 2977986579 2977990081 310
279 iso_pu_bacteria 2979764755 2979767606 310
280 iso_pu_bacteria 2979772303 2979775560 310
281 iso_pu_bacteria 2979793036 2979795825 310
282 iso_pu_bacteria 2979808191 2979811568 310
283 iso_pu_bacteria 2987636660 2987638405 310
284 iso_pu_bacteria 2987645492 2987646879 310
285 iso_pu_bacteria 2987652177 2987657261 310
286 iso_pu_bacteria 2987659509 2987665090 310
287 iso_pu_bacteria 2987666974 2987667942 310
288 iso_pu_bacteria 2987673487 2987680833 310
289 iso_pu_bacteria 2996386984 2996392268 310
290 iso_pu_bacteria 3000135777 3000140749 310
291 iso_pu_bacteria 3004167301 3004168816 310
292 iso_pu_bacteria 3004188549 3004194147 310
293 iso_pu_bacteria 3004195979 3004199997 310
294 iso_pu_bacteria 3004203850 3004205351 310
295 iso_pu_bacteria 3004211236 3004215881 310
296 iso_pu_bacteria 3004218560 3004221953 310
297 iso_pu_bacteria 3004232784 3004237093 310
298 iso_pu_bacteria 3004239961 3004243219 310
299 iso_pu_bacteria 3004248173 3004252567 310
300 iso_pu_bacteria 3004268573 3004274857 310
301 iso_pu_bacteria 3004334049 3004334439 310
302 iso_pu_bacteria 637000159 637074673 310
303 iso_pu_bacteria 649633066 649872895 310
304 iso_pu_bacteria 8004300914 8004303847 310
305 iso_pu_bacteria 8004312739 8004318853 310
306 iso_pu_bacteria 8004361976 8004367109 310
307 iso_pu_bacteria 8004374579 8004380325 310
308 iso_pu_bacteria 8004387939 8004393713 310
309 iso_pu_bacteria 8004395343 8004400767 310
310 iso_pu_bacteria 8004633249 8004637818 310
311 iso_pu_bacteria 8004640170 8004640896 310
312 iso_pu_bacteria 8004695233 8004698443 310
313 iso_pu_bacteria 8004714634 8004720481 310
314 iso_pu_bacteria 8004727605 8004734043 310
315 iso_pu_bacteria 8054558443 8054560612 310
316 iso_pu_bacteria 8055066027 8055069610 310
317 iso_pu_bacteria 8055617313 8055620698 310
318 3300005290 Ga0065712_10077926 Ga0065712_100779262 311
319 3300005293 Ga0065715_10000926 Ga0065715_100009262 311
320 3300005356 Ga0070674_100158593 Ga0070674_1001585932 311
321 3300005548 Ga0070665_100171801 Ga0070665_1001718012 311
322 3300009147 Ga0114129_10305234 Ga0114129_103052342 311
323 3300025908 Ga0207643_10018461 Ga0207643_100184615 311
324 3300028786 Ga0307517_10024087 Ga0307517_100240877 311
325 3300037312 Ga0395899_0127808 Ga0395899_0127808_608_1612 311
326 3300037418 Ga0395900_0221391 Ga0395900_0221391_584_1588 311
327 3300037466 Ga0395898_0125867 Ga0395898_0125867_323_1327 311
328 3300038443 Ga0395901_0107944 Ga0395901_0107944_1746_2750 311
329 3300046522 Ga0495643_0049019 Ga0495643_0049019_601_1602 311
330 3300046558 Ga0495633_0139264 Ga0495633_0139264_14_1015 311
331 3300048915 Ga0496112_0146270 Ga0496112_0146270_692_1702 311
332 3300049579 Ga0501043_0050591 Ga0501043_0050591_1304_2314 311
333 3300049586 Ga0501070_0077106 Ga0501070_0077106_840_1850 311
334 3300049586 Ga0501070_0115954 Ga0501070_0115954_328_1332 311
335 3300049589 Ga0501073_0004199 Ga0501073_0004199_86_1111 311
336 3300053125 Ga0500618_000229 Ga0500618_000229_5114_6115 311
337 3300053153 Ga0500616_0000746 Ga0500616_0000746_1254_2267 311
338 3300003794 Ga0055531_10014220 Ga0055531_100142204 312
339 3300005334 Ga0068869_100114693 Ga0068869_1001146932 312
340 3300005334 Ga0068869_100399907 Ga0068869_1003999071 312
341 3300005564 Ga0070664_100036828 Ga0070664_1000368282 312
342 3300005844 Ga0068862_100318049 Ga0068862_1003180492 312
343 3300005937 Ga0081455_10035932 Ga0081455_100359324 312
344 3300005937 Ga0081455_10125372 Ga0081455_101253722 312
345 3300005981 Ga0081538_10034084 Ga0081538_100340842 312
346 3300005981 Ga0081538_10107367 Ga0081538_101073671 312
347 3300005983 Ga0081540_1013759 Ga0081540_10137593 312
348 3300005983 Ga0081540_1066863 Ga0081540_10668632 312
349 3300009148 Ga0105243_10174296 Ga0105243_101742962 312
350 3300025298 Ga0209050_1010032 Ga0209050_10100324 312
351 3300025302 Ga0207426_1018145 Ga0207426_10181452 312
352 3300025304 Ga0209257_1001205 Ga0209257_10012052 312
353 3300025942 Ga0207689_10109585 Ga0207689_101095853 312
354 3300025942 Ga0207689_10286054 Ga0207689_102860542 312
355 3300025944 Ga0207661_10083755 Ga0207661_100837552 312
356 3300028794 Ga0307515_10000950 Ga0307515_1000095041 312
357 3300031456 Ga0307513_10034954 Ga0307513_100349543 312
358 3300031727 Ga0316576_10134217 Ga0316576_101342172 312
359 3300044901 Ga0466960_0006929 Ga0466960_0006929_1863_2870 312
360 3300046460 Ga0495638_0023757 Ga0495638_0023757_898_1905 312
361 3300048918 Ga0496115_0176301 Ga0496115_0176301_24_1028 312
362 3300048922 Ga0496119_0163510 Ga0496119_0163510_167_1168 312
363 3300049568 Ga0501031_0074474 Ga0501031_0074474_893_1894 312
364 3300049569 Ga0501032_0023569 Ga0501032_0023569_234_1259 312
365 3300049569 Ga0501032_0166784 Ga0501032_0166784_387_1388 312
366 3300049570 Ga0501033_0001198 Ga0501033_0001198_8994_10019 312
367 3300049571 Ga0501034_0265952 Ga0501034_0265952_221_1225 312
368 3300049572 Ga0501036_0101184 Ga0501036_0101184_350_1351 312
369 3300049573 Ga0501037_0000077 Ga0501037_0000077_73377_74402 312
370 3300049575 Ga0501039_0021955 Ga0501039_0021955_3575_4576 312
371 3300049577 Ga0501041_0108784 Ga0501041_0108784_285_1286 312
372 3300049579 Ga0501043_0000114 Ga0501043_0000114_31729_32754 312
373 3300049581 Ga0501047_0232109 Ga0501047_0232109_297_1322 312
374 3300049585 Ga0501069_0000016 Ga0501069_0000016_43468_44493 312
375 3300049586 Ga0501070_0000450 Ga0501070_0000450_17302_18327 312
376 3300049587 Ga0501071_0012836 Ga0501071_0012836_2591_3592 312
377 3300049587 Ga0501071_0020467 Ga0501071_0020467_904_1929 312
378 3300049588 Ga0501072_0166728 Ga0501072_0166728_472_1473 312
379 3300049589 Ga0501073_0196665 Ga0501073_0196665_86_1090 312
380 3300049590 Ga0501074_0000067 Ga0501074_0000067_28016_29041 312
381 3300049590 Ga0501074_0219969 Ga0501074_0219969_12_1013 312
382 3300049591 Ga0501075_0239803 Ga0501075_0239803_317_1318 312
383 3300049742 Ga0501080_0000591 Ga0501080_0000591_7084_8109 312
384 3300049742 Ga0501080_0353060 Ga0501080_0353060_219_1223 312
385 3300049743 Ga0501081_0258514 Ga0501081_0258514_67_1068 312
386 3300049744 Ga0501083_0000111 Ga0501083_0000111_44268_45293 312
387 3300049822 Ga0501035_0000048 Ga0501035_0000048_134883_135908 312
388 3300049823 Ga0501044_0000003 Ga0501044_0000003_118070_119095 312
389 3300049823 Ga0501044_0142450 Ga0501044_0142450_508_1512 312
390 3300050509 nmdc:mga0qj67_293944_c1 nmdc:mga0qj67_293944_c1_205_1206 312
391 3300053151 Ga0500604_0008420 Ga0500604_0008420_1198_2214 312
392 3300054114 Ga0501084_0133414 Ga0501084_0133414_560_1561 312
393 3300003203 JGI25406J46586_10007914 JGI25406J46586_100079145 313
394 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015250 313
395 3300003762 Ga0055542_1000406 Ga0055542_100040633 313
396 3300005327 Ga0070658_10102084 Ga0070658_101020842 313
397 3300005366 Ga0070659_100284247 Ga0070659_1002842472 313
398 3300005435 Ga0070714_100079058 Ga0070714_1000790582 313
399 3300005459 Ga0068867_100067498 Ga0068867_1000674982 313
400 3300005467 Ga0070706_100212785 Ga0070706_1002127852 313
401 3300005468 Ga0070707_100191052 Ga0070707_1001910522 313
402 3300005471 Ga0070698_100002827 Ga0070698_10000282714 313
403 3300005518 Ga0070699_100427383 Ga0070699_1004273831 313
404 3300005539 Ga0068853_100256884 Ga0068853_1002568842 313
405 3300005844 Ga0068862_100010968 Ga0068862_1000109684 313
406 3300005981 Ga0081538_10005290 Ga0081538_1000529011 313
407 3300005985 Ga0081539_10004719 Ga0081539_100047195 313
408 3300006028 Ga0070717_10083269 Ga0070717_100832692 313
409 3300006178 Ga0075367_10086548 Ga0075367_100865482 313
410 3300009147 Ga0114129_10617482 Ga0114129_106174821 313
411 3300014968 Ga0157379_10485997 Ga0157379_104859972 313
412 3300025253 Ga0209677_108050 Ga0209677_1080502 313
413 3300025254 Ga0209148_1000181 Ga0209148_100018119 313
414 3300025261 Ga0209233_1000010 Ga0209233_1000010348 313
415 3300025272 Ga0209455_1000127 Ga0209455_100012719 313
416 3300025910 Ga0207684_10191893 Ga0207684_101918932 313
417 3300025911 Ga0207654_10064432 Ga0207654_100644322 313
418 3300025920 Ga0207649_10130875 Ga0207649_101308752 313
419 3300025922 Ga0207646_10047631 Ga0207646_100476312 313
420 3300025929 Ga0207664_10066080 Ga0207664_100660802 313
421 3300025940 Ga0207691_10057218 Ga0207691_100572182 313
422 3300025944 Ga0207661_10304454 Ga0207661_103044542 313
423 3300025981 Ga0207640_10204095 Ga0207640_102040952 313
424 3300026142 Ga0207698_10189682 Ga0207698_101896822 313
425 3300026142 Ga0207698_10205540 Ga0207698_102055401 313
426 3300027907 Ga0207428_10201387 Ga0207428_102013872 313
427 3300028380 Ga0268265_10009849 Ga0268265_100098495 313
428 3300031901 Ga0307406_10287025 Ga0307406_102870252 313
429 3300039437 Ga0436365_1305769 Ga0436365_1305769_20_1024 313
430 3300041494 Ga0451837_0747065 Ga0451837_0747065_105_1121 313
431 3300046460 Ga0495638_0055505 Ga0495638_0055505_499_1509 313
432 3300048911 Ga0496108_0173314 Ga0496108_0173314_207_1217 313
433 3300048921 Ga0496118_0053400 Ga0496118_0053400_1455_2459 313
434 3300049568 Ga0501031_0032138 Ga0501031_0032138_1485_2492 313
435 3300049569 Ga0501032_0019826 Ga0501032_0019826_2784_3791 313
436 3300049569 Ga0501032_0020200 Ga0501032_0020200_2342_3349 313
437 3300049570 Ga0501033_0023960 Ga0501033_0023960_2185_3192 313
438 3300049570 Ga0501033_0030713 Ga0501033_0030713_1526_2533 313
439 3300049571 Ga0501034_0065517 Ga0501034_0065517_931_1938 313
440 3300049571 Ga0501034_0065519 Ga0501034_0065519_1708_2715 313
441 3300049571 Ga0501034_0099566 Ga0501034_0099566_221_1228 313
442 3300049571 Ga0501034_0210141 Ga0501034_0210141_600_1613 313
443 3300049571 Ga0501034_0434820 Ga0501034_0434820_171_1178 313
444 3300049572 Ga0501036_0018403 Ga0501036_0018403_931_1938 313
445 3300049573 Ga0501037_0013496 Ga0501037_0013496_1859_2866 313
446 3300049573 Ga0501037_0020511 Ga0501037_0020511_1689_2696 313
447 3300049574 Ga0501038_0022496 Ga0501038_0022496_931_1938 313
448 3300049574 Ga0501038_0040409 Ga0501038_0040409_931_1938 313
449 3300049575 Ga0501039_0044165 Ga0501039_0044165_931_1938 313
450 3300049578 Ga0501042_0150798 Ga0501042_0150798_521_1528 313
451 3300049579 Ga0501043_0009321 Ga0501043_0009321_2936_3943 313
452 3300049579 Ga0501043_0010387 Ga0501043_0010387_5359_6366 313
453 3300049580 Ga0501046_0070583 Ga0501046_0070583_333_1337 313
454 3300049581 Ga0501047_0009607 Ga0501047_0009607_1504_2511 313
455 3300049581 Ga0501047_0026908 Ga0501047_0026908_2185_3192 313
456 3300049582 Ga0501048_0042883 Ga0501048_0042883_1374_2381 313
457 3300049583 Ga0501067_0171497 Ga0501067_0171497_89_1093 313
458 3300049584 Ga0501068_0026799 Ga0501068_0026799_2028_3035 313
459 3300049586 Ga0501070_0030883 Ga0501070_0030883_2529_3536 313
460 3300049587 Ga0501071_0140404 Ga0501071_0140404_778_1782 313
461 3300049589 Ga0501073_0159119 Ga0501073_0159119_297_1304 313
462 3300049590 Ga0501074_0041322 Ga0501074_0041322_1558_2565 313
463 3300049590 Ga0501074_0123608 Ga0501074_0123608_110_1114 313
464 3300049590 Ga0501074_0208151 Ga0501074_0208151_214_1218 313
465 3300049742 Ga0501080_0141495 Ga0501080_0141495_881_1888 313
466 3300049743 Ga0501081_0192410 Ga0501081_0192410_333_1337 313
467 3300049822 Ga0501035_0102007 Ga0501035_0102007_580_1587 313
468 3300049823 Ga0501044_0029486 Ga0501044_0029486_1981_2988 313
469 3300049823 Ga0501044_0123308 Ga0501044_0123308_135_1154 313
470 3300050494 nmdc:mga06z11_31359_c1 nmdc:mga06z11_31359_c1_565_1578 313
471 3300050496 nmdc:mga07m45_17984_c1 nmdc:mga07m45_17984_c1_2511_3515 313
472 3300050507 nmdc:mga05p37_338009_c1 nmdc:mga05p37_338009_c1_178_1188 313
473 3300050507 nmdc:mga05p37_389833_c1 nmdc:mga05p37_389833_c1_475_1491 313
474 3300050510 nmdc:mga06r32_390300_c1 nmdc:mga06r32_390300_c1_345_1355 313
475 3300050511 nmdc:mga08y16_155704_c1 nmdc:mga08y16_155704_c1_163_1173 313
476 3300050512 nmdc:mga0n895_465585_c1 nmdc:mga0n895_465585_c1_49_1056 313
477 3300053093 Ga0500651_0002171 Ga0500651_0002171_530_1549 313
478 3300053103 Ga0500555_014404 Ga0500555_014404_101_1120 313
479 3300053119 Ga0500595_000361 Ga0500595_000361_27491_28510 313
480 3300053134 Ga0500658_0016549 Ga0500658_0016549_139_1158 313
481 3300053139 Ga0500568_0003338 Ga0500568_0003338_4433_5452 313
482 3300053156 Ga0500622_0076039 Ga0500622_0076039_384_1403 313
483 3300054114 Ga0501084_0095723 Ga0501084_0095723_755_1759 313
484 3300061734 Ga0530510_0341454 Ga0530510_0341454_89_1093 313
485 3300002705 JGI25156J39149_1008816 JGI25156J39149_10088162 314
486 3300002741 JGI25157J39369_1001276 JGI25157J39369_10012762 314
487 3300003203 JGI25406J46586_10005586 JGI25406J46586_100055862 314
488 3300003215 JGI25153J46596_10000059 JGI25153J46596_1000005997 314
489 3300005347 Ga0070668_100002957 Ga0070668_1000029578 314
490 3300005366 Ga0070659_100071379 Ga0070659_1000713792 314
491 3300005459 Ga0068867_100173398 Ga0068867_1001733982 314
492 3300005548 Ga0070665_100159725 Ga0070665_1001597252 314
493 3300005564 Ga0070664_100139571 Ga0070664_1001395712 314
494 3300005983 Ga0081540_1116014 Ga0081540_11160142 314
495 3300005985 Ga0081539_10001609 Ga0081539_1000160932 314
496 3300006038 Ga0075365_10106791 Ga0075365_101067912 314
497 3300006051 Ga0075364_10141628 Ga0075364_101416282 314
498 3300006177 Ga0075362_10001553 Ga0075362_100015536 314
499 3300009545 Ga0105237_10320634 Ga0105237_103206342 314
500 3300009551 Ga0105238_10025302 Ga0105238_100253026 314
501 3300025250 Ga0209026_1000025 Ga0209026_100002561 314
502 3300025256 Ga0209759_1000226 Ga0209759_100022641 314
503 3300025297 Ga0209758_1000095 Ga0209758_1000095136 314
504 3300025297 Ga0209758_1009435 Ga0209758_10094354 314
505 3300025297 Ga0209758_1018447 Ga0209758_10184472 314
506 3300025919 Ga0207657_10239167 Ga0207657_102391672 314
507 3300025923 Ga0207681_10177610 Ga0207681_101776102 314
508 3300025923 Ga0207681_10217637 Ga0207681_102176372 314
509 3300025924 Ga0207694_10009950 Ga0207694_100099502 314
510 3300025938 Ga0207704_10298007 Ga0207704_102980072 314
511 3300025972 Ga0207668_10000451 Ga0207668_1000045123 314
512 3300026041 Ga0207639_10013061 Ga0207639_100130612 314
513 3300026089 Ga0207648_10188689 Ga0207648_101886892 314
514 3300028558 Ga0265326_10009846 Ga0265326_100098462 314
515 3300028563 Ga0265319_1002662 Ga0265319_10026629 314
516 3300028563 Ga0265319_1003852 Ga0265319_10038523 314
517 3300028573 Ga0265334_10005152 Ga0265334_100051522 314
518 3300028573 Ga0265334_10006850 Ga0265334_100068506 314
519 3300028577 Ga0265318_10000753 Ga0265318_100007536 314
520 3300028577 Ga0265318_10011081 Ga0265318_100110813 314
521 3300028577 Ga0265318_10021909 Ga0265318_100219092 314
522 3300028577 Ga0265318_10028074 Ga0265318_100280742 314
523 3300028653 Ga0265323_10014045 Ga0265323_100140452 314
524 3300028794 Ga0307515_10012424 Ga0307515_100124246 314
525 3300031090 Ga0265760_10012252 Ga0265760_100122523 314
526 3300031235 Ga0265330_10005444 Ga0265330_100054444 314
527 3300031235 Ga0265330_10031135 Ga0265330_100311352 314
528 3300031238 Ga0265332_10029088 Ga0265332_100290882 314
529 3300031238 Ga0265332_10067365 Ga0265332_100673652 314
530 3300031239 Ga0265328_10001487 Ga0265328_100014874 314
531 3300031240 Ga0265320_10007316 Ga0265320_100073168 314
532 3300031240 Ga0265320_10065163 Ga0265320_100651632 314
533 3300031241 Ga0265325_10003209 Ga0265325_1000320910 314
534 3300031242 Ga0265329_10007966 Ga0265329_100079664 314
535 3300031242 Ga0265329_10008622 Ga0265329_100086224 314
536 3300031247 Ga0265340_10013058 Ga0265340_100130583 314
537 3300031247 Ga0265340_10014463 Ga0265340_100144635 314
538 3300031249 Ga0265339_10015660 Ga0265339_100156604 314
539 3300031249 Ga0265339_10110191 Ga0265339_101101912 314
540 3300031249 Ga0265339_10136082 Ga0265339_101360822 314
541 3300031250 Ga0265331_10013395 Ga0265331_100133954 314
542 3300031251 Ga0265327_10013762 Ga0265327_100137622 314
543 3300031344 Ga0265316_10014087 Ga0265316_100140874 314
544 3300031344 Ga0265316_10042539 Ga0265316_100425393 314
545 3300031456 Ga0307513_10001342 Ga0307513_1000134224 314
546 3300031456 Ga0307513_10025115 Ga0307513_100251157 314
547 3300031548 Ga0307408_100149413 Ga0307408_1001494132 314
548 3300031595 Ga0265313_10024901 Ga0265313_100249013 314
549 3300031691 Ga0316579_10005481 Ga0316579_100054811 314
550 3300031711 Ga0265314_10016088 Ga0265314_100160886 314
551 3300031712 Ga0265342_10021752 Ga0265342_100217522 314
552 3300031727 Ga0316576_10028732 Ga0316576_100287323 314
553 3300031728 Ga0316578_10005462 Ga0316578_100054625 314
554 3300031728 Ga0316578_10051093 Ga0316578_100510932 314
555 3300031730 Ga0307516_10002882 Ga0307516_1000288212 314
556 3300031730 Ga0307516_10012820 Ga0307516_100128207 314
557 3300031730 Ga0307516_10023146 Ga0307516_100231462 314
558 3300031730 Ga0307516_10051377 Ga0307516_100513774 314
559 3300031730 Ga0307516_10158596 Ga0307516_101585962 314
560 3300031733 Ga0316577_10012737 Ga0316577_100127371 314
561 3300031733 Ga0316577_10069853 Ga0316577_100698532 314
562 3300032126 Ga0307415_100035697 Ga0307415_1000356973 314
563 3300032137 Ga0316585_10021224 Ga0316585_100212242 314
564 3300032139 Ga0316580_10021998 Ga0316580_100219982 314
565 3300033524 Ga0316592_1003023 Ga0316592_10030231 314
566 3300035398 Ga0316574_0038430 Ga0316574_0038430_786_1796 314
567 3300035398 Ga0316574_0079962 Ga0316574_0079962_546_1586 314
568 3300036647 Ga0316582_0047599 Ga0316582_0047599_345_1355 314
569 3300036712 Ga0316584_0006854 Ga0316584_0006854_2231_3241 314
570 3300037418 Ga0395900_0370545 Ga0395900_0370545_62_1066 314
571 3300037471 Ga0395905_0178873 Ga0395905_0178873_792_1796 314
572 3300037471 Ga0395905_0227281 Ga0395905_0227281_477_1481 314
573 3300038443 Ga0395901_0080348 Ga0395901_0080348_497_1501 314
574 3300038443 Ga0395901_0175766 Ga0395901_0175766_1223_2227 314
575 3300038443 Ga0395901_0197332 Ga0395901_0197332_264_1268 314
576 3300041451 Ga0451791_1107066 Ga0451791_1107066_120_1139 314
577 3300041494 Ga0451837_1649215 Ga0451837_1649215_82_1092 314
578 3300044658 Ga0466972_0050330 Ga0466972_0050330_934_1938 314
579 3300044658 Ga0466972_0067698 Ga0466972_0067698_30_1034 314
580 3300044683 Ga0466965_0108998 Ga0466965_0108998_71_1075 314
581 3300046460 Ga0495638_0023898 Ga0495638_0023898_1986_2996 314
582 3300046542 Ga0495597_0047204 Ga0495597_0047204_94_1098 314
583 3300046660 Ga0495625_0009140 Ga0495625_0009140_620_1624 314
584 3300048911 Ga0496108_0221821 Ga0496108_0221821_139_1143 314
585 3300048923 Ga0496120_0004296 Ga0496120_0004296_9357_10361 314
586 3300048924 Ga0496121_0055037 Ga0496121_0055037_1970_2974 314
587 3300048924 Ga0496121_0175352 Ga0496121_0175352_205_1209 314
588 3300048927 Ga0496124_0245006 Ga0496124_0245006_209_1213 314
589 3300049570 Ga0501033_0218009 Ga0501033_0218009_324_1349 314
590 3300049573 Ga0501037_0081020 Ga0501037_0081020_1110_2135 314
591 3300049574 Ga0501038_0093156 Ga0501038_0093156_821_1843 314
592 3300049576 Ga0501040_0035266 Ga0501040_0035266_858_1886 314
593 3300049577 Ga0501041_0025075 Ga0501041_0025075_2066_3094 314
594 3300049578 Ga0501042_0022122 Ga0501042_0022122_409_1437 314
595 3300049579 Ga0501043_0130386 Ga0501043_0130386_626_1651 314
596 3300049580 Ga0501046_0093446 Ga0501046_0093446_866_1891 314
597 3300049581 Ga0501047_0036844 Ga0501047_0036844_2172_3194 314
598 3300049581 Ga0501047_0042753 Ga0501047_0042753_977_2002 314
599 3300049583 Ga0501067_0019968 Ga0501067_0019968_2670_3677 314
600 3300049585 Ga0501069_0122301 Ga0501069_0122301_227_1252 314
601 3300049588 Ga0501072_0018781 Ga0501072_0018781_4088_5116 314
602 3300049589 Ga0501073_0009138 Ga0501073_0009138_3215_4222 314
603 3300049589 Ga0501073_0036031 Ga0501073_0036031_1217_2242 314
604 3300049591 Ga0501075_0001927 Ga0501075_0001927_2651_3679 314
605 3300049592 Ga0501076_0003686 Ga0501076_0003686_2482_3510 314
606 3300049592 Ga0501076_0243013 Ga0501076_0243013_273_1298 314
607 3300049593 Ga0501077_0041204 Ga0501077_0041204_1737_2765 314
608 3300049741 Ga0501079_0008207 Ga0501079_0008207_3707_4735 314
609 3300049742 Ga0501080_0023439 Ga0501080_0023439_4082_5107 314
610 3300049822 Ga0501035_0180611 Ga0501035_0180611_533_1561 314
611 3300049823 Ga0501044_0015064 Ga0501044_0015064_4874_5896 314
612 3300049823 Ga0501044_0077171 Ga0501044_0077171_576_1601 314
613 3300049824 Ga0501045_0011420 Ga0501045_0011420_3991_5019 314
614 3300050489 nmdc:mga03683_1427_c1 nmdc:mga03683_1427_c1_5113_6144 314
615 3300050492 nmdc:mga0yw44_130703_c1 nmdc:mga0yw44_130703_c1_400_1410 314
616 3300050492 nmdc:mga0yw44_28019_c1 nmdc:mga0yw44_28019_c1_308_1312 314
617 3300053077 Ga0495601_0280575 Ga0495601_0280575_68_1072 314
618 3300053079 Ga0500610_0003387 Ga0500610_0003387_858_1862 314
619 3300053086 Ga0500578_0028025 Ga0500578_0028025_2038_3063 314
620 3300053093 Ga0500651_0129202 Ga0500651_0129202_181_1206 314
621 3300053096 Ga0500641_0007120 Ga0500641_0007120_2817_3842 314
622 3300053104 Ga0500556_0001237 Ga0500556_0001237_6564_7583 314
623 3300053122 Ga0500608_038170 Ga0500608_038170_747_1757 314
624 3300053130 Ga0500642_0002844 Ga0500642_0002844_2787_3812 314
625 3300053130 Ga0500642_0110485 Ga0500642_0110485_144_1169 314
626 3300053139 Ga0500568_0027274 Ga0500568_0027274_399_1403 314
627 3300053149 Ga0500600_0025587 Ga0500600_0025587_1877_2896 314
628 3300053151 Ga0500604_0013949 Ga0500604_0013949_170_1174 314
629 3300053151 Ga0500604_0022067 Ga0500604_0022067_251_1276 314
630 3300053153 Ga0500616_0000476 Ga0500616_0000476_23924_24934 314
631 3300053156 Ga0500622_0003404 Ga0500622_0003404_6029_7039 314
632 3300053731 Ga0500609_001312 Ga0500609_001312_2495_3520 314
633 3300054114 Ga0501084_0044562 Ga0501084_0044562_1716_2744 314
634 3300054114 Ga0501084_0115201 Ga0501084_0115201_709_1734 314
635 3300060353 Ga0501082_0006257 Ga0501082_0006257_8291_9316 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20256

MoCoBD_2

Molybdopterin cofactor-binding domain

2

269

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ker-assembly1.cif.gz_A d-dopachrome tautomerase (d-dt)/ macrophage migration inhibitory factor 2 (mif2) complexed with inhibitor 4-ipp 0.7665 38 75
1pvl-assembly1.cif.gz_A structure of the panton-valentine leucocidin f component from staphylococcus aureus 0.7571 164 190
5jrl-assembly1.cif.gz_C crystal structure of the sphingopyxin i lasso peptide isopeptidase spi-isop (native) 0.7384 165 188
4gum-assembly2.cif.gz_E cystal structure of locked-trimer of human mif 0.7162 38 75
6n31-assembly1.cif.gz_A wd repeats of human wdr12 0.7162 165 189
ID Description Score Start End Superfamily
1dgjA07 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8964 164 307 3.30.365.10
3hrdF01 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8773 165 311 3.30.365.10
af_Q46799_603_751_3.30.365.10 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8598 170 312 3.30.365.10
1t3qB04 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8589 165 309 3.30.365.10
af_Q46799_603_751_3.30.365.10 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8222 170 312 3.30.365.10
ID Description Score Start End GO Terms
AF-A0A2V9Z604-F1-model_v4 Aldehyde oxidase/xanthine dehydrogenase second molybdopterin binding domain-containing protein 0.9106 168 312 GO:0016491
AF-A0A1F9EWS0-F1-model_v4 Aldehyde oxidase/xanthine dehydrogenase second molybdopterin binding domain-containing protein 0.9055 172 313 GO:0016491
AF-A0A3M1ESX0-F1-model_v4 Xanthine dehydrogenase family protein molybdopterin-binding subunit 0.9011 168 313 GO:0005506
GO:0016491
AF-A0A7J3VSV0-F1-model_v4 Xanthine dehydrogenase family protein molybdopterin-binding subunit 0.8923 172 313 GO:0016491
AF-C0D8Q4-F1-model_v4 Aldehyde oxidase/xanthine dehydrogenase second molybdopterin binding domain-containing protein 0.8904 168 313 GO:0016491

Feature Viewer

pLDDT pTM Quality
68.73 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map