F471214

General Info

Members Datasets Scaffolds Average Seq Length
634 331 570 157

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_148394_c1|nmdc:mga0k408_148394_c1_392_961
Length 189
Sequence LFVFKVIASFYKREGGFFWQPIRQLKEINIGIMAEVAYFTKEGLENLKKELQELKTTGRSNISKAIAEARDKGDLSENAEYDAAKEAQGLHEAKIAQMQETLANARLLDESKLDVSKVLALSIVKIKNVSNGATMTYQLVAESEADMKSGKISVISPIAKGLLGKKVGEIAEITVPAGTMQFEILEVSR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
4 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
5 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
6 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
7 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
8 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
9 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
10 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
11 2738541284 Pedobacter sp. YR016 Isolate Unclassified
12 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
13 2738541302 Pedobacter sp. CF074 Isolate Unclassified
14 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
15 2738543023 Pedobacter sp. OK628 Isolate Unclassified
16 2739367651 Pedobacter sp. OK291 Isolate Unclassified
17 2739367656 Pedobacter sp. CF523 Isolate Unclassified
18 2739367663 Pedobacter sp. YR510 Isolate Unclassified
19 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
20 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
21 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
22 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
23 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
24 2818991437 Pedobacter terrae 518 Isolate Unclassified
25 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
26 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
27 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
28 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
29 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
30 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
31 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
32 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
33 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
34 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
35 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
36 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
37 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
38 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
39 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
40 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
41 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
42 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
43 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
44 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
45 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
46 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
47 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
48 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
49 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
50 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
51 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
52 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
53 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
54 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
55 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
56 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
57 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
58 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
59 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
60 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
61 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
62 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
63 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
64 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
65 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
66 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
67 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
68 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
69 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
70 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
71 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
72 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
73 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
76 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
80 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
82 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
83 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
84 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
85 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
86 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
87 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
90 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
94 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
97 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
98 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
99 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
100 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
105 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
108 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
109 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
110 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
111 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
112 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
113 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
114 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
115 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
146 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
147 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
159 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
209 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
210 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
214 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
217 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
218 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
228 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
242 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
243 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
250 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
251 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
252 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
253 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
254 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
255 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
278 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
294 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
297 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
309 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
310 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
311 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
312 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
313 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
314 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
315 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
318 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
319 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
320 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
321 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
322 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
323 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
326 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
327 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
328 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
329 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
330 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
331 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.33
Metatranscriptomes 1.58
Isolates 10.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.57
Nodule 0
Rhizoplane 1.1
Rhizosphere 82.81
Stem 0
Stem Tuber 0
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2255685 2162886007 Bacteria 19658
2 SwRhRL2b_contig_677025 2162886007 Bacteria 181955
3 JGI24736J21556_1006598 3300001904 Bacteria 1953
4 JGI24737J22298_10000303 3300001990 Bacteria 16452
5 JGI24737J22298_10017213 3300001990 Bacteria 2330
6 JGI24737J22298_10027852 3300001990 Bacteria 1779
7 JGI24735J21928_10000007 3300002067 Bacteria 333510
8 JGI25162J39368_1000408 3300002737 Bacteria 35183
9 JGI25162J39368_1001130 3300002737 Bacteria 16055
10 JGI25157J39369_1026186 3300002741 Bacteria 678
11 JGI25164J39214_1001242 3300002772 Bacteria 6779
12 JGI25150J39212_1000003 3300002774 Bacteria 508651
13 JGI25151J46595_10000002 3300003187 Bacteria 731381
14 JGI25165J46597_1001079 3300003214 Bacteria 17498
15 JGI25153J46596_10000015 3300003215 Bacteria 289820
16 rootH1_10012261 3300003316 Bacteria 7196
17 rootH2_10021444 3300003320 Bacteria 14118
18 rootH2_10163983 3300003320 Bacteria 2996
19 rootL2_10017333 3300003322 Bacteria 5289
20 rootH1_10007236 3300003323 Bacteria 15279
21 rootH1_10123432 3300003323 Bacteria 1833
22 Ga0055536_1000006 3300003781 Bacteria 347733
23 Ga0055530_10003370 3300003791 Bacteria 9143
24 Ga0058863_11132184 3300004799 Bacteria 1045
25 Ga0058861_10544333 3300004800 Bacteria 669
26 Ga0065714_10002307 3300005288 Bacteria 26043
27 Ga0065714_10004556 3300005288 Bacteria 8945
28 Ga0065714_10013498 3300005288 Bacteria 2292
29 Ga0065714_10171551 3300005288 Bacteria 1002
30 Ga0065704_10000425 3300005289 Bacteria 76756
31 Ga0065704_10037577 3300005289 Bacteria 877
32 Ga0065704_10091506 3300005289 Bacteria 2686
33 Ga0065715_10820055 3300005293 Bacteria 603
34 Ga0070658_10000058 3300005327 Bacteria 113042
35 Ga0070658_10199513 3300005327 Bacteria 1688
36 Ga0070658_10374165 3300005327 Bacteria 1221
37 Ga0070658_10381425 3300005327 Bacteria 1209
38 Ga0070658_10623627 3300005327 Bacteria 935
39 Ga0070658_10669752 3300005327 Bacteria 900
40 Ga0070676_10002416 3300005328 Bacteria 9573
41 Ga0070683_100106209 3300005329 Bacteria 2647
42 Ga0068869_100288693 3300005334 Bacteria 1321
43 Ga0070680_100050557 3300005336 Bacteria 3390
44 Ga0070680_100398285 3300005336 Bacteria 1173
45 Ga0068868_100031260 3300005338 Bacteria 4088
46 Ga0070660_100027913 3300005339 Bacteria 4218
47 Ga0070660_100368814 3300005339 Bacteria 1184
48 Ga0070661_100268696 3300005344 Bacteria 1320
49 Ga0070675_101564256 3300005354 Bacteria 608
50 Ga0070671_100017668 3300005355 Bacteria 5780
51 Ga0070688_100123958 3300005365 Bacteria 1734
52 Ga0070659_100000766 3300005366 Bacteria 23347
53 Ga0070659_100016158 3300005366 Bacteria 5600
54 Ga0070659_100131080 3300005366 Bacteria 2036
55 Ga0070663_100048593 3300005455 Bacteria 3009
56 Ga0070678_100135001 3300005456 Bacteria 1966
57 Ga0070662_100000043 3300005457 Bacteria 70660
58 Ga0070681_10002600 3300005458 Bacteria 16566
59 Ga0068867_100086395 3300005459 Bacteria 2373
60 Ga0070685_10283476 3300005466 Unclassified 1110
61 Ga0070679_100005033 3300005530 Bacteria 12199
62 Ga0070684_100301504 3300005535 Bacteria 1470
63 Ga0070684_101304246 3300005535 Bacteria 683
64 Ga0068853_100026336 3300005539 Bacteria 4882
65 Ga0068853_100092816 3300005539 Bacteria 2656
66 Ga0068853_100262356 3300005539 Bacteria 1589
67 Ga0068853_100531774 3300005539 Bacteria 1112
68 Ga0070665_100000017 3300005548 Bacteria 448013
69 Ga0068855_100000060 3300005563 Bacteria 133838
70 Ga0068855_100000489 3300005563 Bacteria 48884
71 Ga0068855_100005005 3300005563 Bacteria 16170
72 Ga0068855_100042809 3300005563 Bacteria 5365
73 Ga0068855_100093441 3300005563 Bacteria 3469
74 Ga0068855_100325758 3300005563 Bacteria 1697
75 Ga0068855_100490007 3300005563 Bacteria 1337
76 Ga0068857_100007916 3300005577 Bacteria 9170
77 Ga0068857_100197778 3300005577 Bacteria 1832
78 Ga0068854_100355733 3300005578 Bacteria 1200
79 Ga0068856_100000040 3300005614 Bacteria 114443
80 Ga0068856_100006135 3300005614 Bacteria 11797
81 Ga0068856_100015573 3300005614 Bacteria 7351
82 Ga0068856_100300340 3300005614 Bacteria 1623
83 Ga0068856_100310564 3300005614 Bacteria 1594
84 Ga0068856_100403441 3300005614 Bacteria 1387
85 Ga0068856_101395529 3300005614 Bacteria 715
86 Ga0068852_100001476 3300005616 Bacteria 15913
87 Ga0068852_101534264 3300005616 Bacteria 689
88 Ga0068859_102138690 3300005617 Unclassified 618
89 Ga0068864_100319501 3300005618 Bacteria 1458
90 Ga0068864_101657122 3300005618 Bacteria 644
91 Ga0068864_102106013 3300005618 Bacteria 570
92 Ga0068866_10045008 3300005718 Bacteria 2211
93 Ga0068870_10035732 3300005840 Bacteria 2552
94 Ga0068863_100170839 3300005841 Bacteria 2085
95 Ga0068863_101586957 3300005841 Bacteria 663
96 Ga0068858_100163125 3300005842 Bacteria 2099
97 Ga0068858_100220214 3300005842 Bacteria 1797
98 Ga0068860_100780885 3300005843 Unclassified 968
99 Ga0068862_100169619 3300005844 Bacteria 1953
100 Ga0075366_10001904 3300006195 Bacteria 10546
101 Ga0075366_10003458 3300006195 Bacteria 8335
102 Ga0075366_10005500 3300006195 Bacteria 6865
103 Ga0075366_10128355 3300006195 Bacteria 1530
104 Ga0097621_100000099 3300006237 Bacteria 48404
105 Ga0097621_101025510 3300006237 Bacteria 772
106 Ga0075370_10172582 3300006353 Bacteria 1271
107 Ga0068871_100000290 3300006358 Bacteria 35074
108 Ga0068865_100005903 3300006881 Bacteria 7448
109 Ga0068865_100933051 3300006881 Bacteria 756
110 Ga0097620_102138977 3300006931 Unclassified 618
111 Ga0105244_10132016 3300009036 Bacteria 1205
112 Ga0105240_10011079 3300009093 Bacteria 12608
113 Ga0105240_10034592 3300009093 Bacteria 6516
114 Ga0105240_10114183 3300009093 Bacteria 3263
115 Ga0105240_10120468 3300009093 Bacteria 3160
116 Ga0105240_10184210 3300009093 Bacteria 2461
117 Ga0105240_10447706 3300009093 Bacteria 1446
118 Ga0105240_10738482 3300009093 Bacteria 1071
119 Ga0105240_10962389 3300009093 Bacteria 915
120 Ga0105243_10049063 3300009148 Bacteria 3330
121 Ga0105243_10190265 3300009148 Bacteria 1792
122 Ga0105241_10001269 3300009174 Bacteria 19251
123 Ga0105241_10011955 3300009174 Bacteria 6375
124 Ga0105241_10053940 3300009174 Bacteria 3076
125 Ga0105241_10162486 3300009174 Bacteria 1837
126 Ga0105242_10225915 3300009176 Bacteria 1675
127 Ga0105237_10001359 3300009545 Bacteria 32392
128 Ga0105237_10002200 3300009545 Bacteria 24430
129 Ga0105237_10004303 3300009545 Bacteria 16508
130 Ga0105237_10006338 3300009545 Bacteria 13151
131 Ga0105237_10013563 3300009545 Bacteria 8537
132 Ga0105237_10078586 3300009545 Bacteria 3289
133 Ga0105237_10089329 3300009545 Bacteria 3071
134 Ga0105237_10121520 3300009545 Bacteria 2606
135 Ga0105237_10122779 3300009545 Bacteria 2591
136 Ga0105237_10407357 3300009545 Bacteria 1365
137 Ga0105237_12031337 3300009545 Bacteria 583
138 Ga0105238_10273348 3300009551 Bacteria 1670
139 Ga0105238_10559830 3300009551 Bacteria 1148
140 Ga0105249_10214518 3300009553 Bacteria 1891
141 Ga0105249_10727608 3300009553 Bacteria 1054
142 Ga0105239_10000008 3300010375 Bacteria 376925
143 Ga0105239_10002395 3300010375 Bacteria 23910
144 Ga0105239_10079442 3300010375 Bacteria 3610
145 Ga0105239_10152189 3300010375 Bacteria 2582
146 Ga0105239_10192263 3300010375 Bacteria 2284
147 Ga0105239_10591045 3300010375 Bacteria 1266
148 Ga0105239_10780464 3300010375 Bacteria 1094
149 Ga0105239_10813238 3300010375 Bacteria 1071
150 Ga0157373_10000090 3300013100 Bacteria 78142
151 Ga0157373_10001836 3300013100 Bacteria 16168
152 Ga0157373_10001855 3300013100 Bacteria 16047
153 Ga0157373_10006316 3300013100 Bacteria 8850
154 Ga0157373_10091329 3300013100 Bacteria 2145
155 Ga0157373_10408456 3300013100 Bacteria 974
156 Ga0157373_11261670 3300013100 Bacteria 558
157 Ga0157371_10000117 3300013102 Bacteria 121069
158 Ga0157371_10000836 3300013102 Bacteria 35185
159 Ga0157371_10003113 3300013102 Bacteria 15341
160 Ga0157371_10005385 3300013102 Bacteria 10807
161 Ga0157371_10008918 3300013102 Bacteria 7943
162 Ga0157371_10010708 3300013102 Bacteria 7120
163 Ga0157371_10080148 3300013102 Bacteria 2312
164 Ga0157371_10440863 3300013102 Bacteria 957
165 Ga0157371_10847201 3300013102 Bacteria 691
166 Ga0157370_10001636 3300013104 Bacteria 27645
167 Ga0157370_10023420 3300013104 Bacteria 6129
168 Ga0157370_10035281 3300013104 Bacteria 4864
169 Ga0157370_10046282 3300013104 Bacteria 4171
170 Ga0157370_10047550 3300013104 Bacteria 4112
171 Ga0157370_10148167 3300013104 Bacteria 2185
172 Ga0157370_10291805 3300013104 Bacteria 1506
173 Ga0157370_10300416 3300013104 Bacteria 1482
174 Ga0157369_10000047 3300013105 Bacteria 172682
175 Ga0157369_10008223 3300013105 Bacteria 11962
176 Ga0157369_10010084 3300013105 Bacteria 10789
177 Ga0157369_10032151 3300013105 Bacteria 5771
178 Ga0157369_10602349 3300013105 Bacteria 1134
179 Ga0157369_11284029 3300013105 Bacteria 746
180 Ga0157369_11286251 3300013105 Bacteria 746
181 Ga0157369_11287139 3300013105 Bacteria 745
182 Ga0157374_10000360 3300013296 Bacteria 42177
183 Ga0157374_10001750 3300013296 Bacteria 18236
184 Ga0157374_10289041 3300013296 Bacteria 1620
185 Ga0157374_10397197 3300013296 Bacteria 1375
186 Ga0157374_10545805 3300013296 Bacteria 1167
187 Ga0157374_10578723 3300013296 Bacteria 1132
188 Ga0157374_10906424 3300013296 Bacteria 899
189 Ga0157374_10954419 3300013296 Bacteria 876
190 Ga0157374_11921353 3300013296 Bacteria 618
191 Ga0157378_10027617 3300013297 Bacteria 5007
192 Ga0157378_10101595 3300013297 Bacteria 2626
193 Ga0157378_10424599 3300013297 Bacteria 1315
194 Ga0157378_10759567 3300013297 Unclassified 993
195 Ga0163162_10000051 3300013306 Bacteria 117695
196 Ga0163162_10002853 3300013306 Bacteria 16447
197 Ga0163162_10003445 3300013306 Bacteria 15107
198 Ga0163162_10060266 3300013306 Bacteria 3830
199 Ga0163162_10216979 3300013306 Bacteria 2043
200 Ga0163162_10822470 3300013306 Bacteria 1045
201 Ga0157372_10000009 3300013307 Bacteria 302051
202 Ga0157372_10000158 3300013307 Bacteria 73709
203 Ga0157372_10021408 3300013307 Bacteria 6985
204 Ga0157372_10080696 3300013307 Bacteria 3681
205 Ga0157372_10396617 3300013307 Bacteria 1608
206 Ga0157372_10410618 3300013307 Bacteria 1578
207 Ga0157372_10533190 3300013307 Bacteria 1368
208 Ga0157372_10572830 3300013307 Bacteria 1316
209 Ga0157372_10651208 3300013307 Bacteria 1227
210 Ga0157375_10005633 3300013308 Bacteria 10905
211 Ga0157375_10060012 3300013308 Bacteria 3770
212 Ga0157375_10288143 3300013308 Bacteria 1805
213 Ga0157375_11837521 3300013308 Bacteria 719
214 Ga0157380_10003722 3300014326 Bacteria 10487
215 Ga0157380_10231164 3300014326 Unclassified 1661
216 Ga0182008_10000022 3300014497 Bacteria 207052
217 Ga0182008_10000132 3300014497 Bacteria 56231
218 Ga0182008_10030340 3300014497 Bacteria 2725
219 Ga0182008_10170899 3300014497 Bacteria 1097
220 Ga0182008_10185586 3300014497 Bacteria 1054
221 Ga0157377_10011833 3300014745 Bacteria 4368
222 Ga0157377_10550770 3300014745 Bacteria 815
223 Ga0157379_10131009 3300014968 Unclassified 2257
224 Ga0157376_10115178 3300014969 Bacteria 2373
225 Ga0182006_1000179 3300015261 Bacteria 66779
226 Ga0182006_1000182 3300015261 Bacteria 65171
227 Ga0182006_1002331 3300015261 Bacteria 10444
228 Ga0182007_10000005 3300015262 Bacteria 442702
229 Ga0182007_10006614 3300015262 Bacteria 4964
230 Ga0182007_10106538 3300015262 Unclassified 931
231 Ga0183373_1002 3300015682 Bacteria 990153
232 Ga0163161_10000787 3300017792 Bacteria 24900
233 Ga0163161_10000800 3300017792 Bacteria 24627
234 Ga0163161_10000838 3300017792 Bacteria 23986
235 Ga0163161_10007400 3300017792 Bacteria 7584
236 Ga0163161_10028641 3300017792 Bacteria 3956
237 Ga0163161_10033006 3300017792 Bacteria 3699
238 Ga0163161_10253362 3300017792 Bacteria 1373
239 Ga0206351_10102194 3300020077 Bacteria 1059
240 Ga0206351_10975742 3300020077 Bacteria 639
241 Ga0206352_10899470 3300020078 Bacteria 915
242 Ga0206352_11031737 3300020078 Bacteria 709
243 Ga0206350_10335256 3300020080 Bacteria 711
244 Ga0206354_11258126 3300020081 Bacteria 679
245 Ga0224712_10137680 3300022467 Bacteria 1072
246 Ga0209563_107553 3300025230 Bacteria 1775
247 Ga0207427_100159 3300025231 Bacteria 76256
248 Ga0209437_100021 3300025233 Bacteria 646400
249 Ga0209437_100144 3300025233 Bacteria 164794
250 Ga0209258_120069 3300025242 Bacteria 703
251 Ga0207425_1000003 3300025245 Bacteria 1145342
252 Ga0209026_1003403 3300025250 Bacteria 5243
253 Ga0209026_1004215 3300025250 Bacteria 4376
254 Ga0209026_1019768 3300025250 Bacteria 1053
255 Ga0209148_1018019 3300025254 Bacteria 1191
256 Ga0209129_1000014 3300025258 Bacteria 509018
257 Ga0209129_1035887 3300025258 Bacteria 804
258 Ga0209233_1000035 3300025261 Bacteria 568478
259 Ga0209233_1000524 3300025261 Bacteria 22083
260 Ga0209233_1016027 3300025261 Bacteria 2072
261 Ga0209233_1020888 3300025261 Bacteria 1707
262 Ga0209455_1000854 3300025272 Bacteria 16294
263 Ga0209676_1000039 3300025292 Bacteria 443158
264 Ga0209025_1000007 3300025294 Bacteria 1145109
265 Ga0209758_1000012 3300025297 Bacteria 949866
266 Ga0209050_1000033 3300025298 Bacteria 442615
267 Ga0207656_10000027 3300025321 Bacteria 86479
268 Ga0207647_10000036 3300025904 Bacteria 98204
269 Ga0207647_10000135 3300025904 Bacteria 58247
270 Ga0207647_10032124 3300025904 Bacteria 3375
271 Ga0207645_10000312 3300025907 Bacteria 40968
272 Ga0207705_10000090 3300025909 Bacteria 113233
273 Ga0207705_10145411 3300025909 Bacteria 1773
274 Ga0207705_10152355 3300025909 Bacteria 1733
275 Ga0207705_10221646 3300025909 Bacteria 1437
276 Ga0207705_10248913 3300025909 Bacteria 1355
277 Ga0207705_10570876 3300025909 Bacteria 879
278 Ga0207705_10906025 3300025909 Unclassified 683
279 Ga0207654_10012162 3300025911 Bacteria 4405
280 Ga0207654_10066304 3300025911 Bacteria 2129
281 Ga0207654_10188108 3300025911 Bacteria 1351
282 Ga0207654_10695942 3300025911 Bacteria 730
283 Ga0207707_10090091 3300025912 Bacteria 2681
284 Ga0207695_10000197 3300025913 Bacteria 168837
285 Ga0207695_10048999 3300025913 Bacteria 4456
286 Ga0207695_10060894 3300025913 Bacteria 3904
287 Ga0207695_10119332 3300025913 Bacteria 2607
288 Ga0207695_10302353 3300025913 Bacteria 1491
289 Ga0207695_10325922 3300025913 Bacteria 1425
290 Ga0207695_10461738 3300025913 Bacteria 1153
291 Ga0207695_10525930 3300025913 Bacteria 1064
292 Ga0207671_10000514 3300025914 Bacteria 52449
293 Ga0207671_10000516 3300025914 Bacteria 52391
294 Ga0207671_10004576 3300025914 Bacteria 13143
295 Ga0207671_10050514 3300025914 Bacteria 3079
296 Ga0207671_10106783 3300025914 Bacteria 2126
297 Ga0207671_10149620 3300025914 Bacteria 1803
298 Ga0207671_10225797 3300025914 Bacteria 1468
299 Ga0207663_10575116 3300025916 Bacteria 883
300 Ga0207660_10061068 3300025917 Bacteria 2712
301 Ga0207657_10070315 3300025919 Bacteria 2967
302 Ga0207657_10426756 3300025919 Bacteria 1042
303 Ga0207657_10950276 3300025919 Bacteria 661
304 Ga0207652_10027483 3300025921 Bacteria 4741
305 Ga0207652_10322330 3300025921 Bacteria 1395
306 Ga0207694_10199409 3300025924 Bacteria 1628
307 Ga0207694_10285577 3300025924 Bacteria 1356
308 Ga0207664_10737332 3300025929 Bacteria 886
309 Ga0207644_10004264 3300025931 Bacteria 9279
310 Ga0207690_10003074 3300025932 Bacteria 10052
311 Ga0207690_10048622 3300025932 Bacteria 2822
312 Ga0207690_10105159 3300025932 Bacteria 2024
313 Ga0207706_10000466 3300025933 Bacteria 43209
314 Ga0207706_10356900 3300025933 Bacteria 1270
315 Ga0207686_10223896 3300025934 Bacteria 1360
316 Ga0207709_10142418 3300025935 Bacteria 1649
317 Ga0207709_10407925 3300025935 Bacteria 1040
318 Ga0207670_10248180 3300025936 Unclassified 1374
319 Ga0207704_10000123 3300025938 Bacteria 41995
320 Ga0207691_10144358 3300025940 Bacteria 2096
321 Ga0207661_10080160 3300025944 Bacteria 2693
322 Ga0207667_10000033 3300025949 Bacteria 314353
323 Ga0207667_10000408 3300025949 Bacteria 58389
324 Ga0207667_10038475 3300025949 Bacteria 5109
325 Ga0207667_10072414 3300025949 Bacteria 3582
326 Ga0207667_10097087 3300025949 Bacteria 3041
327 Ga0207667_10819348 3300025949 Bacteria 926
328 Ga0207667_12173215 3300025949 Bacteria 512
329 Ga0207651_10606751 3300025960 Bacteria 957
330 Ga0207712_10130332 3300025961 Bacteria 1915
331 Ga0207712_10844810 3300025961 Bacteria 807
332 Ga0207640_10104052 3300025981 Bacteria 1997
333 Ga0207640_10343801 3300025981 Bacteria 1196
334 Ga0207640_11005212 3300025981 Bacteria 734
335 Ga0207677_10039733 3300026023 Bacteria 3096
336 Ga0207703_10214543 3300026035 Bacteria 1718
337 Ga0207639_10008486 3300026041 Bacteria 7043
338 Ga0207639_10061537 3300026041 Bacteria 2900
339 Ga0207639_10220250 3300026041 Bacteria 1638
340 Ga0207678_10021343 3300026067 Bacteria 5678
341 Ga0207702_10000042 3300026078 Bacteria 150673
342 Ga0207702_10017181 3300026078 Bacteria 5985
343 Ga0207702_10041295 3300026078 Bacteria 3868
344 Ga0207702_10143412 3300026078 Bacteria 2164
345 Ga0207702_11133928 3300026078 Bacteria 776
346 Ga0207641_10472791 3300026088 Bacteria 1214
347 Ga0207648_10000913 3300026089 Bacteria 33285
348 Ga0207676_11374618 3300026095 Bacteria 702
349 Ga0207674_10052917 3300026116 Bacteria 4139
350 Ga0207683_10042837 3300026121 Bacteria 3953
351 Ga0207698_10158689 3300026142 Bacteria 1975
352 Ga0207698_10420779 3300026142 Bacteria 1282
353 Ga0207698_11137856 3300026142 Bacteria 794
354 Ga0207698_11339857 3300026142 Bacteria 731
355 Ga0207698_12241605 3300026142 Bacteria 559
356 Ga0268266_10000037 3300028379 Bacteria 342368
357 Ga0268264_10689495 3300028381 Unclassified 1014
358 Ga0265318_10038333 3300028577 Bacteria 1832
359 Ga0265322_10000666 3300028654 Bacteria 12820
360 Ga0307517_10008846 3300028786 Bacteria 14389
361 Ga0307515_10000299 3300028794 Bacteria 122087
362 Ga0307515_10017355 3300028794 Bacteria 13116
363 Ga0307515_10027268 3300028794 Bacteria 9776
364 Ga0307515_10129864 3300028794 Bacteria 2784
365 Ga0307515_10430276 3300028794 Bacteria 938
366 Ga0265338_10011196 3300028800 Bacteria 10397
367 Ga0316176_1017512 3300030732 Bacteria 17610
368 Ga0316183_1098725 3300030742 Bacteria 33143
369 Ga0316181_1132426 3300030744 Unclassified 3472
370 Ga0316181_1167703 3300030744 Bacteria 2373
371 Ga0316181_1199287 3300030744 Bacteria 890
372 Ga0316182_1262601 3300030745 Bacteria 1086
373 Ga0265332_10145367 3300031238 Bacteria 993
374 Ga0265320_10045945 3300031240 Bacteria 2143
375 Ga0265339_10018562 3300031249 Bacteria 4096
376 Ga0265331_10016100 3300031250 Bacteria 3932
377 Ga0265331_10074885 3300031250 Bacteria 1579
378 Ga0265327_10000172 3300031251 Bacteria 139400
379 Ga0265327_10112526 3300031251 Bacteria 1299
380 Ga0265316_10017745 3300031344 Bacteria 6138
381 Ga0307509_10117242 3300031507 Bacteria 2650
382 Ga0307509_10332984 3300031507 Bacteria 1249
383 Ga0307408_100000628 3300031548 Bacteria 29832
384 Ga0307408_100000671 3300031548 Bacteria 28437
385 Ga0307408_100001834 3300031548 Bacteria 15479
386 Ga0265314_10059606 3300031711 Bacteria 2610
387 Ga0265342_10020333 3300031712 Bacteria 4261
388 Ga0316576_10889536 3300031727 Bacteria 638
389 Ga0316578_10545908 3300031728 Unclassified 681
390 Ga0316578_10671347 3300031728 Bacteria 604
391 Ga0307405_10000009 3300031731 Bacteria 259388
392 Ga0307405_10030688 3300031731 Bacteria 3154
393 Ga0307413_10415852 3300031824 Bacteria 1058
394 Ga0307413_10999963 3300031824 Bacteria 717
395 Ga0307406_11010840 3300031901 Bacteria 714
396 Ga0307407_10000001 3300031903 Bacteria 570048
397 Ga0307412_10000001 3300031911 Bacteria 822691
398 Ga0307412_10011880 3300031911 Bacteria 5057
399 Ga0307412_10115157 3300031911 Bacteria 1926
400 Ga0307412_10223081 3300031911 Bacteria 1446
401 Ga0307412_10228184 3300031911 Bacteria 1432
402 Ga0307412_10665734 3300031911 Unclassified 890
403 Ga0307412_11582711 3300031911 Bacteria 598
404 Ga0307409_100000833 3300031995 Bacteria 14214
405 Ga0307409_101546022 3300031995 Bacteria 691
406 Ga0307416_100000008 3300032002 Bacteria 401343
407 Ga0307416_100358950 3300032002 Bacteria 1478
408 Ga0307414_10000268 3300032004 Bacteria 32688
409 Ga0307414_10001436 3300032004 Bacteria 12368
410 Ga0307414_10005701 3300032004 Bacteria 6877
411 Ga0307414_10017760 3300032004 Bacteria 4361
412 Ga0307414_10020240 3300032004 Bacteria 4144
413 Ga0307414_10021383 3300032004 Bacteria 4058
414 Ga0307414_10040328 3300032004 Bacteria 3153
415 Ga0307414_10078558 3300032004 Bacteria 2406
416 Ga0307414_10151219 3300032004 Bacteria 1831
417 Ga0307414_10199112 3300032004 Bacteria 1627
418 Ga0307414_10213712 3300032004 Bacteria 1578
419 Ga0307414_10225625 3300032004 Bacteria 1541
420 Ga0307414_10247602 3300032004 Bacteria 1479
421 Ga0307414_10416579 3300032004 Bacteria 1170
422 Ga0307414_10423324 3300032004 Unclassified 1162
423 Ga0307414_10829705 3300032004 Bacteria 844
424 Ga0307414_11098145 3300032004 Bacteria 734
425 Ga0307411_10226670 3300032005 Bacteria 1454
426 Ga0307411_10241333 3300032005 Bacteria 1415
427 Ga0307507_10000313 3300033179 Bacteria 97672
428 Ga0307510_10001091 3300033180 Bacteria 28923
429 Ga0373941_0003096 3300035115 Bacteria 3730
430 Ga0316574_0125076 3300035398 Bacteria 1652
431 Ga0316574_0197547 3300035398 Bacteria 1293
432 Ga0316584_0058280 3300036712 Bacteria 2892
433 Ga0395899_0000011 3300037312 Bacteria 521331
434 Ga0395899_0000780 3300037312 Bacteria 31338
435 Ga0395899_0004206 3300037312 Bacteria 11292
436 Ga0395900_0000478 3300037418 Bacteria 56604
437 Ga0395900_0001720 3300037418 Bacteria 25283
438 Ga0395900_0006013 3300037418 Bacteria 12660
439 Ga0395898_0053528 3300037466 Bacteria 3942
440 Ga0395898_0057445 3300037466 Bacteria 3792
441 Ga0395905_0000705 3300037471 Bacteria 44338
442 Ga0395905_0002686 3300037471 Bacteria 19498
443 Ga0395905_0004170 3300037471 Bacteria 15118
444 Ga0395901_0001267 3300038443 Bacteria 26781
445 Ga0395901_0026240 3300038443 Bacteria 5981
446 Ga0436361_0530171 3300039447 Bacteria 11212
447 Ga0451787_768126 3300041441 Bacteria 785
448 Ga0451793_0105024 3300041452 Bacteria 1104
449 Ga0451797_1468381 3300041453 Bacteria 672
450 Ga0451798_1002939 3300041458 Bacteria 574
451 Ga0451807_1307333 3300041486 Bacteria 556
452 Ga0451849_0358896 3300041505 Bacteria 667
453 Ga0439448_0118018 3300042005 Bacteria 909
454 Ga0451577_0000935 3300042876 Bacteria 42928
455 Ga0453683_0001745 3300044673 Bacteria 18035
456 Ga0453683_0114321 3300044673 Bacteria 1698
457 Ga0466966_0064372 3300044684 Bacteria 2308
458 Ga0466961_0035332 3300044693 Bacteria 3210
459 Ga0453684_0000696 3300044712 Bacteria 119520
460 Ga0453684_0113475 3300044712 Bacteria 3287
461 Ga0453684_0326412 3300044712 Unclassified 1736
462 Ga0453684_0331834 3300044712 Bacteria 1720
463 Ga0453684_0570966 3300044712 Bacteria 1243
464 Ga0466970_0049594 3300044765 Unclassified 2239
465 Ga0466959_0027729 3300045049 Bacteria 4200
466 Ga0466959_0128403 3300045049 Bacteria 1798
467 Ga0451576_0027949 3300045051 Bacteria 6050
468 Ga0451576_0107623 3300045051 Bacteria 2901
469 Ga0466958_0029480 3300045836 Bacteria 3256
470 Ga0495629_0121174 3300046459 Bacteria 1822
471 Ga0495650_0000050 3300046471 Bacteria 318894
472 Ga0495585_0000198 3300046492 Bacteria 62640
473 Ga0495585_0001607 3300046492 Bacteria 17441
474 Ga0495607_0255244 3300046501 Bacteria 842
475 Ga0495583_0148676 3300046506 Bacteria 972
476 Ga0495606_0000213 3300046507 Bacteria 103305
477 Ga0495606_0002949 3300046507 Bacteria 18762
478 Ga0495606_0015650 3300046507 Bacteria 5829
479 Ga0495606_0017631 3300046507 Bacteria 5389
480 Ga0495606_0028874 3300046507 Bacteria 3905
481 Ga0495606_0183159 3300046507 Bacteria 1206
482 Ga0495606_0242785 3300046507 Bacteria 1003
483 Ga0495608_0464603 3300046511 Bacteria 769
484 Ga0495610_0000076 3300046512 Bacteria 118246
485 Ga0495610_0000696 3300046512 Bacteria 32341
486 Ga0495610_0001134 3300046512 Bacteria 24228
487 Ga0495616_0000433 3300046513 Bacteria 31968
488 Ga0495616_0022684 3300046513 Bacteria 3387
489 Ga0495631_0011938 3300046518 Bacteria 4259
490 Ga0495631_0051578 3300046518 Bacteria 1798
491 Ga0495631_0171908 3300046518 Bacteria 929
492 Ga0495637_0033328 3300046520 Bacteria 2263
493 Ga0495644_0030789 3300046523 Bacteria 2026
494 Ga0495648_0004911 3300046524 Bacteria 11246
495 Ga0495648_0007028 3300046524 Bacteria 9074
496 Ga0495642_0150214 3300046528 Unclassified 1007
497 Ga0495652_0170280 3300046529 Bacteria 1682
498 Ga0495652_0318317 3300046529 Bacteria 1125
499 Ga0495652_0860419 3300046529 Bacteria 600
500 Ga0495654_0223566 3300046530 Bacteria 795
501 Ga0495609_0002985 3300046538 Bacteria 9997
502 Ga0495609_0011292 3300046538 Bacteria 4258
503 Ga0495621_0123436 3300046539 Bacteria 1002
504 Ga0495622_0066925 3300046557 Bacteria 1660
505 Ga0495633_0000295 3300046558 Bacteria 56870
506 Ga0495633_0004623 3300046558 Bacteria 8671
507 Ga0495633_0016647 3300046558 Bacteria 3784
508 Ga0495668_0000121 3300046616 Bacteria 116234
509 Ga0495625_0000105 3300046660 Bacteria 126078
510 Ga0495625_0000316 3300046660 Bacteria 73939
511 Ga0495625_0002036 3300046660 Bacteria 22758
512 Ga0495625_0015634 3300046660 Bacteria 6002
513 Ga0495625_0058128 3300046660 Bacteria 2748
514 Ga0495625_0079580 3300046660 Bacteria 2285
515 Ga0495625_0098382 3300046660 Bacteria 2012
516 Ga0495625_0461379 3300046660 Bacteria 783
517 Ga0495661_0001116 3300046665 Bacteria 23480
518 Ga0495661_0021682 3300046665 Bacteria 4184
519 Ga0495661_0107213 3300046665 Bacteria 1562
520 Ga0495658_0376779 3300046683 Bacteria 903
521 Ga0495658_0388747 3300046683 Bacteria 889
522 Ga0495658_0690920 3300046683 Bacteria 654
523 Ga0495669_0228285 3300046684 Bacteria 893
524 Ga0495670_0136694 3300046691 Bacteria 1280
525 Ga0495649_0000011 3300046694 Bacteria 416695
526 Ga0495589_0053508 3300046794 Bacteria 1992
527 Ga0495660_0014777 3300046810 Bacteria 4515
528 Ga0495660_0089654 3300046810 Bacteria 1601
529 Ga0495672_0216411 3300047320 Bacteria 948
530 Ga0495687_000249 3300047443 Bacteria 72846
531 Ga0495687_000556 3300047443 Bacteria 44028
532 Ga0495673_0017458 3300047469 Bacteria 3643
533 Ga0495681_0294079 3300047470 Bacteria 630
534 Ga0495686_0000306 3300047472 Bacteria 83341
535 Ga0495686_0006170 3300047472 Bacteria 9265
536 Ga0495686_0011257 3300047472 Bacteria 6308
537 Ga0495686_0054555 3300047472 Bacteria 2502
538 Ga0495686_0083731 3300047472 Bacteria 1945
539 Ga0495602_0253515 3300048088 Bacteria 1310
540 Ga0495614_0012346 3300048089 Bacteria 3749
541 Ga0496115_0533308 3300048918 Bacteria 940
542 Ga0496126_0408942 3300048929 Bacteria 1099
543 Ga0495678_004962 3300049459 Bacteria 7501
544 Ga0495682_0130090 3300049460 Bacteria 900
545 Ga0501316_031660 3300049532 Bacteria 710
546 Ga0501033_0358777 3300049570 Bacteria 1020
547 Ga0501034_0674197 3300049571 Bacteria 934
548 Ga0501198_017809 3300049649 Bacteria 1108
549 Ga0501227_085631 3300049665 Bacteria 829
550 Ga0501238_032085 3300049671 Bacteria 761
551 Ga0501240_016056 3300049673 Bacteria 1072
552 Ga0501241_002026 3300049758 Bacteria 3973
553 Ga0501273_056872 3300049770 Bacteria 609
554 Ga0501204_025641 3300049850 Bacteria 794
555 nmdc:mga0k408_148394_c1 3300050493 Bacteria 1396
556 nmdc:mga0k408_20927_c1 3300050493 Bacteria 3671
557 nmdc:mga0k408_275_c2 3300050493 Bacteria 24277
558 nmdc:mga0k408_66_c1 3300050493 Bacteria 33479
559 nmdc:mga07m45_103476_c1 3300050496 Bacteria 1636
560 Ga0500635_0000412 3300053080 Bacteria 12782
561 Ga0500635_0069511 3300053080 Bacteria 1246
562 Ga0500578_0341928 3300053086 Bacteria 877
563 Ga0500651_0001193 3300053093 Bacteria 12892
564 Ga0500572_079552 3300053111 Bacteria 1025
565 Ga0500608_000596 3300053122 Bacteria 13310
566 Ga0500608_008269 3300053122 Bacteria 4364
567 Ga0500618_000033 3300053125 Bacteria 121886
568 Ga0500619_121475 3300053154 Bacteria 890
569 Ga0500622_0001136 3300053156 Bacteria 22218
570 Ga0500624_000712 3300053157 Bacteria 8312

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10131009 Ga0157379_101310092 131
2 3300005618 Ga0068864_102106013 Ga0068864_1021060131 136
3 3300026095 Ga0207676_11374618 Ga0207676_113746181 136
4 3300005618 Ga0068864_101657122 Ga0068864_1016571221 151
5 3300005841 Ga0068863_100170839 Ga0068863_1001708392 151
6 3300026088 Ga0207641_10472791 Ga0207641_104727911 151
7 3300044712 Ga0453684_0113475 Ga0453684_0113475_1408_1863 151
8 iso_pu_bacteria 2523533629 2524006388 152
9 iso_pu_bacteria 2519899754 2520881002 153
10 iso_pu_bacteria 2585427687 2586208806 153
11 iso_pu_bacteria 2599185184 2599479812 153
12 iso_pu_bacteria 2643221600 2644012536 153
13 iso_pu_bacteria 2643221667 2644371789 153
14 iso_pu_bacteria 2643221716 2644640865 153
15 iso_pu_bacteria 2643221725 2644684316 153
16 iso_pu_bacteria 2738541279 2738734943 153
17 iso_pu_bacteria 2738541284 2738763146 153
18 iso_pu_bacteria 2738541285 2738769086 153
19 iso_pu_bacteria 2738541302 2738854845 153
20 iso_pu_bacteria 2738543007 2739216525 153
21 iso_pu_bacteria 2738543023 2739303828 153
22 iso_pu_bacteria 2739367651 2739587039 153
23 iso_pu_bacteria 2739367656 2739618228 153
24 iso_pu_bacteria 2739367663 2739646335 153
25 iso_pu_bacteria 2739367857 2739999821 153
26 iso_pu_bacteria 2739367858 2740004637 153
27 iso_pu_bacteria 2775506987 2776616317 153
28 iso_pu_bacteria 2802428842 2802651792 153
29 iso_pu_bacteria 2816332280 2817414661 153
30 iso_pu_bacteria 2818991437 2819547490 153
31 iso_pu_bacteria 2833640130 2833641343 153
32 iso_pu_bacteria 2842722452 2842726514 153
33 iso_pu_bacteria 2842903701 2842904819 153
34 iso_pu_bacteria 2842909656 2842911278 153
35 iso_pu_bacteria 2849281842 2849286485 153
36 iso_pu_bacteria 2852623160 2852626024 153
37 iso_pu_bacteria 2852627209 2852629657 153
38 iso_pu_bacteria 2857613821 2857615359 153
39 iso_pu_bacteria 2857618242 2857622834 153
40 iso_pu_bacteria 2857627736 2857631482 153
41 iso_pu_bacteria 2881247448 2881250504 153
42 iso_pu_bacteria 2881359912 2881363997 153
43 iso_pu_bacteria 2881955468 2881956713 153
44 iso_pu_bacteria 2884933994 2884935508 153
45 iso_pu_bacteria 2896317667 2896319661 153
46 iso_pu_bacteria 2902048731 2902051948 153
47 iso_pu_bacteria 2903895155 2903895744 153
48 iso_pu_bacteria 2904419702 2904422558 153
49 iso_pu_bacteria 2904445276 2904448921 153
50 iso_pu_bacteria 2904555929 2904558304 153
51 iso_pu_bacteria 2919186247 2919191068 153
52 iso_pu_bacteria 2919191525 2919192959 153
53 iso_pu_bacteria 2919437846 2919439413 153
54 iso_pu_bacteria 2919683626 2919683672 153
55 iso_pu_bacteria 2928078545 2928080943 153
56 iso_pu_bacteria 2928147474 2928152638 153
57 iso_pu_bacteria 2929150217 2929151803 153
58 iso_pu_bacteria 2932082852 2932086964 153
59 iso_pu_bacteria 2939664404 2939669348 153
60 iso_pu_bacteria 2945997725 2946003185 153
61 iso_pu_bacteria 2954016120 2954020042 153
62 iso_pu_bacteria 2958458903 2958462638 153
63 iso_pu_bacteria 2977232053 2977234087 153
64 iso_pu_bacteria 2977268062 2977268532 153
65 iso_pu_bacteria 3003233435 3003233619 153
66 iso_pu_bacteria 8036736890 8036737203 153
67 iso_pu_bacteria 8054307821 8054308978 153
68 iso_pu_bacteria 8055419101 8055419557 153
69 iso_pu_bacteria 8055588893 8055589668 153
70 iso_pu_bacteria 8055592153 8055595814 153
71 iso_pu_bacteria 8056440228 8056443205 153
72 3300005365 Ga0070688_100123958 Ga0070688_1001239582 156
73 3300005466 Ga0070685_10283476 Ga0070685_102834762 156
74 3300005614 Ga0068856_101395529 Ga0068856_1013955292 156
75 3300025936 Ga0207670_10248180 Ga0207670_102481802 156
76 3300026078 Ga0207702_11133928 Ga0207702_111339282 156
77 3300028577 Ga0265318_10038333 Ga0265318_100383332 156
78 3300031238 Ga0265332_10145367 Ga0265332_101453672 156
79 3300031240 Ga0265320_10045945 Ga0265320_100459453 156
80 3300031249 Ga0265339_10018562 Ga0265339_100185623 156
81 3300031250 Ga0265331_10016100 Ga0265331_100161004 156
82 3300031344 Ga0265316_10017745 Ga0265316_100177454 156
83 3300031711 Ga0265314_10059606 Ga0265314_100596062 156
84 3300031712 Ga0265342_10020333 Ga0265342_100203332 156
85 3300041441 Ga0451787_768126 Ga0451787_768126_103_576 156
86 3300044712 Ga0453684_0331834 Ga0453684_0331834_578_1048 156
87 2162886007 SwRhRL2b_contig_2255685 SwRhRL2b_0652.00005740 157
88 2162886007 SwRhRL2b_contig_677025 SwRhRL2b_0927.00001600 157
89 3300001904 JGI24736J21556_1006598 JGI24736J21556_10065982 157
90 3300001990 JGI24737J22298_10000303 JGI24737J22298_100003034 157
91 3300001990 JGI24737J22298_10017213 JGI24737J22298_100172132 157
92 3300001990 JGI24737J22298_10027852 JGI24737J22298_100278523 157
93 3300002067 JGI24735J21928_10000007 JGI24735J21928_10000007148 157
94 3300002737 JGI25162J39368_1000408 JGI25162J39368_100040826 157
95 3300002737 JGI25162J39368_1001130 JGI25162J39368_100113012 157
96 3300002741 JGI25157J39369_1026186 JGI25157J39369_10261861 157
97 3300002772 JGI25164J39214_1001242 JGI25164J39214_10012422 157
98 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003236 157
99 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002236 157
100 3300003214 JGI25165J46597_1001079 JGI25165J46597_10010797 157
101 3300003215 JGI25153J46596_10000015 JGI25153J46596_1000001547 157
102 3300003316 rootH1_10012261 rootH1_100122612 157
103 3300003320 rootH2_10021444 rootH2_1002144413 157
104 3300003320 rootH2_10163983 rootH2_101639832 157
105 3300003322 rootL2_10017333 rootL2_100173338 157
106 3300003323 rootH1_10007236 rootH1_1000723611 157
107 3300003323 rootH1_10123432 rootH1_101234322 157
108 3300003781 Ga0055536_1000006 Ga0055536_1000006147 157
109 3300003791 Ga0055530_10003370 Ga0055530_100033703 157
110 3300004799 Ga0058863_11132184 Ga0058863_111321842 157
111 3300004800 Ga0058861_10544333 Ga0058861_105443332 157
112 3300005288 Ga0065714_10002307 Ga0065714_1000230727 157
113 3300005288 Ga0065714_10004556 Ga0065714_100045568 157
114 3300005288 Ga0065714_10013498 Ga0065714_100134982 157
115 3300005288 Ga0065714_10171551 Ga0065714_101715511 157
116 3300005289 Ga0065704_10000425 Ga0065704_1000042513 157
117 3300005289 Ga0065704_10037577 Ga0065704_100375772 157
118 3300005289 Ga0065704_10091506 Ga0065704_100915061 157
119 3300005293 Ga0065715_10820055 Ga0065715_108200551 157
120 3300005327 Ga0070658_10000058 Ga0070658_100000584 157
121 3300005327 Ga0070658_10199513 Ga0070658_101995132 157
122 3300005327 Ga0070658_10374165 Ga0070658_103741653 157
123 3300005327 Ga0070658_10381425 Ga0070658_103814252 157
124 3300005327 Ga0070658_10623627 Ga0070658_106236271 157
125 3300005327 Ga0070658_10669752 Ga0070658_106697521 157
126 3300005328 Ga0070676_10002416 Ga0070676_100024167 157
127 3300005329 Ga0070683_100106209 Ga0070683_1001062094 157
128 3300005334 Ga0068869_100288693 Ga0068869_1002886932 157
129 3300005336 Ga0070680_100050557 Ga0070680_1000505573 157
130 3300005336 Ga0070680_100398285 Ga0070680_1003982851 157
131 3300005338 Ga0068868_100031260 Ga0068868_1000312605 157
132 3300005339 Ga0070660_100027913 Ga0070660_1000279138 157
133 3300005339 Ga0070660_100368814 Ga0070660_1003688142 157
134 3300005344 Ga0070661_100268696 Ga0070661_1002686963 157
135 3300005354 Ga0070675_101564256 Ga0070675_1015642561 157
136 3300005355 Ga0070671_100017668 Ga0070671_1000176683 157
137 3300005366 Ga0070659_100000766 Ga0070659_10000076611 157
138 3300005366 Ga0070659_100016158 Ga0070659_1000161585 157
139 3300005366 Ga0070659_100131080 Ga0070659_1001310802 157
140 3300005455 Ga0070663_100048593 Ga0070663_1000485933 157
141 3300005456 Ga0070678_100135001 Ga0070678_1001350012 157
142 3300005457 Ga0070662_100000043 Ga0070662_10000004336 157
143 3300005458 Ga0070681_10002600 Ga0070681_1000260016 157
144 3300005459 Ga0068867_100086395 Ga0068867_1000863954 157
145 3300005530 Ga0070679_100005033 Ga0070679_10000503312 157
146 3300005535 Ga0070684_100301504 Ga0070684_1003015041 157
147 3300005535 Ga0070684_101304246 Ga0070684_1013042461 157
148 3300005539 Ga0068853_100026336 Ga0068853_1000263364 157
149 3300005539 Ga0068853_100092816 Ga0068853_1000928163 157
150 3300005539 Ga0068853_100262356 Ga0068853_1002623562 157
151 3300005539 Ga0068853_100531774 Ga0068853_1005317742 157
152 3300005548 Ga0070665_100000017 Ga0070665_100000017206 157
153 3300005563 Ga0068855_100000060 Ga0068855_10000006034 157
154 3300005563 Ga0068855_100000489 Ga0068855_10000048925 157
155 3300005563 Ga0068855_100005005 Ga0068855_1000050054 157
156 3300005563 Ga0068855_100042809 Ga0068855_1000428098 157
157 3300005563 Ga0068855_100093441 Ga0068855_1000934414 157
158 3300005563 Ga0068855_100325758 Ga0068855_1003257582 157
159 3300005563 Ga0068855_100490007 Ga0068855_1004900072 157
160 3300005577 Ga0068857_100007916 Ga0068857_1000079165 157
161 3300005577 Ga0068857_100197778 Ga0068857_1001977781 157
162 3300005578 Ga0068854_100355733 Ga0068854_1003557332 157
163 3300005614 Ga0068856_100000040 Ga0068856_10000004040 157
164 3300005614 Ga0068856_100006135 Ga0068856_1000061359 157
165 3300005614 Ga0068856_100015573 Ga0068856_1000155737 157
166 3300005614 Ga0068856_100300340 Ga0068856_1003003402 157
167 3300005614 Ga0068856_100310564 Ga0068856_1003105642 157
168 3300005614 Ga0068856_100403441 Ga0068856_1004034412 157
169 3300005616 Ga0068852_100001476 Ga0068852_10000147615 157
170 3300005616 Ga0068852_101534264 Ga0068852_1015342642 157
171 3300005617 Ga0068859_102138690 Ga0068859_1021386901 157
172 3300005618 Ga0068864_100319501 Ga0068864_1003195012 157
173 3300005718 Ga0068866_10045008 Ga0068866_100450083 157
174 3300005840 Ga0068870_10035732 Ga0068870_100357323 157
175 3300005841 Ga0068863_101586957 Ga0068863_1015869571 157
176 3300005842 Ga0068858_100163125 Ga0068858_1001631253 157
177 3300005842 Ga0068858_100220214 Ga0068858_1002202144 157
178 3300005843 Ga0068860_100780885 Ga0068860_1007808852 157
179 3300005844 Ga0068862_100169619 Ga0068862_1001696193 157
180 3300006195 Ga0075366_10001904 Ga0075366_100019044 157
181 3300006195 Ga0075366_10003458 Ga0075366_100034585 157
182 3300006195 Ga0075366_10005500 Ga0075366_100055001 157
183 3300006195 Ga0075366_10128355 Ga0075366_101283552 157
184 3300006237 Ga0097621_100000099 Ga0097621_10000009918 157
185 3300006237 Ga0097621_101025510 Ga0097621_1010255102 157
186 3300006353 Ga0075370_10172582 Ga0075370_101725821 157
187 3300006358 Ga0068871_100000290 Ga0068871_1000002906 157
188 3300006881 Ga0068865_100005903 Ga0068865_1000059035 157
189 3300006881 Ga0068865_100933051 Ga0068865_1009330511 157
190 3300006931 Ga0097620_102138977 Ga0097620_1021389771 157
191 3300009036 Ga0105244_10132016 Ga0105244_101320162 157
192 3300009093 Ga0105240_10011079 Ga0105240_1001107911 157
193 3300009093 Ga0105240_10034592 Ga0105240_100345923 157
194 3300009093 Ga0105240_10114183 Ga0105240_101141833 157
195 3300009093 Ga0105240_10120468 Ga0105240_101204684 157
196 3300009093 Ga0105240_10184210 Ga0105240_101842101 157
197 3300009093 Ga0105240_10447706 Ga0105240_104477061 157
198 3300009093 Ga0105240_10738482 Ga0105240_107384821 157
199 3300009093 Ga0105240_10962389 Ga0105240_109623891 157
200 3300009148 Ga0105243_10049063 Ga0105243_100490634 157
201 3300009148 Ga0105243_10190265 Ga0105243_101902652 157
202 3300009174 Ga0105241_10001269 Ga0105241_100012692 157
203 3300009174 Ga0105241_10011955 Ga0105241_100119553 157
204 3300009174 Ga0105241_10053940 Ga0105241_100539403 157
205 3300009174 Ga0105241_10162486 Ga0105241_101624862 157
206 3300009176 Ga0105242_10225915 Ga0105242_102259152 157
207 3300009545 Ga0105237_10001359 Ga0105237_1000135924 157
208 3300009545 Ga0105237_10002200 Ga0105237_100022002 157
209 3300009545 Ga0105237_10004303 Ga0105237_1000430316 157
210 3300009545 Ga0105237_10006338 Ga0105237_100063387 157
211 3300009545 Ga0105237_10013563 Ga0105237_100135636 157
212 3300009545 Ga0105237_10078586 Ga0105237_100785862 157
213 3300009545 Ga0105237_10089329 Ga0105237_100893293 157
214 3300009545 Ga0105237_10121520 Ga0105237_101215203 157
215 3300009545 Ga0105237_10122779 Ga0105237_101227793 157
216 3300009545 Ga0105237_10407357 Ga0105237_104073572 157
217 3300009545 Ga0105237_12031337 Ga0105237_120313371 157
218 3300009551 Ga0105238_10273348 Ga0105238_102733482 157
219 3300009551 Ga0105238_10559830 Ga0105238_105598302 157
220 3300009553 Ga0105249_10214518 Ga0105249_102145183 157
221 3300009553 Ga0105249_10727608 Ga0105249_107276082 157
222 3300010375 Ga0105239_10000008 Ga0105239_10000008143 157
223 3300010375 Ga0105239_10002395 Ga0105239_100023951 157
224 3300010375 Ga0105239_10079442 Ga0105239_100794421 157
225 3300010375 Ga0105239_10152189 Ga0105239_101521893 157
226 3300010375 Ga0105239_10192263 Ga0105239_101922633 157
227 3300010375 Ga0105239_10591045 Ga0105239_105910453 157
228 3300010375 Ga0105239_10780464 Ga0105239_107804642 157
229 3300010375 Ga0105239_10813238 Ga0105239_108132381 157
230 3300013100 Ga0157373_10000090 Ga0157373_1000009051 157
231 3300013100 Ga0157373_10001836 Ga0157373_1000183611 157
232 3300013100 Ga0157373_10001855 Ga0157373_1000185515 157
233 3300013100 Ga0157373_10006316 Ga0157373_100063162 157
234 3300013100 Ga0157373_10091329 Ga0157373_100913292 157
235 3300013100 Ga0157373_10408456 Ga0157373_104084561 157
236 3300013100 Ga0157373_11261670 Ga0157373_112616701 157
237 3300013102 Ga0157371_10000117 Ga0157371_1000011758 157
238 3300013102 Ga0157371_10000836 Ga0157371_1000083624 157
239 3300013102 Ga0157371_10003113 Ga0157371_100031136 157
240 3300013102 Ga0157371_10005385 Ga0157371_1000538512 157
241 3300013102 Ga0157371_10008918 Ga0157371_100089184 157
242 3300013102 Ga0157371_10010708 Ga0157371_100107085 157
243 3300013102 Ga0157371_10080148 Ga0157371_100801483 157
244 3300013102 Ga0157371_10440863 Ga0157371_104408632 157
245 3300013102 Ga0157371_10847201 Ga0157371_108472011 157
246 3300013104 Ga0157370_10001636 Ga0157370_1000163620 157
247 3300013104 Ga0157370_10023420 Ga0157370_100234201 157
248 3300013104 Ga0157370_10035281 Ga0157370_100352812 157
249 3300013104 Ga0157370_10046282 Ga0157370_100462823 157
250 3300013104 Ga0157370_10047550 Ga0157370_100475501 157
251 3300013104 Ga0157370_10148167 Ga0157370_101481672 157
252 3300013104 Ga0157370_10291805 Ga0157370_102918052 157
253 3300013104 Ga0157370_10300416 Ga0157370_103004162 157
254 3300013105 Ga0157369_10000047 Ga0157369_10000047101 157
255 3300013105 Ga0157369_10008223 Ga0157369_1000822312 157
256 3300013105 Ga0157369_10010084 Ga0157369_100100843 157
257 3300013105 Ga0157369_10032151 Ga0157369_100321512 157
258 3300013105 Ga0157369_10602349 Ga0157369_106023492 157
259 3300013105 Ga0157369_11284029 Ga0157369_112840291 157
260 3300013105 Ga0157369_11286251 Ga0157369_112862512 157
261 3300013105 Ga0157369_11287139 Ga0157369_112871391 157
262 3300013296 Ga0157374_10000360 Ga0157374_1000036039 157
263 3300013296 Ga0157374_10001750 Ga0157374_1000175011 157
264 3300013296 Ga0157374_10289041 Ga0157374_102890412 157
265 3300013296 Ga0157374_10397197 Ga0157374_103971972 157
266 3300013296 Ga0157374_10545805 Ga0157374_105458052 157
267 3300013296 Ga0157374_10578723 Ga0157374_105787232 157
268 3300013296 Ga0157374_10906424 Ga0157374_109064241 157
269 3300013296 Ga0157374_10954419 Ga0157374_109544191 157
270 3300013296 Ga0157374_11921353 Ga0157374_119213531 157
271 3300013297 Ga0157378_10027617 Ga0157378_100276173 157
272 3300013297 Ga0157378_10101595 Ga0157378_101015954 157
273 3300013297 Ga0157378_10424599 Ga0157378_104245991 157
274 3300013297 Ga0157378_10759567 Ga0157378_107595672 157
275 3300013306 Ga0163162_10000051 Ga0163162_1000005184 157
276 3300013306 Ga0163162_10002853 Ga0163162_1000285313 157
277 3300013306 Ga0163162_10003445 Ga0163162_100034453 157
278 3300013306 Ga0163162_10060266 Ga0163162_100602664 157
279 3300013306 Ga0163162_10216979 Ga0163162_102169792 157
280 3300013306 Ga0163162_10822470 Ga0163162_108224702 157
281 3300013307 Ga0157372_10000009 Ga0157372_1000000974 157
282 3300013307 Ga0157372_10000158 Ga0157372_1000015845 157
283 3300013307 Ga0157372_10021408 Ga0157372_100214083 157
284 3300013307 Ga0157372_10080696 Ga0157372_100806962 157
285 3300013307 Ga0157372_10396617 Ga0157372_103966172 157
286 3300013307 Ga0157372_10410618 Ga0157372_104106183 157
287 3300013307 Ga0157372_10533190 Ga0157372_105331902 157
288 3300013307 Ga0157372_10572830 Ga0157372_105728302 157
289 3300013307 Ga0157372_10651208 Ga0157372_106512082 157
290 3300013308 Ga0157375_10005633 Ga0157375_100056337 157
291 3300013308 Ga0157375_10060012 Ga0157375_100600123 157
292 3300013308 Ga0157375_10288143 Ga0157375_102881432 157
293 3300013308 Ga0157375_11837521 Ga0157375_118375211 157
294 3300014326 Ga0157380_10003722 Ga0157380_100037226 157
295 3300014326 Ga0157380_10231164 Ga0157380_102311644 157
296 3300014497 Ga0182008_10000022 Ga0182008_1000002220 157
297 3300014497 Ga0182008_10000132 Ga0182008_100001328 157
298 3300014497 Ga0182008_10030340 Ga0182008_100303403 157
299 3300014497 Ga0182008_10170899 Ga0182008_101708992 157
300 3300014497 Ga0182008_10185586 Ga0182008_101855862 157
301 3300014745 Ga0157377_10011833 Ga0157377_100118332 157
302 3300014745 Ga0157377_10550770 Ga0157377_105507701 157
303 3300014969 Ga0157376_10115178 Ga0157376_101151782 157
304 3300015261 Ga0182006_1000179 Ga0182006_100017911 157
305 3300015261 Ga0182006_1000182 Ga0182006_100018212 157
306 3300015261 Ga0182006_1002331 Ga0182006_10023317 157
307 3300015262 Ga0182007_10000005 Ga0182007_10000005186 157
308 3300015262 Ga0182007_10006614 Ga0182007_100066146 157
309 3300015262 Ga0182007_10106538 Ga0182007_101065381 157
310 3300015682 Ga0183373_1002 Ga0183373_1002773 157
311 3300017792 Ga0163161_10000787 Ga0163161_100007876 157
312 3300017792 Ga0163161_10000800 Ga0163161_1000080014 157
313 3300017792 Ga0163161_10000838 Ga0163161_1000083810 157
314 3300017792 Ga0163161_10007400 Ga0163161_100074004 157
315 3300017792 Ga0163161_10028641 Ga0163161_100286412 157
316 3300017792 Ga0163161_10033006 Ga0163161_100330061 157
317 3300017792 Ga0163161_10253362 Ga0163161_102533621 157
318 3300020077 Ga0206351_10102194 Ga0206351_101021941 157
319 3300020077 Ga0206351_10975742 Ga0206351_109757421 157
320 3300020078 Ga0206352_10899470 Ga0206352_108994701 157
321 3300020078 Ga0206352_11031737 Ga0206352_110317371 157
322 3300020080 Ga0206350_10335256 Ga0206350_103352561 157
323 3300020081 Ga0206354_11258126 Ga0206354_112581261 157
324 3300022467 Ga0224712_10137680 Ga0224712_101376801 157
325 3300025230 Ga0209563_107553 Ga0209563_1075532 157
326 3300025231 Ga0207427_100159 Ga0207427_10015972 157
327 3300025233 Ga0209437_100021 Ga0209437_10002192 157
328 3300025233 Ga0209437_100144 Ga0209437_100144130 157
329 3300025242 Ga0209258_120069 Ga0209258_1200692 157
330 3300025245 Ga0207425_1000003 Ga0207425_1000003606 157
331 3300025250 Ga0209026_1003403 Ga0209026_10034035 157
332 3300025250 Ga0209026_1004215 Ga0209026_10042153 157
333 3300025250 Ga0209026_1019768 Ga0209026_10197681 157
334 3300025254 Ga0209148_1018019 Ga0209148_10180192 157
335 3300025258 Ga0209129_1000014 Ga0209129_1000014227 157
336 3300025258 Ga0209129_1035887 Ga0209129_10358871 157
337 3300025261 Ga0209233_1000035 Ga0209233_1000035545 157
338 3300025261 Ga0209233_1000524 Ga0209233_100052415 157
339 3300025261 Ga0209233_1016027 Ga0209233_10160271 157
340 3300025261 Ga0209233_1020888 Ga0209233_10208883 157
341 3300025272 Ga0209455_1000854 Ga0209455_100085416 157
342 3300025292 Ga0209676_1000039 Ga0209676_1000039239 157
343 3300025294 Ga0209025_1000007 Ga0209025_1000007605 157
344 3300025297 Ga0209758_1000012 Ga0209758_1000012606 157
345 3300025298 Ga0209050_1000033 Ga0209050_1000033209 157
346 3300025321 Ga0207656_10000027 Ga0207656_1000002737 157
347 3300025904 Ga0207647_10000036 Ga0207647_1000003616 157
348 3300025904 Ga0207647_10000135 Ga0207647_1000013552 157
349 3300025904 Ga0207647_10032124 Ga0207647_100321243 157
350 3300025907 Ga0207645_10000312 Ga0207645_1000031235 157
351 3300025909 Ga0207705_10000090 Ga0207705_10000090104 157
352 3300025909 Ga0207705_10145411 Ga0207705_101454112 157
353 3300025909 Ga0207705_10152355 Ga0207705_101523552 157
354 3300025909 Ga0207705_10221646 Ga0207705_102216462 157
355 3300025909 Ga0207705_10248913 Ga0207705_102489133 157
356 3300025909 Ga0207705_10570876 Ga0207705_105708762 157
357 3300025909 Ga0207705_10906025 Ga0207705_109060251 157
358 3300025911 Ga0207654_10012162 Ga0207654_100121623 157
359 3300025911 Ga0207654_10066304 Ga0207654_100663044 157
360 3300025911 Ga0207654_10188108 Ga0207654_101881082 157
361 3300025911 Ga0207654_10695942 Ga0207654_106959421 157
362 3300025912 Ga0207707_10090091 Ga0207707_100900913 157
363 3300025913 Ga0207695_10000197 Ga0207695_1000019760 157
364 3300025913 Ga0207695_10048999 Ga0207695_100489996 157
365 3300025913 Ga0207695_10060894 Ga0207695_100608944 157
366 3300025913 Ga0207695_10119332 Ga0207695_101193321 157
367 3300025913 Ga0207695_10302353 Ga0207695_103023533 157
368 3300025913 Ga0207695_10325922 Ga0207695_103259222 157
369 3300025913 Ga0207695_10461738 Ga0207695_104617382 157
370 3300025913 Ga0207695_10525930 Ga0207695_105259302 157
371 3300025914 Ga0207671_10000514 Ga0207671_1000051433 157
372 3300025914 Ga0207671_10000516 Ga0207671_1000051645 157
373 3300025914 Ga0207671_10004576 Ga0207671_100045767 157
374 3300025914 Ga0207671_10050514 Ga0207671_100505146 157
375 3300025914 Ga0207671_10106783 Ga0207671_101067832 157
376 3300025914 Ga0207671_10149620 Ga0207671_101496203 157
377 3300025914 Ga0207671_10225797 Ga0207671_102257972 157
378 3300025916 Ga0207663_10575116 Ga0207663_105751161 157
379 3300025917 Ga0207660_10061068 Ga0207660_100610683 157
380 3300025919 Ga0207657_10070315 Ga0207657_100703151 157
381 3300025919 Ga0207657_10426756 Ga0207657_104267562 157
382 3300025919 Ga0207657_10950276 Ga0207657_109502761 157
383 3300025921 Ga0207652_10027483 Ga0207652_100274835 157
384 3300025921 Ga0207652_10322330 Ga0207652_103223302 157
385 3300025924 Ga0207694_10199409 Ga0207694_101994092 157
386 3300025924 Ga0207694_10285577 Ga0207694_102855772 157
387 3300025929 Ga0207664_10737332 Ga0207664_107373322 157
388 3300025931 Ga0207644_10004264 Ga0207644_100042644 157
389 3300025932 Ga0207690_10003074 Ga0207690_100030748 157
390 3300025932 Ga0207690_10048622 Ga0207690_100486222 157
391 3300025932 Ga0207690_10105159 Ga0207690_101051593 157
392 3300025933 Ga0207706_10000466 Ga0207706_1000046637 157
393 3300025933 Ga0207706_10356900 Ga0207706_103569001 157
394 3300025934 Ga0207686_10223896 Ga0207686_102238962 157
395 3300025935 Ga0207709_10142418 Ga0207709_101424182 157
396 3300025935 Ga0207709_10407925 Ga0207709_104079251 157
397 3300025938 Ga0207704_10000123 Ga0207704_100001232 157
398 3300025940 Ga0207691_10144358 Ga0207691_101443581 157
399 3300025944 Ga0207661_10080160 Ga0207661_100801604 157
400 3300025949 Ga0207667_10000033 Ga0207667_10000033255 157
401 3300025949 Ga0207667_10000408 Ga0207667_1000040832 157
402 3300025949 Ga0207667_10038475 Ga0207667_100384754 157
403 3300025949 Ga0207667_10072414 Ga0207667_100724145 157
404 3300025949 Ga0207667_10097087 Ga0207667_100970872 157
405 3300025949 Ga0207667_10819348 Ga0207667_108193481 157
406 3300025949 Ga0207667_12173215 Ga0207667_121732151 157
407 3300025960 Ga0207651_10606751 Ga0207651_106067511 157
408 3300025961 Ga0207712_10130332 Ga0207712_101303323 157
409 3300025961 Ga0207712_10844810 Ga0207712_108448102 157
410 3300025981 Ga0207640_10104052 Ga0207640_101040523 157
411 3300025981 Ga0207640_10343801 Ga0207640_103438012 157
412 3300025981 Ga0207640_11005212 Ga0207640_110052122 157
413 3300026023 Ga0207677_10039733 Ga0207677_100397334 157
414 3300026035 Ga0207703_10214543 Ga0207703_102145433 157
415 3300026041 Ga0207639_10008486 Ga0207639_100084866 157
416 3300026041 Ga0207639_10061537 Ga0207639_100615372 157
417 3300026041 Ga0207639_10220250 Ga0207639_102202503 157
418 3300026067 Ga0207678_10021343 Ga0207678_100213432 157
419 3300026078 Ga0207702_10000042 Ga0207702_1000004213 157
420 3300026078 Ga0207702_10017181 Ga0207702_100171816 157
421 3300026078 Ga0207702_10041295 Ga0207702_100412952 157
422 3300026078 Ga0207702_10143412 Ga0207702_101434123 157
423 3300026089 Ga0207648_10000913 Ga0207648_100009134 157
424 3300026116 Ga0207674_10052917 Ga0207674_100529174 157
425 3300026121 Ga0207683_10042837 Ga0207683_100428376 157
426 3300026142 Ga0207698_10158689 Ga0207698_101586891 157
427 3300026142 Ga0207698_10420779 Ga0207698_104207792 157
428 3300026142 Ga0207698_11137856 Ga0207698_111378562 157
429 3300026142 Ga0207698_11339857 Ga0207698_113398571 157
430 3300026142 Ga0207698_12241605 Ga0207698_122416051 157
431 3300028379 Ga0268266_10000037 Ga0268266_10000037112 157
432 3300028381 Ga0268264_10689495 Ga0268264_106894952 157
433 3300028654 Ga0265322_10000666 Ga0265322_100006668 157
434 3300028786 Ga0307517_10008846 Ga0307517_1000884610 157
435 3300028794 Ga0307515_10000299 Ga0307515_10000299121 157
436 3300028794 Ga0307515_10017355 Ga0307515_1001735513 157
437 3300028794 Ga0307515_10027268 Ga0307515_1002726810 157
438 3300028794 Ga0307515_10129864 Ga0307515_101298643 157
439 3300028794 Ga0307515_10430276 Ga0307515_104302761 157
440 3300028800 Ga0265338_10011196 Ga0265338_100111966 157
441 3300030732 Ga0316176_1017512 Ga0316176_101751219 157
442 3300030742 Ga0316183_1098725 Ga0316183_109872520 157
443 3300030744 Ga0316181_1132426 Ga0316181_11324264 157
444 3300030744 Ga0316181_1167703 Ga0316181_11677031 157
445 3300030744 Ga0316181_1199287 Ga0316181_11992871 157
446 3300030745 Ga0316182_1262601 Ga0316182_12626012 157
447 3300031250 Ga0265331_10074885 Ga0265331_100748852 157
448 3300031251 Ga0265327_10000172 Ga0265327_1000017284 157
449 3300031251 Ga0265327_10112526 Ga0265327_101125262 157
450 3300031507 Ga0307509_10117242 Ga0307509_101172422 157
451 3300031507 Ga0307509_10332984 Ga0307509_103329841 157
452 3300031548 Ga0307408_100000628 Ga0307408_10000062810 157
453 3300031548 Ga0307408_100000671 Ga0307408_1000006718 157
454 3300031548 Ga0307408_100001834 Ga0307408_1000018345 157
455 3300031727 Ga0316576_10889536 Ga0316576_108895361 157
456 3300031728 Ga0316578_10545908 Ga0316578_105459081 157
457 3300031728 Ga0316578_10671347 Ga0316578_106713471 157
458 3300031731 Ga0307405_10000009 Ga0307405_1000000987 157
459 3300031731 Ga0307405_10030688 Ga0307405_100306883 157
460 3300031824 Ga0307413_10415852 Ga0307413_104158522 157
461 3300031824 Ga0307413_10999963 Ga0307413_109999631 157
462 3300031901 Ga0307406_11010840 Ga0307406_110108402 157
463 3300031903 Ga0307407_10000001 Ga0307407_10000001264 157
464 3300031911 Ga0307412_10000001 Ga0307412_1000000149 157
465 3300031911 Ga0307412_10011880 Ga0307412_100118805 157
466 3300031911 Ga0307412_10115157 Ga0307412_101151573 157
467 3300031911 Ga0307412_10223081 Ga0307412_102230811 157
468 3300031911 Ga0307412_10228184 Ga0307412_102281841 157
469 3300031911 Ga0307412_10665734 Ga0307412_106657342 157
470 3300031911 Ga0307412_11582711 Ga0307412_115827111 157
471 3300031995 Ga0307409_100000833 Ga0307409_1000008338 157
472 3300031995 Ga0307409_101546022 Ga0307409_1015460221 157
473 3300032002 Ga0307416_100000008 Ga0307416_100000008125 157
474 3300032002 Ga0307416_100358950 Ga0307416_1003589502 157
475 3300032004 Ga0307414_10000268 Ga0307414_100002687 157
476 3300032004 Ga0307414_10001436 Ga0307414_1000143613 157
477 3300032004 Ga0307414_10005701 Ga0307414_100057014 157
478 3300032004 Ga0307414_10017760 Ga0307414_100177604 157
479 3300032004 Ga0307414_10020240 Ga0307414_100202404 157
480 3300032004 Ga0307414_10021383 Ga0307414_100213836 157
481 3300032004 Ga0307414_10040328 Ga0307414_100403285 157
482 3300032004 Ga0307414_10078558 Ga0307414_100785582 157
483 3300032004 Ga0307414_10151219 Ga0307414_101512192 157
484 3300032004 Ga0307414_10199112 Ga0307414_101991123 157
485 3300032004 Ga0307414_10213712 Ga0307414_102137122 157
486 3300032004 Ga0307414_10225625 Ga0307414_102256253 157
487 3300032004 Ga0307414_10247602 Ga0307414_102476022 157
488 3300032004 Ga0307414_10416579 Ga0307414_104165792 157
489 3300032004 Ga0307414_10423324 Ga0307414_104233241 157
490 3300032004 Ga0307414_10829705 Ga0307414_108297051 157
491 3300032004 Ga0307414_11098145 Ga0307414_110981451 157
492 3300032005 Ga0307411_10226670 Ga0307411_102266702 157
493 3300032005 Ga0307411_10241333 Ga0307411_102413332 157
494 3300033179 Ga0307507_10000313 Ga0307507_1000031362 157
495 3300033180 Ga0307510_10001091 Ga0307510_1000109124 157
496 3300035115 Ga0373941_0003096 Ga0373941_0003096_1110_1583 157
497 3300035398 Ga0316574_0125076 Ga0316574_0125076_1019_1492 157
498 3300035398 Ga0316574_0197547 Ga0316574_0197547_678_1151 157
499 3300036712 Ga0316584_0058280 Ga0316584_0058280_1827_2300 157
500 3300037312 Ga0395899_0000011 Ga0395899_0000011_27594_28067 157
501 3300037312 Ga0395899_0000780 Ga0395899_0000780_5019_5492 157
502 3300037312 Ga0395899_0004206 Ga0395899_0004206_7427_7900 157
503 3300037418 Ga0395900_0000478 Ga0395900_0000478_14047_14520 157
504 3300037418 Ga0395900_0001720 Ga0395900_0001720_17388_17861 157
505 3300037418 Ga0395900_0006013 Ga0395900_0006013_11380_11853 157
506 3300037466 Ga0395898_0053528 Ga0395898_0053528_3217_3690 157
507 3300037466 Ga0395898_0057445 Ga0395898_0057445_2403_2876 157
508 3300037471 Ga0395905_0000705 Ga0395905_0000705_11355_11828 157
509 3300037471 Ga0395905_0002686 Ga0395905_0002686_609_1082 157
510 3300037471 Ga0395905_0004170 Ga0395905_0004170_12432_12905 157
511 3300038443 Ga0395901_0001267 Ga0395901_0001267_6076_6549 157
512 3300038443 Ga0395901_0026240 Ga0395901_0026240_1800_2273 157
513 3300039447 Ga0436361_0530171 Ga0436361_0530171_10529_11002 157
514 3300041452 Ga0451793_0105024 Ga0451793_0105024_348_821 157
515 3300041453 Ga0451797_1468381 Ga0451797_1468381_145_618 157
516 3300041458 Ga0451798_1002939 Ga0451798_1002939_19_492 157
517 3300041486 Ga0451807_1307333 Ga0451807_1307333_44_520 157
518 3300041505 Ga0451849_0358896 Ga0451849_0358896_27_500 157
519 3300042005 Ga0439448_0118018 Ga0439448_0118018_308_781 157
520 3300042876 Ga0451577_0000935 Ga0451577_0000935_2473_2961 157
521 3300044673 Ga0453683_0001745 Ga0453683_0001745_15373_15861 157
522 3300044673 Ga0453683_0114321 Ga0453683_0114321_695_1183 157
523 3300044684 Ga0466966_0064372 Ga0466966_0064372_1734_2207 157
524 3300044693 Ga0466961_0035332 Ga0466961_0035332_1976_2449 157
525 3300044712 Ga0453684_0000696 Ga0453684_0000696_77798_78286 157
526 3300044712 Ga0453684_0326412 Ga0453684_0326412_137_613 157
527 3300044712 Ga0453684_0570966 Ga0453684_0570966_87_560 157
528 3300044765 Ga0466970_0049594 Ga0466970_0049594_1095_1568 157
529 3300045049 Ga0466959_0027729 Ga0466959_0027729_85_558 157
530 3300045049 Ga0466959_0128403 Ga0466959_0128403_449_922 157
531 3300045051 Ga0451576_0027949 Ga0451576_0027949_857_1330 157
532 3300045051 Ga0451576_0107623 Ga0451576_0107623_47_538 157
533 3300045836 Ga0466958_0029480 Ga0466958_0029480_2663_3136 157
534 3300046459 Ga0495629_0121174 Ga0495629_0121174_1258_1731 157
535 3300046471 Ga0495650_0000050 Ga0495650_0000050_62376_62849 157
536 3300046492 Ga0495585_0000198 Ga0495585_0000198_3325_3798 157
537 3300046492 Ga0495585_0001607 Ga0495585_0001607_3677_4150 157
538 3300046501 Ga0495607_0255244 Ga0495607_0255244_110_583 157
539 3300046506 Ga0495583_0148676 Ga0495583_0148676_486_959 157
540 3300046507 Ga0495606_0000213 Ga0495606_0000213_82835_83371 157
541 3300046507 Ga0495606_0002949 Ga0495606_0002949_14739_15212 157
542 3300046507 Ga0495606_0015650 Ga0495606_0015650_2591_3067 157
543 3300046507 Ga0495606_0017631 Ga0495606_0017631_2100_2573 157
544 3300046507 Ga0495606_0028874 Ga0495606_0028874_3374_3847 157
545 3300046507 Ga0495606_0183159 Ga0495606_0183159_507_980 157
546 3300046507 Ga0495606_0242785 Ga0495606_0242785_339_812 157
547 3300046511 Ga0495608_0464603 Ga0495608_0464603_135_608 157
548 3300046512 Ga0495610_0000076 Ga0495610_0000076_51306_51779 157
549 3300046512 Ga0495610_0000696 Ga0495610_0000696_14746_15219 157
550 3300046512 Ga0495610_0001134 Ga0495610_0001134_10768_11241 157
551 3300046513 Ga0495616_0000433 Ga0495616_0000433_20778_21251 157
552 3300046513 Ga0495616_0022684 Ga0495616_0022684_549_1022 157
553 3300046518 Ga0495631_0011938 Ga0495631_0011938_3391_3864 157
554 3300046518 Ga0495631_0051578 Ga0495631_0051578_1125_1598 157
555 3300046518 Ga0495631_0171908 Ga0495631_0171908_151_624 157
556 3300046520 Ga0495637_0033328 Ga0495637_0033328_992_1465 157
557 3300046523 Ga0495644_0030789 Ga0495644_0030789_814_1287 157
558 3300046524 Ga0495648_0004911 Ga0495648_0004911_4716_5189 157
559 3300046524 Ga0495648_0007028 Ga0495648_0007028_1626_2099 157
560 3300046528 Ga0495642_0150214 Ga0495642_0150214_449_922 157
561 3300046529 Ga0495652_0170280 Ga0495652_0170280_671_1144 157
562 3300046529 Ga0495652_0318317 Ga0495652_0318317_402_875 157
563 3300046529 Ga0495652_0860419 Ga0495652_0860419_35_508 157
564 3300046530 Ga0495654_0223566 Ga0495654_0223566_53_526 157
565 3300046538 Ga0495609_0002985 Ga0495609_0002985_2265_2738 157
566 3300046538 Ga0495609_0011292 Ga0495609_0011292_1347_1820 157
567 3300046539 Ga0495621_0123436 Ga0495621_0123436_72_545 157
568 3300046557 Ga0495622_0066925 Ga0495622_0066925_119_592 157
569 3300046558 Ga0495633_0000295 Ga0495633_0000295_54771_55244 157
570 3300046558 Ga0495633_0004623 Ga0495633_0004623_3458_3931 157
571 3300046558 Ga0495633_0016647 Ga0495633_0016647_682_1155 157
572 3300046616 Ga0495668_0000121 Ga0495668_0000121_4853_5326 157
573 3300046660 Ga0495625_0000105 Ga0495625_0000105_73442_73915 157
574 3300046660 Ga0495625_0000316 Ga0495625_0000316_38416_38889 157
575 3300046660 Ga0495625_0002036 Ga0495625_0002036_14091_14564 157
576 3300046660 Ga0495625_0015634 Ga0495625_0015634_343_816 157
577 3300046660 Ga0495625_0058128 Ga0495625_0058128_2255_2728 157
578 3300046660 Ga0495625_0079580 Ga0495625_0079580_1615_2088 157
579 3300046660 Ga0495625_0098382 Ga0495625_0098382_527_1000 157
580 3300046660 Ga0495625_0461379 Ga0495625_0461379_23_496 157
581 3300046665 Ga0495661_0001116 Ga0495661_0001116_5655_6128 157
582 3300046665 Ga0495661_0021682 Ga0495661_0021682_166_639 157
583 3300046665 Ga0495661_0107213 Ga0495661_0107213_706_1179 157
584 3300046683 Ga0495658_0376779 Ga0495658_0376779_101_574 157
585 3300046683 Ga0495658_0388747 Ga0495658_0388747_155_628 157
586 3300046683 Ga0495658_0690920 Ga0495658_0690920_151_624 157
587 3300046684 Ga0495669_0228285 Ga0495669_0228285_82_555 157
588 3300046691 Ga0495670_0136694 Ga0495670_0136694_714_1187 157
589 3300046694 Ga0495649_0000011 Ga0495649_0000011_51027_51500 157
590 3300046794 Ga0495589_0053508 Ga0495589_0053508_515_988 157
591 3300046810 Ga0495660_0014777 Ga0495660_0014777_2362_2835 157
592 3300046810 Ga0495660_0089654 Ga0495660_0089654_596_1069 157
593 3300047320 Ga0495672_0216411 Ga0495672_0216411_328_801 157
594 3300047443 Ga0495687_000249 Ga0495687_000249_10688_11161 157
595 3300047443 Ga0495687_000556 Ga0495687_000556_37054_37527 157
596 3300047469 Ga0495673_0017458 Ga0495673_0017458_1576_2049 157
597 3300047470 Ga0495681_0294079 Ga0495681_0294079_49_522 157
598 3300047472 Ga0495686_0000306 Ga0495686_0000306_58743_59216 157
599 3300047472 Ga0495686_0006170 Ga0495686_0006170_452_925 157
600 3300047472 Ga0495686_0011257 Ga0495686_0011257_365_838 157
601 3300047472 Ga0495686_0054555 Ga0495686_0054555_819_1292 157
602 3300047472 Ga0495686_0083731 Ga0495686_0083731_788_1261 157
603 3300048088 Ga0495602_0253515 Ga0495602_0253515_599_1072 157
604 3300048089 Ga0495614_0012346 Ga0495614_0012346_1750_2223 157
605 3300048918 Ga0496115_0533308 Ga0496115_0533308_434_907 157
606 3300048929 Ga0496126_0408942 Ga0496126_0408942_601_1074 157
607 3300049459 Ga0495678_004962 Ga0495678_004962_3859_4332 157
608 3300049460 Ga0495682_0130090 Ga0495682_0130090_261_734 157
609 3300049532 Ga0501316_031660 Ga0501316_031660_67_540 157
610 3300049570 Ga0501033_0358777 Ga0501033_0358777_322_795 157
611 3300049571 Ga0501034_0674197 Ga0501034_0674197_81_554 157
612 3300049649 Ga0501198_017809 Ga0501198_017809_459_932 157
613 3300049665 Ga0501227_085631 Ga0501227_085631_146_619 157
614 3300049671 Ga0501238_032085 Ga0501238_032085_104_577 157
615 3300049673 Ga0501240_016056 Ga0501240_016056_44_517 157
616 3300049758 Ga0501241_002026 Ga0501241_002026_1903_2376 157
617 3300049770 Ga0501273_056872 Ga0501273_056872_58_531 157
618 3300049850 Ga0501204_025641 Ga0501204_025641_176_649 157
619 3300050493 nmdc:mga0k408_148394_c1 nmdc:mga0k408_148394_c1_392_961 157
620 3300050493 nmdc:mga0k408_20927_c1 nmdc:mga0k408_20927_c1_1937_2410 157
621 3300050493 nmdc:mga0k408_275_c2 nmdc:mga0k408_275_c2_17454_17927 157
622 3300050493 nmdc:mga0k408_66_c1 nmdc:mga0k408_66_c1_17578_18051 157
623 3300050496 nmdc:mga07m45_103476_c1 nmdc:mga07m45_103476_c1_1056_1529 157
624 3300053080 Ga0500635_0000412 Ga0500635_0000412_2320_2793 157
625 3300053080 Ga0500635_0069511 Ga0500635_0069511_110_583 157
626 3300053086 Ga0500578_0341928 Ga0500578_0341928_321_794 157
627 3300053093 Ga0500651_0001193 Ga0500651_0001193_2237_2710 157
628 3300053111 Ga0500572_079552 Ga0500572_079552_101_574 157
629 3300053122 Ga0500608_000596 Ga0500608_000596_4690_5163 157
630 3300053122 Ga0500608_008269 Ga0500608_008269_698_1171 157
631 3300053125 Ga0500618_000033 Ga0500618_000033_48434_48907 157
632 3300053154 Ga0500619_121475 Ga0500619_121475_54_527 157
633 3300053156 Ga0500622_0001136 Ga0500622_0001136_12448_12921 157
634 3300053157 Ga0500624_000712 Ga0500624_000712_6064_6537 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03449

GreA_GreB_N

Transcription elongation factor, N-terminal

37

107

0.98

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

113

189

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd5-assembly1.cif.gz_A structural basis for budding by the escrtiii factor chmp3 0.8687 9 71
2gd5-assembly2.cif.gz_C structural basis for budding by the escrtiii factor chmp3 0.8581 9 68
2gd5-assembly2.cif.gz_D structural basis for budding by the escrtiii factor chmp3 0.8573 9 68
7qnl-assembly1.cif.gz_AAA lov2-darpin fusion - d4_deltalov 0.8495 15 67
7zcg-assembly1.cif.gz_B chmp2a-chmp3 heterodimer (430 angstrom diameter) 0.8444 12 71
ID Description Score Start End Superfamily
af_Q2FXW7_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.8989 2 76 1.10.287.180
af_Q2FXW7_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.8882 2 76 1.10.287.180
af_P0A6W5_1_75_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.8838 6 76 1.10.287.180
af_Q2FXW7_79_158_3.10.50.30 Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain 0.8788 81 156 3.10.50.30
af_P9WMT9_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.876 2 77 1.10.287.180
ID Description Score Start End GO Terms
AF-A0A661Z7U8-F1-model_v4 Transcription elongation factor GreA/GreB C-terminal domain-containing protein 0.9893 92 157 GO:0003677
GO:0006354
GO:0032784
GO:0070063
AF-A0A6L8Q7V6-F1-model_v4 GreA/GreB family elongation factor 0.9875 90 157 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A7V8KLB0-F1-model_v4 deleted 0.9826 88 157
AF-A0A3C1WF27-F1-model_v4 Transcription elongation factor GreA 0.9811 87 156 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A661Z7U8-F1-model_v4 Transcription elongation factor GreA/GreB C-terminal domain-containing protein 0.9605 92 157 GO:0003677
GO:0006354
GO:0032784
GO:0070063

Feature Viewer

pLDDT pTM Quality
85.46 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map