F471214
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 634 | 331 | 570 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_148394_c1|nmdc:mga0k408_148394_c1_392_961 |
| Length | 189 |
| Sequence | LFVFKVIASFYKREGGFFWQPIRQLKEINIGIMAEVAYFTKEGLENLKKELQELKTTGRSNISKAIAEARDKGDLSENAEYDAAKEAQGLHEAKIAQMQETLANARLLDESKLDVSKVLALSIVKIKNVSNGATMTYQLVAESEADMKSGKISVISPIAKGLLGKKVGEIAEITVPAGTMQFEILEVSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 3 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 4 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 5 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 6 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 7 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 8 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 9 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 10 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 11 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 12 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 13 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 14 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 15 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 16 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 17 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 18 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 19 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 20 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 21 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 22 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 23 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 24 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 25 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 26 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 27 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 28 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 29 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 30 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 31 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 32 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 33 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 34 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 35 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 36 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 37 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 38 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 39 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 40 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 41 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 42 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 43 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 44 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 45 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 46 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 47 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 48 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 49 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 50 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 51 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 52 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 53 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 54 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 55 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 56 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 57 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 58 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 59 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 60 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 61 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 62 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 63 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 64 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 65 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 66 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 67 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 68 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 69 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 70 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 71 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 72 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 73 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 74 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 79 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 85 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 87 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 92 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 98 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 102 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 104 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 105 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 106 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 107 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 108 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 109 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 110 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 111 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 112 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 113 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 114 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 115 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 214 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 215 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 216 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 217 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 228 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 231 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 232 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 243 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 249 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 255 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 256 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 257 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 260 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 261 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 309 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 311 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 313 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 314 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 315 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 316 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 318 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 319 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 320 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 321 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 324 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 325 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 326 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 327 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 328 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 329 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
| 330 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 331 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.33 |
| Metatranscriptomes | 1.58 |
| Isolates | 10.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.57 |
| Nodule | 0 |
| Rhizoplane | 1.1 |
| Rhizosphere | 82.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2255685 | 2162886007 | Bacteria | 19658 |
| 2 | SwRhRL2b_contig_677025 | 2162886007 | Bacteria | 181955 |
| 3 | JGI24736J21556_1006598 | 3300001904 | Bacteria | 1953 |
| 4 | JGI24737J22298_10000303 | 3300001990 | Bacteria | 16452 |
| 5 | JGI24737J22298_10017213 | 3300001990 | Bacteria | 2330 |
| 6 | JGI24737J22298_10027852 | 3300001990 | Bacteria | 1779 |
| 7 | JGI24735J21928_10000007 | 3300002067 | Bacteria | 333510 |
| 8 | JGI25162J39368_1000408 | 3300002737 | Bacteria | 35183 |
| 9 | JGI25162J39368_1001130 | 3300002737 | Bacteria | 16055 |
| 10 | JGI25157J39369_1026186 | 3300002741 | Bacteria | 678 |
| 11 | JGI25164J39214_1001242 | 3300002772 | Bacteria | 6779 |
| 12 | JGI25150J39212_1000003 | 3300002774 | Bacteria | 508651 |
| 13 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 14 | JGI25165J46597_1001079 | 3300003214 | Bacteria | 17498 |
| 15 | JGI25153J46596_10000015 | 3300003215 | Bacteria | 289820 |
| 16 | rootH1_10012261 | 3300003316 | Bacteria | 7196 |
| 17 | rootH2_10021444 | 3300003320 | Bacteria | 14118 |
| 18 | rootH2_10163983 | 3300003320 | Bacteria | 2996 |
| 19 | rootL2_10017333 | 3300003322 | Bacteria | 5289 |
| 20 | rootH1_10007236 | 3300003323 | Bacteria | 15279 |
| 21 | rootH1_10123432 | 3300003323 | Bacteria | 1833 |
| 22 | Ga0055536_1000006 | 3300003781 | Bacteria | 347733 |
| 23 | Ga0055530_10003370 | 3300003791 | Bacteria | 9143 |
| 24 | Ga0058863_11132184 | 3300004799 | Bacteria | 1045 |
| 25 | Ga0058861_10544333 | 3300004800 | Bacteria | 669 |
| 26 | Ga0065714_10002307 | 3300005288 | Bacteria | 26043 |
| 27 | Ga0065714_10004556 | 3300005288 | Bacteria | 8945 |
| 28 | Ga0065714_10013498 | 3300005288 | Bacteria | 2292 |
| 29 | Ga0065714_10171551 | 3300005288 | Bacteria | 1002 |
| 30 | Ga0065704_10000425 | 3300005289 | Bacteria | 76756 |
| 31 | Ga0065704_10037577 | 3300005289 | Bacteria | 877 |
| 32 | Ga0065704_10091506 | 3300005289 | Bacteria | 2686 |
| 33 | Ga0065715_10820055 | 3300005293 | Bacteria | 603 |
| 34 | Ga0070658_10000058 | 3300005327 | Bacteria | 113042 |
| 35 | Ga0070658_10199513 | 3300005327 | Bacteria | 1688 |
| 36 | Ga0070658_10374165 | 3300005327 | Bacteria | 1221 |
| 37 | Ga0070658_10381425 | 3300005327 | Bacteria | 1209 |
| 38 | Ga0070658_10623627 | 3300005327 | Bacteria | 935 |
| 39 | Ga0070658_10669752 | 3300005327 | Bacteria | 900 |
| 40 | Ga0070676_10002416 | 3300005328 | Bacteria | 9573 |
| 41 | Ga0070683_100106209 | 3300005329 | Bacteria | 2647 |
| 42 | Ga0068869_100288693 | 3300005334 | Bacteria | 1321 |
| 43 | Ga0070680_100050557 | 3300005336 | Bacteria | 3390 |
| 44 | Ga0070680_100398285 | 3300005336 | Bacteria | 1173 |
| 45 | Ga0068868_100031260 | 3300005338 | Bacteria | 4088 |
| 46 | Ga0070660_100027913 | 3300005339 | Bacteria | 4218 |
| 47 | Ga0070660_100368814 | 3300005339 | Bacteria | 1184 |
| 48 | Ga0070661_100268696 | 3300005344 | Bacteria | 1320 |
| 49 | Ga0070675_101564256 | 3300005354 | Bacteria | 608 |
| 50 | Ga0070671_100017668 | 3300005355 | Bacteria | 5780 |
| 51 | Ga0070688_100123958 | 3300005365 | Bacteria | 1734 |
| 52 | Ga0070659_100000766 | 3300005366 | Bacteria | 23347 |
| 53 | Ga0070659_100016158 | 3300005366 | Bacteria | 5600 |
| 54 | Ga0070659_100131080 | 3300005366 | Bacteria | 2036 |
| 55 | Ga0070663_100048593 | 3300005455 | Bacteria | 3009 |
| 56 | Ga0070678_100135001 | 3300005456 | Bacteria | 1966 |
| 57 | Ga0070662_100000043 | 3300005457 | Bacteria | 70660 |
| 58 | Ga0070681_10002600 | 3300005458 | Bacteria | 16566 |
| 59 | Ga0068867_100086395 | 3300005459 | Bacteria | 2373 |
| 60 | Ga0070685_10283476 | 3300005466 | Unclassified | 1110 |
| 61 | Ga0070679_100005033 | 3300005530 | Bacteria | 12199 |
| 62 | Ga0070684_100301504 | 3300005535 | Bacteria | 1470 |
| 63 | Ga0070684_101304246 | 3300005535 | Bacteria | 683 |
| 64 | Ga0068853_100026336 | 3300005539 | Bacteria | 4882 |
| 65 | Ga0068853_100092816 | 3300005539 | Bacteria | 2656 |
| 66 | Ga0068853_100262356 | 3300005539 | Bacteria | 1589 |
| 67 | Ga0068853_100531774 | 3300005539 | Bacteria | 1112 |
| 68 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 69 | Ga0068855_100000060 | 3300005563 | Bacteria | 133838 |
| 70 | Ga0068855_100000489 | 3300005563 | Bacteria | 48884 |
| 71 | Ga0068855_100005005 | 3300005563 | Bacteria | 16170 |
| 72 | Ga0068855_100042809 | 3300005563 | Bacteria | 5365 |
| 73 | Ga0068855_100093441 | 3300005563 | Bacteria | 3469 |
| 74 | Ga0068855_100325758 | 3300005563 | Bacteria | 1697 |
| 75 | Ga0068855_100490007 | 3300005563 | Bacteria | 1337 |
| 76 | Ga0068857_100007916 | 3300005577 | Bacteria | 9170 |
| 77 | Ga0068857_100197778 | 3300005577 | Bacteria | 1832 |
| 78 | Ga0068854_100355733 | 3300005578 | Bacteria | 1200 |
| 79 | Ga0068856_100000040 | 3300005614 | Bacteria | 114443 |
| 80 | Ga0068856_100006135 | 3300005614 | Bacteria | 11797 |
| 81 | Ga0068856_100015573 | 3300005614 | Bacteria | 7351 |
| 82 | Ga0068856_100300340 | 3300005614 | Bacteria | 1623 |
| 83 | Ga0068856_100310564 | 3300005614 | Bacteria | 1594 |
| 84 | Ga0068856_100403441 | 3300005614 | Bacteria | 1387 |
| 85 | Ga0068856_101395529 | 3300005614 | Bacteria | 715 |
| 86 | Ga0068852_100001476 | 3300005616 | Bacteria | 15913 |
| 87 | Ga0068852_101534264 | 3300005616 | Bacteria | 689 |
| 88 | Ga0068859_102138690 | 3300005617 | Unclassified | 618 |
| 89 | Ga0068864_100319501 | 3300005618 | Bacteria | 1458 |
| 90 | Ga0068864_101657122 | 3300005618 | Bacteria | 644 |
| 91 | Ga0068864_102106013 | 3300005618 | Bacteria | 570 |
| 92 | Ga0068866_10045008 | 3300005718 | Bacteria | 2211 |
| 93 | Ga0068870_10035732 | 3300005840 | Bacteria | 2552 |
| 94 | Ga0068863_100170839 | 3300005841 | Bacteria | 2085 |
| 95 | Ga0068863_101586957 | 3300005841 | Bacteria | 663 |
| 96 | Ga0068858_100163125 | 3300005842 | Bacteria | 2099 |
| 97 | Ga0068858_100220214 | 3300005842 | Bacteria | 1797 |
| 98 | Ga0068860_100780885 | 3300005843 | Unclassified | 968 |
| 99 | Ga0068862_100169619 | 3300005844 | Bacteria | 1953 |
| 100 | Ga0075366_10001904 | 3300006195 | Bacteria | 10546 |
| 101 | Ga0075366_10003458 | 3300006195 | Bacteria | 8335 |
| 102 | Ga0075366_10005500 | 3300006195 | Bacteria | 6865 |
| 103 | Ga0075366_10128355 | 3300006195 | Bacteria | 1530 |
| 104 | Ga0097621_100000099 | 3300006237 | Bacteria | 48404 |
| 105 | Ga0097621_101025510 | 3300006237 | Bacteria | 772 |
| 106 | Ga0075370_10172582 | 3300006353 | Bacteria | 1271 |
| 107 | Ga0068871_100000290 | 3300006358 | Bacteria | 35074 |
| 108 | Ga0068865_100005903 | 3300006881 | Bacteria | 7448 |
| 109 | Ga0068865_100933051 | 3300006881 | Bacteria | 756 |
| 110 | Ga0097620_102138977 | 3300006931 | Unclassified | 618 |
| 111 | Ga0105244_10132016 | 3300009036 | Bacteria | 1205 |
| 112 | Ga0105240_10011079 | 3300009093 | Bacteria | 12608 |
| 113 | Ga0105240_10034592 | 3300009093 | Bacteria | 6516 |
| 114 | Ga0105240_10114183 | 3300009093 | Bacteria | 3263 |
| 115 | Ga0105240_10120468 | 3300009093 | Bacteria | 3160 |
| 116 | Ga0105240_10184210 | 3300009093 | Bacteria | 2461 |
| 117 | Ga0105240_10447706 | 3300009093 | Bacteria | 1446 |
| 118 | Ga0105240_10738482 | 3300009093 | Bacteria | 1071 |
| 119 | Ga0105240_10962389 | 3300009093 | Bacteria | 915 |
| 120 | Ga0105243_10049063 | 3300009148 | Bacteria | 3330 |
| 121 | Ga0105243_10190265 | 3300009148 | Bacteria | 1792 |
| 122 | Ga0105241_10001269 | 3300009174 | Bacteria | 19251 |
| 123 | Ga0105241_10011955 | 3300009174 | Bacteria | 6375 |
| 124 | Ga0105241_10053940 | 3300009174 | Bacteria | 3076 |
| 125 | Ga0105241_10162486 | 3300009174 | Bacteria | 1837 |
| 126 | Ga0105242_10225915 | 3300009176 | Bacteria | 1675 |
| 127 | Ga0105237_10001359 | 3300009545 | Bacteria | 32392 |
| 128 | Ga0105237_10002200 | 3300009545 | Bacteria | 24430 |
| 129 | Ga0105237_10004303 | 3300009545 | Bacteria | 16508 |
| 130 | Ga0105237_10006338 | 3300009545 | Bacteria | 13151 |
| 131 | Ga0105237_10013563 | 3300009545 | Bacteria | 8537 |
| 132 | Ga0105237_10078586 | 3300009545 | Bacteria | 3289 |
| 133 | Ga0105237_10089329 | 3300009545 | Bacteria | 3071 |
| 134 | Ga0105237_10121520 | 3300009545 | Bacteria | 2606 |
| 135 | Ga0105237_10122779 | 3300009545 | Bacteria | 2591 |
| 136 | Ga0105237_10407357 | 3300009545 | Bacteria | 1365 |
| 137 | Ga0105237_12031337 | 3300009545 | Bacteria | 583 |
| 138 | Ga0105238_10273348 | 3300009551 | Bacteria | 1670 |
| 139 | Ga0105238_10559830 | 3300009551 | Bacteria | 1148 |
| 140 | Ga0105249_10214518 | 3300009553 | Bacteria | 1891 |
| 141 | Ga0105249_10727608 | 3300009553 | Bacteria | 1054 |
| 142 | Ga0105239_10000008 | 3300010375 | Bacteria | 376925 |
| 143 | Ga0105239_10002395 | 3300010375 | Bacteria | 23910 |
| 144 | Ga0105239_10079442 | 3300010375 | Bacteria | 3610 |
| 145 | Ga0105239_10152189 | 3300010375 | Bacteria | 2582 |
| 146 | Ga0105239_10192263 | 3300010375 | Bacteria | 2284 |
| 147 | Ga0105239_10591045 | 3300010375 | Bacteria | 1266 |
| 148 | Ga0105239_10780464 | 3300010375 | Bacteria | 1094 |
| 149 | Ga0105239_10813238 | 3300010375 | Bacteria | 1071 |
| 150 | Ga0157373_10000090 | 3300013100 | Bacteria | 78142 |
| 151 | Ga0157373_10001836 | 3300013100 | Bacteria | 16168 |
| 152 | Ga0157373_10001855 | 3300013100 | Bacteria | 16047 |
| 153 | Ga0157373_10006316 | 3300013100 | Bacteria | 8850 |
| 154 | Ga0157373_10091329 | 3300013100 | Bacteria | 2145 |
| 155 | Ga0157373_10408456 | 3300013100 | Bacteria | 974 |
| 156 | Ga0157373_11261670 | 3300013100 | Bacteria | 558 |
| 157 | Ga0157371_10000117 | 3300013102 | Bacteria | 121069 |
| 158 | Ga0157371_10000836 | 3300013102 | Bacteria | 35185 |
| 159 | Ga0157371_10003113 | 3300013102 | Bacteria | 15341 |
| 160 | Ga0157371_10005385 | 3300013102 | Bacteria | 10807 |
| 161 | Ga0157371_10008918 | 3300013102 | Bacteria | 7943 |
| 162 | Ga0157371_10010708 | 3300013102 | Bacteria | 7120 |
| 163 | Ga0157371_10080148 | 3300013102 | Bacteria | 2312 |
| 164 | Ga0157371_10440863 | 3300013102 | Bacteria | 957 |
| 165 | Ga0157371_10847201 | 3300013102 | Bacteria | 691 |
| 166 | Ga0157370_10001636 | 3300013104 | Bacteria | 27645 |
| 167 | Ga0157370_10023420 | 3300013104 | Bacteria | 6129 |
| 168 | Ga0157370_10035281 | 3300013104 | Bacteria | 4864 |
| 169 | Ga0157370_10046282 | 3300013104 | Bacteria | 4171 |
| 170 | Ga0157370_10047550 | 3300013104 | Bacteria | 4112 |
| 171 | Ga0157370_10148167 | 3300013104 | Bacteria | 2185 |
| 172 | Ga0157370_10291805 | 3300013104 | Bacteria | 1506 |
| 173 | Ga0157370_10300416 | 3300013104 | Bacteria | 1482 |
| 174 | Ga0157369_10000047 | 3300013105 | Bacteria | 172682 |
| 175 | Ga0157369_10008223 | 3300013105 | Bacteria | 11962 |
| 176 | Ga0157369_10010084 | 3300013105 | Bacteria | 10789 |
| 177 | Ga0157369_10032151 | 3300013105 | Bacteria | 5771 |
| 178 | Ga0157369_10602349 | 3300013105 | Bacteria | 1134 |
| 179 | Ga0157369_11284029 | 3300013105 | Bacteria | 746 |
| 180 | Ga0157369_11286251 | 3300013105 | Bacteria | 746 |
| 181 | Ga0157369_11287139 | 3300013105 | Bacteria | 745 |
| 182 | Ga0157374_10000360 | 3300013296 | Bacteria | 42177 |
| 183 | Ga0157374_10001750 | 3300013296 | Bacteria | 18236 |
| 184 | Ga0157374_10289041 | 3300013296 | Bacteria | 1620 |
| 185 | Ga0157374_10397197 | 3300013296 | Bacteria | 1375 |
| 186 | Ga0157374_10545805 | 3300013296 | Bacteria | 1167 |
| 187 | Ga0157374_10578723 | 3300013296 | Bacteria | 1132 |
| 188 | Ga0157374_10906424 | 3300013296 | Bacteria | 899 |
| 189 | Ga0157374_10954419 | 3300013296 | Bacteria | 876 |
| 190 | Ga0157374_11921353 | 3300013296 | Bacteria | 618 |
| 191 | Ga0157378_10027617 | 3300013297 | Bacteria | 5007 |
| 192 | Ga0157378_10101595 | 3300013297 | Bacteria | 2626 |
| 193 | Ga0157378_10424599 | 3300013297 | Bacteria | 1315 |
| 194 | Ga0157378_10759567 | 3300013297 | Unclassified | 993 |
| 195 | Ga0163162_10000051 | 3300013306 | Bacteria | 117695 |
| 196 | Ga0163162_10002853 | 3300013306 | Bacteria | 16447 |
| 197 | Ga0163162_10003445 | 3300013306 | Bacteria | 15107 |
| 198 | Ga0163162_10060266 | 3300013306 | Bacteria | 3830 |
| 199 | Ga0163162_10216979 | 3300013306 | Bacteria | 2043 |
| 200 | Ga0163162_10822470 | 3300013306 | Bacteria | 1045 |
| 201 | Ga0157372_10000009 | 3300013307 | Bacteria | 302051 |
| 202 | Ga0157372_10000158 | 3300013307 | Bacteria | 73709 |
| 203 | Ga0157372_10021408 | 3300013307 | Bacteria | 6985 |
| 204 | Ga0157372_10080696 | 3300013307 | Bacteria | 3681 |
| 205 | Ga0157372_10396617 | 3300013307 | Bacteria | 1608 |
| 206 | Ga0157372_10410618 | 3300013307 | Bacteria | 1578 |
| 207 | Ga0157372_10533190 | 3300013307 | Bacteria | 1368 |
| 208 | Ga0157372_10572830 | 3300013307 | Bacteria | 1316 |
| 209 | Ga0157372_10651208 | 3300013307 | Bacteria | 1227 |
| 210 | Ga0157375_10005633 | 3300013308 | Bacteria | 10905 |
| 211 | Ga0157375_10060012 | 3300013308 | Bacteria | 3770 |
| 212 | Ga0157375_10288143 | 3300013308 | Bacteria | 1805 |
| 213 | Ga0157375_11837521 | 3300013308 | Bacteria | 719 |
| 214 | Ga0157380_10003722 | 3300014326 | Bacteria | 10487 |
| 215 | Ga0157380_10231164 | 3300014326 | Unclassified | 1661 |
| 216 | Ga0182008_10000022 | 3300014497 | Bacteria | 207052 |
| 217 | Ga0182008_10000132 | 3300014497 | Bacteria | 56231 |
| 218 | Ga0182008_10030340 | 3300014497 | Bacteria | 2725 |
| 219 | Ga0182008_10170899 | 3300014497 | Bacteria | 1097 |
| 220 | Ga0182008_10185586 | 3300014497 | Bacteria | 1054 |
| 221 | Ga0157377_10011833 | 3300014745 | Bacteria | 4368 |
| 222 | Ga0157377_10550770 | 3300014745 | Bacteria | 815 |
| 223 | Ga0157379_10131009 | 3300014968 | Unclassified | 2257 |
| 224 | Ga0157376_10115178 | 3300014969 | Bacteria | 2373 |
| 225 | Ga0182006_1000179 | 3300015261 | Bacteria | 66779 |
| 226 | Ga0182006_1000182 | 3300015261 | Bacteria | 65171 |
| 227 | Ga0182006_1002331 | 3300015261 | Bacteria | 10444 |
| 228 | Ga0182007_10000005 | 3300015262 | Bacteria | 442702 |
| 229 | Ga0182007_10006614 | 3300015262 | Bacteria | 4964 |
| 230 | Ga0182007_10106538 | 3300015262 | Unclassified | 931 |
| 231 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 232 | Ga0163161_10000787 | 3300017792 | Bacteria | 24900 |
| 233 | Ga0163161_10000800 | 3300017792 | Bacteria | 24627 |
| 234 | Ga0163161_10000838 | 3300017792 | Bacteria | 23986 |
| 235 | Ga0163161_10007400 | 3300017792 | Bacteria | 7584 |
| 236 | Ga0163161_10028641 | 3300017792 | Bacteria | 3956 |
| 237 | Ga0163161_10033006 | 3300017792 | Bacteria | 3699 |
| 238 | Ga0163161_10253362 | 3300017792 | Bacteria | 1373 |
| 239 | Ga0206351_10102194 | 3300020077 | Bacteria | 1059 |
| 240 | Ga0206351_10975742 | 3300020077 | Bacteria | 639 |
| 241 | Ga0206352_10899470 | 3300020078 | Bacteria | 915 |
| 242 | Ga0206352_11031737 | 3300020078 | Bacteria | 709 |
| 243 | Ga0206350_10335256 | 3300020080 | Bacteria | 711 |
| 244 | Ga0206354_11258126 | 3300020081 | Bacteria | 679 |
| 245 | Ga0224712_10137680 | 3300022467 | Bacteria | 1072 |
| 246 | Ga0209563_107553 | 3300025230 | Bacteria | 1775 |
| 247 | Ga0207427_100159 | 3300025231 | Bacteria | 76256 |
| 248 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 249 | Ga0209437_100144 | 3300025233 | Bacteria | 164794 |
| 250 | Ga0209258_120069 | 3300025242 | Bacteria | 703 |
| 251 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 252 | Ga0209026_1003403 | 3300025250 | Bacteria | 5243 |
| 253 | Ga0209026_1004215 | 3300025250 | Bacteria | 4376 |
| 254 | Ga0209026_1019768 | 3300025250 | Bacteria | 1053 |
| 255 | Ga0209148_1018019 | 3300025254 | Bacteria | 1191 |
| 256 | Ga0209129_1000014 | 3300025258 | Bacteria | 509018 |
| 257 | Ga0209129_1035887 | 3300025258 | Bacteria | 804 |
| 258 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 259 | Ga0209233_1000524 | 3300025261 | Bacteria | 22083 |
| 260 | Ga0209233_1016027 | 3300025261 | Bacteria | 2072 |
| 261 | Ga0209233_1020888 | 3300025261 | Bacteria | 1707 |
| 262 | Ga0209455_1000854 | 3300025272 | Bacteria | 16294 |
| 263 | Ga0209676_1000039 | 3300025292 | Bacteria | 443158 |
| 264 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 265 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 266 | Ga0209050_1000033 | 3300025298 | Bacteria | 442615 |
| 267 | Ga0207656_10000027 | 3300025321 | Bacteria | 86479 |
| 268 | Ga0207647_10000036 | 3300025904 | Bacteria | 98204 |
| 269 | Ga0207647_10000135 | 3300025904 | Bacteria | 58247 |
| 270 | Ga0207647_10032124 | 3300025904 | Bacteria | 3375 |
| 271 | Ga0207645_10000312 | 3300025907 | Bacteria | 40968 |
| 272 | Ga0207705_10000090 | 3300025909 | Bacteria | 113233 |
| 273 | Ga0207705_10145411 | 3300025909 | Bacteria | 1773 |
| 274 | Ga0207705_10152355 | 3300025909 | Bacteria | 1733 |
| 275 | Ga0207705_10221646 | 3300025909 | Bacteria | 1437 |
| 276 | Ga0207705_10248913 | 3300025909 | Bacteria | 1355 |
| 277 | Ga0207705_10570876 | 3300025909 | Bacteria | 879 |
| 278 | Ga0207705_10906025 | 3300025909 | Unclassified | 683 |
| 279 | Ga0207654_10012162 | 3300025911 | Bacteria | 4405 |
| 280 | Ga0207654_10066304 | 3300025911 | Bacteria | 2129 |
| 281 | Ga0207654_10188108 | 3300025911 | Bacteria | 1351 |
| 282 | Ga0207654_10695942 | 3300025911 | Bacteria | 730 |
| 283 | Ga0207707_10090091 | 3300025912 | Bacteria | 2681 |
| 284 | Ga0207695_10000197 | 3300025913 | Bacteria | 168837 |
| 285 | Ga0207695_10048999 | 3300025913 | Bacteria | 4456 |
| 286 | Ga0207695_10060894 | 3300025913 | Bacteria | 3904 |
| 287 | Ga0207695_10119332 | 3300025913 | Bacteria | 2607 |
| 288 | Ga0207695_10302353 | 3300025913 | Bacteria | 1491 |
| 289 | Ga0207695_10325922 | 3300025913 | Bacteria | 1425 |
| 290 | Ga0207695_10461738 | 3300025913 | Bacteria | 1153 |
| 291 | Ga0207695_10525930 | 3300025913 | Bacteria | 1064 |
| 292 | Ga0207671_10000514 | 3300025914 | Bacteria | 52449 |
| 293 | Ga0207671_10000516 | 3300025914 | Bacteria | 52391 |
| 294 | Ga0207671_10004576 | 3300025914 | Bacteria | 13143 |
| 295 | Ga0207671_10050514 | 3300025914 | Bacteria | 3079 |
| 296 | Ga0207671_10106783 | 3300025914 | Bacteria | 2126 |
| 297 | Ga0207671_10149620 | 3300025914 | Bacteria | 1803 |
| 298 | Ga0207671_10225797 | 3300025914 | Bacteria | 1468 |
| 299 | Ga0207663_10575116 | 3300025916 | Bacteria | 883 |
| 300 | Ga0207660_10061068 | 3300025917 | Bacteria | 2712 |
| 301 | Ga0207657_10070315 | 3300025919 | Bacteria | 2967 |
| 302 | Ga0207657_10426756 | 3300025919 | Bacteria | 1042 |
| 303 | Ga0207657_10950276 | 3300025919 | Bacteria | 661 |
| 304 | Ga0207652_10027483 | 3300025921 | Bacteria | 4741 |
| 305 | Ga0207652_10322330 | 3300025921 | Bacteria | 1395 |
| 306 | Ga0207694_10199409 | 3300025924 | Bacteria | 1628 |
| 307 | Ga0207694_10285577 | 3300025924 | Bacteria | 1356 |
| 308 | Ga0207664_10737332 | 3300025929 | Bacteria | 886 |
| 309 | Ga0207644_10004264 | 3300025931 | Bacteria | 9279 |
| 310 | Ga0207690_10003074 | 3300025932 | Bacteria | 10052 |
| 311 | Ga0207690_10048622 | 3300025932 | Bacteria | 2822 |
| 312 | Ga0207690_10105159 | 3300025932 | Bacteria | 2024 |
| 313 | Ga0207706_10000466 | 3300025933 | Bacteria | 43209 |
| 314 | Ga0207706_10356900 | 3300025933 | Bacteria | 1270 |
| 315 | Ga0207686_10223896 | 3300025934 | Bacteria | 1360 |
| 316 | Ga0207709_10142418 | 3300025935 | Bacteria | 1649 |
| 317 | Ga0207709_10407925 | 3300025935 | Bacteria | 1040 |
| 318 | Ga0207670_10248180 | 3300025936 | Unclassified | 1374 |
| 319 | Ga0207704_10000123 | 3300025938 | Bacteria | 41995 |
| 320 | Ga0207691_10144358 | 3300025940 | Bacteria | 2096 |
| 321 | Ga0207661_10080160 | 3300025944 | Bacteria | 2693 |
| 322 | Ga0207667_10000033 | 3300025949 | Bacteria | 314353 |
| 323 | Ga0207667_10000408 | 3300025949 | Bacteria | 58389 |
| 324 | Ga0207667_10038475 | 3300025949 | Bacteria | 5109 |
| 325 | Ga0207667_10072414 | 3300025949 | Bacteria | 3582 |
| 326 | Ga0207667_10097087 | 3300025949 | Bacteria | 3041 |
| 327 | Ga0207667_10819348 | 3300025949 | Bacteria | 926 |
| 328 | Ga0207667_12173215 | 3300025949 | Bacteria | 512 |
| 329 | Ga0207651_10606751 | 3300025960 | Bacteria | 957 |
| 330 | Ga0207712_10130332 | 3300025961 | Bacteria | 1915 |
| 331 | Ga0207712_10844810 | 3300025961 | Bacteria | 807 |
| 332 | Ga0207640_10104052 | 3300025981 | Bacteria | 1997 |
| 333 | Ga0207640_10343801 | 3300025981 | Bacteria | 1196 |
| 334 | Ga0207640_11005212 | 3300025981 | Bacteria | 734 |
| 335 | Ga0207677_10039733 | 3300026023 | Bacteria | 3096 |
| 336 | Ga0207703_10214543 | 3300026035 | Bacteria | 1718 |
| 337 | Ga0207639_10008486 | 3300026041 | Bacteria | 7043 |
| 338 | Ga0207639_10061537 | 3300026041 | Bacteria | 2900 |
| 339 | Ga0207639_10220250 | 3300026041 | Bacteria | 1638 |
| 340 | Ga0207678_10021343 | 3300026067 | Bacteria | 5678 |
| 341 | Ga0207702_10000042 | 3300026078 | Bacteria | 150673 |
| 342 | Ga0207702_10017181 | 3300026078 | Bacteria | 5985 |
| 343 | Ga0207702_10041295 | 3300026078 | Bacteria | 3868 |
| 344 | Ga0207702_10143412 | 3300026078 | Bacteria | 2164 |
| 345 | Ga0207702_11133928 | 3300026078 | Bacteria | 776 |
| 346 | Ga0207641_10472791 | 3300026088 | Bacteria | 1214 |
| 347 | Ga0207648_10000913 | 3300026089 | Bacteria | 33285 |
| 348 | Ga0207676_11374618 | 3300026095 | Bacteria | 702 |
| 349 | Ga0207674_10052917 | 3300026116 | Bacteria | 4139 |
| 350 | Ga0207683_10042837 | 3300026121 | Bacteria | 3953 |
| 351 | Ga0207698_10158689 | 3300026142 | Bacteria | 1975 |
| 352 | Ga0207698_10420779 | 3300026142 | Bacteria | 1282 |
| 353 | Ga0207698_11137856 | 3300026142 | Bacteria | 794 |
| 354 | Ga0207698_11339857 | 3300026142 | Bacteria | 731 |
| 355 | Ga0207698_12241605 | 3300026142 | Bacteria | 559 |
| 356 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 357 | Ga0268264_10689495 | 3300028381 | Unclassified | 1014 |
| 358 | Ga0265318_10038333 | 3300028577 | Bacteria | 1832 |
| 359 | Ga0265322_10000666 | 3300028654 | Bacteria | 12820 |
| 360 | Ga0307517_10008846 | 3300028786 | Bacteria | 14389 |
| 361 | Ga0307515_10000299 | 3300028794 | Bacteria | 122087 |
| 362 | Ga0307515_10017355 | 3300028794 | Bacteria | 13116 |
| 363 | Ga0307515_10027268 | 3300028794 | Bacteria | 9776 |
| 364 | Ga0307515_10129864 | 3300028794 | Bacteria | 2784 |
| 365 | Ga0307515_10430276 | 3300028794 | Bacteria | 938 |
| 366 | Ga0265338_10011196 | 3300028800 | Bacteria | 10397 |
| 367 | Ga0316176_1017512 | 3300030732 | Bacteria | 17610 |
| 368 | Ga0316183_1098725 | 3300030742 | Bacteria | 33143 |
| 369 | Ga0316181_1132426 | 3300030744 | Unclassified | 3472 |
| 370 | Ga0316181_1167703 | 3300030744 | Bacteria | 2373 |
| 371 | Ga0316181_1199287 | 3300030744 | Bacteria | 890 |
| 372 | Ga0316182_1262601 | 3300030745 | Bacteria | 1086 |
| 373 | Ga0265332_10145367 | 3300031238 | Bacteria | 993 |
| 374 | Ga0265320_10045945 | 3300031240 | Bacteria | 2143 |
| 375 | Ga0265339_10018562 | 3300031249 | Bacteria | 4096 |
| 376 | Ga0265331_10016100 | 3300031250 | Bacteria | 3932 |
| 377 | Ga0265331_10074885 | 3300031250 | Bacteria | 1579 |
| 378 | Ga0265327_10000172 | 3300031251 | Bacteria | 139400 |
| 379 | Ga0265327_10112526 | 3300031251 | Bacteria | 1299 |
| 380 | Ga0265316_10017745 | 3300031344 | Bacteria | 6138 |
| 381 | Ga0307509_10117242 | 3300031507 | Bacteria | 2650 |
| 382 | Ga0307509_10332984 | 3300031507 | Bacteria | 1249 |
| 383 | Ga0307408_100000628 | 3300031548 | Bacteria | 29832 |
| 384 | Ga0307408_100000671 | 3300031548 | Bacteria | 28437 |
| 385 | Ga0307408_100001834 | 3300031548 | Bacteria | 15479 |
| 386 | Ga0265314_10059606 | 3300031711 | Bacteria | 2610 |
| 387 | Ga0265342_10020333 | 3300031712 | Bacteria | 4261 |
| 388 | Ga0316576_10889536 | 3300031727 | Bacteria | 638 |
| 389 | Ga0316578_10545908 | 3300031728 | Unclassified | 681 |
| 390 | Ga0316578_10671347 | 3300031728 | Bacteria | 604 |
| 391 | Ga0307405_10000009 | 3300031731 | Bacteria | 259388 |
| 392 | Ga0307405_10030688 | 3300031731 | Bacteria | 3154 |
| 393 | Ga0307413_10415852 | 3300031824 | Bacteria | 1058 |
| 394 | Ga0307413_10999963 | 3300031824 | Bacteria | 717 |
| 395 | Ga0307406_11010840 | 3300031901 | Bacteria | 714 |
| 396 | Ga0307407_10000001 | 3300031903 | Bacteria | 570048 |
| 397 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 398 | Ga0307412_10011880 | 3300031911 | Bacteria | 5057 |
| 399 | Ga0307412_10115157 | 3300031911 | Bacteria | 1926 |
| 400 | Ga0307412_10223081 | 3300031911 | Bacteria | 1446 |
| 401 | Ga0307412_10228184 | 3300031911 | Bacteria | 1432 |
| 402 | Ga0307412_10665734 | 3300031911 | Unclassified | 890 |
| 403 | Ga0307412_11582711 | 3300031911 | Bacteria | 598 |
| 404 | Ga0307409_100000833 | 3300031995 | Bacteria | 14214 |
| 405 | Ga0307409_101546022 | 3300031995 | Bacteria | 691 |
| 406 | Ga0307416_100000008 | 3300032002 | Bacteria | 401343 |
| 407 | Ga0307416_100358950 | 3300032002 | Bacteria | 1478 |
| 408 | Ga0307414_10000268 | 3300032004 | Bacteria | 32688 |
| 409 | Ga0307414_10001436 | 3300032004 | Bacteria | 12368 |
| 410 | Ga0307414_10005701 | 3300032004 | Bacteria | 6877 |
| 411 | Ga0307414_10017760 | 3300032004 | Bacteria | 4361 |
| 412 | Ga0307414_10020240 | 3300032004 | Bacteria | 4144 |
| 413 | Ga0307414_10021383 | 3300032004 | Bacteria | 4058 |
| 414 | Ga0307414_10040328 | 3300032004 | Bacteria | 3153 |
| 415 | Ga0307414_10078558 | 3300032004 | Bacteria | 2406 |
| 416 | Ga0307414_10151219 | 3300032004 | Bacteria | 1831 |
| 417 | Ga0307414_10199112 | 3300032004 | Bacteria | 1627 |
| 418 | Ga0307414_10213712 | 3300032004 | Bacteria | 1578 |
| 419 | Ga0307414_10225625 | 3300032004 | Bacteria | 1541 |
| 420 | Ga0307414_10247602 | 3300032004 | Bacteria | 1479 |
| 421 | Ga0307414_10416579 | 3300032004 | Bacteria | 1170 |
| 422 | Ga0307414_10423324 | 3300032004 | Unclassified | 1162 |
| 423 | Ga0307414_10829705 | 3300032004 | Bacteria | 844 |
| 424 | Ga0307414_11098145 | 3300032004 | Bacteria | 734 |
| 425 | Ga0307411_10226670 | 3300032005 | Bacteria | 1454 |
| 426 | Ga0307411_10241333 | 3300032005 | Bacteria | 1415 |
| 427 | Ga0307507_10000313 | 3300033179 | Bacteria | 97672 |
| 428 | Ga0307510_10001091 | 3300033180 | Bacteria | 28923 |
| 429 | Ga0373941_0003096 | 3300035115 | Bacteria | 3730 |
| 430 | Ga0316574_0125076 | 3300035398 | Bacteria | 1652 |
| 431 | Ga0316574_0197547 | 3300035398 | Bacteria | 1293 |
| 432 | Ga0316584_0058280 | 3300036712 | Bacteria | 2892 |
| 433 | Ga0395899_0000011 | 3300037312 | Bacteria | 521331 |
| 434 | Ga0395899_0000780 | 3300037312 | Bacteria | 31338 |
| 435 | Ga0395899_0004206 | 3300037312 | Bacteria | 11292 |
| 436 | Ga0395900_0000478 | 3300037418 | Bacteria | 56604 |
| 437 | Ga0395900_0001720 | 3300037418 | Bacteria | 25283 |
| 438 | Ga0395900_0006013 | 3300037418 | Bacteria | 12660 |
| 439 | Ga0395898_0053528 | 3300037466 | Bacteria | 3942 |
| 440 | Ga0395898_0057445 | 3300037466 | Bacteria | 3792 |
| 441 | Ga0395905_0000705 | 3300037471 | Bacteria | 44338 |
| 442 | Ga0395905_0002686 | 3300037471 | Bacteria | 19498 |
| 443 | Ga0395905_0004170 | 3300037471 | Bacteria | 15118 |
| 444 | Ga0395901_0001267 | 3300038443 | Bacteria | 26781 |
| 445 | Ga0395901_0026240 | 3300038443 | Bacteria | 5981 |
| 446 | Ga0436361_0530171 | 3300039447 | Bacteria | 11212 |
| 447 | Ga0451787_768126 | 3300041441 | Bacteria | 785 |
| 448 | Ga0451793_0105024 | 3300041452 | Bacteria | 1104 |
| 449 | Ga0451797_1468381 | 3300041453 | Bacteria | 672 |
| 450 | Ga0451798_1002939 | 3300041458 | Bacteria | 574 |
| 451 | Ga0451807_1307333 | 3300041486 | Bacteria | 556 |
| 452 | Ga0451849_0358896 | 3300041505 | Bacteria | 667 |
| 453 | Ga0439448_0118018 | 3300042005 | Bacteria | 909 |
| 454 | Ga0451577_0000935 | 3300042876 | Bacteria | 42928 |
| 455 | Ga0453683_0001745 | 3300044673 | Bacteria | 18035 |
| 456 | Ga0453683_0114321 | 3300044673 | Bacteria | 1698 |
| 457 | Ga0466966_0064372 | 3300044684 | Bacteria | 2308 |
| 458 | Ga0466961_0035332 | 3300044693 | Bacteria | 3210 |
| 459 | Ga0453684_0000696 | 3300044712 | Bacteria | 119520 |
| 460 | Ga0453684_0113475 | 3300044712 | Bacteria | 3287 |
| 461 | Ga0453684_0326412 | 3300044712 | Unclassified | 1736 |
| 462 | Ga0453684_0331834 | 3300044712 | Bacteria | 1720 |
| 463 | Ga0453684_0570966 | 3300044712 | Bacteria | 1243 |
| 464 | Ga0466970_0049594 | 3300044765 | Unclassified | 2239 |
| 465 | Ga0466959_0027729 | 3300045049 | Bacteria | 4200 |
| 466 | Ga0466959_0128403 | 3300045049 | Bacteria | 1798 |
| 467 | Ga0451576_0027949 | 3300045051 | Bacteria | 6050 |
| 468 | Ga0451576_0107623 | 3300045051 | Bacteria | 2901 |
| 469 | Ga0466958_0029480 | 3300045836 | Bacteria | 3256 |
| 470 | Ga0495629_0121174 | 3300046459 | Bacteria | 1822 |
| 471 | Ga0495650_0000050 | 3300046471 | Bacteria | 318894 |
| 472 | Ga0495585_0000198 | 3300046492 | Bacteria | 62640 |
| 473 | Ga0495585_0001607 | 3300046492 | Bacteria | 17441 |
| 474 | Ga0495607_0255244 | 3300046501 | Bacteria | 842 |
| 475 | Ga0495583_0148676 | 3300046506 | Bacteria | 972 |
| 476 | Ga0495606_0000213 | 3300046507 | Bacteria | 103305 |
| 477 | Ga0495606_0002949 | 3300046507 | Bacteria | 18762 |
| 478 | Ga0495606_0015650 | 3300046507 | Bacteria | 5829 |
| 479 | Ga0495606_0017631 | 3300046507 | Bacteria | 5389 |
| 480 | Ga0495606_0028874 | 3300046507 | Bacteria | 3905 |
| 481 | Ga0495606_0183159 | 3300046507 | Bacteria | 1206 |
| 482 | Ga0495606_0242785 | 3300046507 | Bacteria | 1003 |
| 483 | Ga0495608_0464603 | 3300046511 | Bacteria | 769 |
| 484 | Ga0495610_0000076 | 3300046512 | Bacteria | 118246 |
| 485 | Ga0495610_0000696 | 3300046512 | Bacteria | 32341 |
| 486 | Ga0495610_0001134 | 3300046512 | Bacteria | 24228 |
| 487 | Ga0495616_0000433 | 3300046513 | Bacteria | 31968 |
| 488 | Ga0495616_0022684 | 3300046513 | Bacteria | 3387 |
| 489 | Ga0495631_0011938 | 3300046518 | Bacteria | 4259 |
| 490 | Ga0495631_0051578 | 3300046518 | Bacteria | 1798 |
| 491 | Ga0495631_0171908 | 3300046518 | Bacteria | 929 |
| 492 | Ga0495637_0033328 | 3300046520 | Bacteria | 2263 |
| 493 | Ga0495644_0030789 | 3300046523 | Bacteria | 2026 |
| 494 | Ga0495648_0004911 | 3300046524 | Bacteria | 11246 |
| 495 | Ga0495648_0007028 | 3300046524 | Bacteria | 9074 |
| 496 | Ga0495642_0150214 | 3300046528 | Unclassified | 1007 |
| 497 | Ga0495652_0170280 | 3300046529 | Bacteria | 1682 |
| 498 | Ga0495652_0318317 | 3300046529 | Bacteria | 1125 |
| 499 | Ga0495652_0860419 | 3300046529 | Bacteria | 600 |
| 500 | Ga0495654_0223566 | 3300046530 | Bacteria | 795 |
| 501 | Ga0495609_0002985 | 3300046538 | Bacteria | 9997 |
| 502 | Ga0495609_0011292 | 3300046538 | Bacteria | 4258 |
| 503 | Ga0495621_0123436 | 3300046539 | Bacteria | 1002 |
| 504 | Ga0495622_0066925 | 3300046557 | Bacteria | 1660 |
| 505 | Ga0495633_0000295 | 3300046558 | Bacteria | 56870 |
| 506 | Ga0495633_0004623 | 3300046558 | Bacteria | 8671 |
| 507 | Ga0495633_0016647 | 3300046558 | Bacteria | 3784 |
| 508 | Ga0495668_0000121 | 3300046616 | Bacteria | 116234 |
| 509 | Ga0495625_0000105 | 3300046660 | Bacteria | 126078 |
| 510 | Ga0495625_0000316 | 3300046660 | Bacteria | 73939 |
| 511 | Ga0495625_0002036 | 3300046660 | Bacteria | 22758 |
| 512 | Ga0495625_0015634 | 3300046660 | Bacteria | 6002 |
| 513 | Ga0495625_0058128 | 3300046660 | Bacteria | 2748 |
| 514 | Ga0495625_0079580 | 3300046660 | Bacteria | 2285 |
| 515 | Ga0495625_0098382 | 3300046660 | Bacteria | 2012 |
| 516 | Ga0495625_0461379 | 3300046660 | Bacteria | 783 |
| 517 | Ga0495661_0001116 | 3300046665 | Bacteria | 23480 |
| 518 | Ga0495661_0021682 | 3300046665 | Bacteria | 4184 |
| 519 | Ga0495661_0107213 | 3300046665 | Bacteria | 1562 |
| 520 | Ga0495658_0376779 | 3300046683 | Bacteria | 903 |
| 521 | Ga0495658_0388747 | 3300046683 | Bacteria | 889 |
| 522 | Ga0495658_0690920 | 3300046683 | Bacteria | 654 |
| 523 | Ga0495669_0228285 | 3300046684 | Bacteria | 893 |
| 524 | Ga0495670_0136694 | 3300046691 | Bacteria | 1280 |
| 525 | Ga0495649_0000011 | 3300046694 | Bacteria | 416695 |
| 526 | Ga0495589_0053508 | 3300046794 | Bacteria | 1992 |
| 527 | Ga0495660_0014777 | 3300046810 | Bacteria | 4515 |
| 528 | Ga0495660_0089654 | 3300046810 | Bacteria | 1601 |
| 529 | Ga0495672_0216411 | 3300047320 | Bacteria | 948 |
| 530 | Ga0495687_000249 | 3300047443 | Bacteria | 72846 |
| 531 | Ga0495687_000556 | 3300047443 | Bacteria | 44028 |
| 532 | Ga0495673_0017458 | 3300047469 | Bacteria | 3643 |
| 533 | Ga0495681_0294079 | 3300047470 | Bacteria | 630 |
| 534 | Ga0495686_0000306 | 3300047472 | Bacteria | 83341 |
| 535 | Ga0495686_0006170 | 3300047472 | Bacteria | 9265 |
| 536 | Ga0495686_0011257 | 3300047472 | Bacteria | 6308 |
| 537 | Ga0495686_0054555 | 3300047472 | Bacteria | 2502 |
| 538 | Ga0495686_0083731 | 3300047472 | Bacteria | 1945 |
| 539 | Ga0495602_0253515 | 3300048088 | Bacteria | 1310 |
| 540 | Ga0495614_0012346 | 3300048089 | Bacteria | 3749 |
| 541 | Ga0496115_0533308 | 3300048918 | Bacteria | 940 |
| 542 | Ga0496126_0408942 | 3300048929 | Bacteria | 1099 |
| 543 | Ga0495678_004962 | 3300049459 | Bacteria | 7501 |
| 544 | Ga0495682_0130090 | 3300049460 | Bacteria | 900 |
| 545 | Ga0501316_031660 | 3300049532 | Bacteria | 710 |
| 546 | Ga0501033_0358777 | 3300049570 | Bacteria | 1020 |
| 547 | Ga0501034_0674197 | 3300049571 | Bacteria | 934 |
| 548 | Ga0501198_017809 | 3300049649 | Bacteria | 1108 |
| 549 | Ga0501227_085631 | 3300049665 | Bacteria | 829 |
| 550 | Ga0501238_032085 | 3300049671 | Bacteria | 761 |
| 551 | Ga0501240_016056 | 3300049673 | Bacteria | 1072 |
| 552 | Ga0501241_002026 | 3300049758 | Bacteria | 3973 |
| 553 | Ga0501273_056872 | 3300049770 | Bacteria | 609 |
| 554 | Ga0501204_025641 | 3300049850 | Bacteria | 794 |
| 555 | nmdc:mga0k408_148394_c1 | 3300050493 | Bacteria | 1396 |
| 556 | nmdc:mga0k408_20927_c1 | 3300050493 | Bacteria | 3671 |
| 557 | nmdc:mga0k408_275_c2 | 3300050493 | Bacteria | 24277 |
| 558 | nmdc:mga0k408_66_c1 | 3300050493 | Bacteria | 33479 |
| 559 | nmdc:mga07m45_103476_c1 | 3300050496 | Bacteria | 1636 |
| 560 | Ga0500635_0000412 | 3300053080 | Bacteria | 12782 |
| 561 | Ga0500635_0069511 | 3300053080 | Bacteria | 1246 |
| 562 | Ga0500578_0341928 | 3300053086 | Bacteria | 877 |
| 563 | Ga0500651_0001193 | 3300053093 | Bacteria | 12892 |
| 564 | Ga0500572_079552 | 3300053111 | Bacteria | 1025 |
| 565 | Ga0500608_000596 | 3300053122 | Bacteria | 13310 |
| 566 | Ga0500608_008269 | 3300053122 | Bacteria | 4364 |
| 567 | Ga0500618_000033 | 3300053125 | Bacteria | 121886 |
| 568 | Ga0500619_121475 | 3300053154 | Bacteria | 890 |
| 569 | Ga0500622_0001136 | 3300053156 | Bacteria | 22218 |
| 570 | Ga0500624_000712 | 3300053157 | Bacteria | 8312 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014968 | Ga0157379_10131009 | Ga0157379_101310092 | 131 |
| 2 | 3300005618 | Ga0068864_102106013 | Ga0068864_1021060131 | 136 |
| 3 | 3300026095 | Ga0207676_11374618 | Ga0207676_113746181 | 136 |
| 4 | 3300005618 | Ga0068864_101657122 | Ga0068864_1016571221 | 151 |
| 5 | 3300005841 | Ga0068863_100170839 | Ga0068863_1001708392 | 151 |
| 6 | 3300026088 | Ga0207641_10472791 | Ga0207641_104727911 | 151 |
| 7 | 3300044712 | Ga0453684_0113475 | Ga0453684_0113475_1408_1863 | 151 |
| 8 | iso_pu_bacteria | 2523533629 | 2524006388 | 152 |
| 9 | iso_pu_bacteria | 2519899754 | 2520881002 | 153 |
| 10 | iso_pu_bacteria | 2585427687 | 2586208806 | 153 |
| 11 | iso_pu_bacteria | 2599185184 | 2599479812 | 153 |
| 12 | iso_pu_bacteria | 2643221600 | 2644012536 | 153 |
| 13 | iso_pu_bacteria | 2643221667 | 2644371789 | 153 |
| 14 | iso_pu_bacteria | 2643221716 | 2644640865 | 153 |
| 15 | iso_pu_bacteria | 2643221725 | 2644684316 | 153 |
| 16 | iso_pu_bacteria | 2738541279 | 2738734943 | 153 |
| 17 | iso_pu_bacteria | 2738541284 | 2738763146 | 153 |
| 18 | iso_pu_bacteria | 2738541285 | 2738769086 | 153 |
| 19 | iso_pu_bacteria | 2738541302 | 2738854845 | 153 |
| 20 | iso_pu_bacteria | 2738543007 | 2739216525 | 153 |
| 21 | iso_pu_bacteria | 2738543023 | 2739303828 | 153 |
| 22 | iso_pu_bacteria | 2739367651 | 2739587039 | 153 |
| 23 | iso_pu_bacteria | 2739367656 | 2739618228 | 153 |
| 24 | iso_pu_bacteria | 2739367663 | 2739646335 | 153 |
| 25 | iso_pu_bacteria | 2739367857 | 2739999821 | 153 |
| 26 | iso_pu_bacteria | 2739367858 | 2740004637 | 153 |
| 27 | iso_pu_bacteria | 2775506987 | 2776616317 | 153 |
| 28 | iso_pu_bacteria | 2802428842 | 2802651792 | 153 |
| 29 | iso_pu_bacteria | 2816332280 | 2817414661 | 153 |
| 30 | iso_pu_bacteria | 2818991437 | 2819547490 | 153 |
| 31 | iso_pu_bacteria | 2833640130 | 2833641343 | 153 |
| 32 | iso_pu_bacteria | 2842722452 | 2842726514 | 153 |
| 33 | iso_pu_bacteria | 2842903701 | 2842904819 | 153 |
| 34 | iso_pu_bacteria | 2842909656 | 2842911278 | 153 |
| 35 | iso_pu_bacteria | 2849281842 | 2849286485 | 153 |
| 36 | iso_pu_bacteria | 2852623160 | 2852626024 | 153 |
| 37 | iso_pu_bacteria | 2852627209 | 2852629657 | 153 |
| 38 | iso_pu_bacteria | 2857613821 | 2857615359 | 153 |
| 39 | iso_pu_bacteria | 2857618242 | 2857622834 | 153 |
| 40 | iso_pu_bacteria | 2857627736 | 2857631482 | 153 |
| 41 | iso_pu_bacteria | 2881247448 | 2881250504 | 153 |
| 42 | iso_pu_bacteria | 2881359912 | 2881363997 | 153 |
| 43 | iso_pu_bacteria | 2881955468 | 2881956713 | 153 |
| 44 | iso_pu_bacteria | 2884933994 | 2884935508 | 153 |
| 45 | iso_pu_bacteria | 2896317667 | 2896319661 | 153 |
| 46 | iso_pu_bacteria | 2902048731 | 2902051948 | 153 |
| 47 | iso_pu_bacteria | 2903895155 | 2903895744 | 153 |
| 48 | iso_pu_bacteria | 2904419702 | 2904422558 | 153 |
| 49 | iso_pu_bacteria | 2904445276 | 2904448921 | 153 |
| 50 | iso_pu_bacteria | 2904555929 | 2904558304 | 153 |
| 51 | iso_pu_bacteria | 2919186247 | 2919191068 | 153 |
| 52 | iso_pu_bacteria | 2919191525 | 2919192959 | 153 |
| 53 | iso_pu_bacteria | 2919437846 | 2919439413 | 153 |
| 54 | iso_pu_bacteria | 2919683626 | 2919683672 | 153 |
| 55 | iso_pu_bacteria | 2928078545 | 2928080943 | 153 |
| 56 | iso_pu_bacteria | 2928147474 | 2928152638 | 153 |
| 57 | iso_pu_bacteria | 2929150217 | 2929151803 | 153 |
| 58 | iso_pu_bacteria | 2932082852 | 2932086964 | 153 |
| 59 | iso_pu_bacteria | 2939664404 | 2939669348 | 153 |
| 60 | iso_pu_bacteria | 2945997725 | 2946003185 | 153 |
| 61 | iso_pu_bacteria | 2954016120 | 2954020042 | 153 |
| 62 | iso_pu_bacteria | 2958458903 | 2958462638 | 153 |
| 63 | iso_pu_bacteria | 2977232053 | 2977234087 | 153 |
| 64 | iso_pu_bacteria | 2977268062 | 2977268532 | 153 |
| 65 | iso_pu_bacteria | 3003233435 | 3003233619 | 153 |
| 66 | iso_pu_bacteria | 8036736890 | 8036737203 | 153 |
| 67 | iso_pu_bacteria | 8054307821 | 8054308978 | 153 |
| 68 | iso_pu_bacteria | 8055419101 | 8055419557 | 153 |
| 69 | iso_pu_bacteria | 8055588893 | 8055589668 | 153 |
| 70 | iso_pu_bacteria | 8055592153 | 8055595814 | 153 |
| 71 | iso_pu_bacteria | 8056440228 | 8056443205 | 153 |
| 72 | 3300005365 | Ga0070688_100123958 | Ga0070688_1001239582 | 156 |
| 73 | 3300005466 | Ga0070685_10283476 | Ga0070685_102834762 | 156 |
| 74 | 3300005614 | Ga0068856_101395529 | Ga0068856_1013955292 | 156 |
| 75 | 3300025936 | Ga0207670_10248180 | Ga0207670_102481802 | 156 |
| 76 | 3300026078 | Ga0207702_11133928 | Ga0207702_111339282 | 156 |
| 77 | 3300028577 | Ga0265318_10038333 | Ga0265318_100383332 | 156 |
| 78 | 3300031238 | Ga0265332_10145367 | Ga0265332_101453672 | 156 |
| 79 | 3300031240 | Ga0265320_10045945 | Ga0265320_100459453 | 156 |
| 80 | 3300031249 | Ga0265339_10018562 | Ga0265339_100185623 | 156 |
| 81 | 3300031250 | Ga0265331_10016100 | Ga0265331_100161004 | 156 |
| 82 | 3300031344 | Ga0265316_10017745 | Ga0265316_100177454 | 156 |
| 83 | 3300031711 | Ga0265314_10059606 | Ga0265314_100596062 | 156 |
| 84 | 3300031712 | Ga0265342_10020333 | Ga0265342_100203332 | 156 |
| 85 | 3300041441 | Ga0451787_768126 | Ga0451787_768126_103_576 | 156 |
| 86 | 3300044712 | Ga0453684_0331834 | Ga0453684_0331834_578_1048 | 156 |
| 87 | 2162886007 | SwRhRL2b_contig_2255685 | SwRhRL2b_0652.00005740 | 157 |
| 88 | 2162886007 | SwRhRL2b_contig_677025 | SwRhRL2b_0927.00001600 | 157 |
| 89 | 3300001904 | JGI24736J21556_1006598 | JGI24736J21556_10065982 | 157 |
| 90 | 3300001990 | JGI24737J22298_10000303 | JGI24737J22298_100003034 | 157 |
| 91 | 3300001990 | JGI24737J22298_10017213 | JGI24737J22298_100172132 | 157 |
| 92 | 3300001990 | JGI24737J22298_10027852 | JGI24737J22298_100278523 | 157 |
| 93 | 3300002067 | JGI24735J21928_10000007 | JGI24735J21928_10000007148 | 157 |
| 94 | 3300002737 | JGI25162J39368_1000408 | JGI25162J39368_100040826 | 157 |
| 95 | 3300002737 | JGI25162J39368_1001130 | JGI25162J39368_100113012 | 157 |
| 96 | 3300002741 | JGI25157J39369_1026186 | JGI25157J39369_10261861 | 157 |
| 97 | 3300002772 | JGI25164J39214_1001242 | JGI25164J39214_10012422 | 157 |
| 98 | 3300002774 | JGI25150J39212_1000003 | JGI25150J39212_1000003236 | 157 |
| 99 | 3300003187 | JGI25151J46595_10000002 | JGI25151J46595_10000002236 | 157 |
| 100 | 3300003214 | JGI25165J46597_1001079 | JGI25165J46597_10010797 | 157 |
| 101 | 3300003215 | JGI25153J46596_10000015 | JGI25153J46596_1000001547 | 157 |
| 102 | 3300003316 | rootH1_10012261 | rootH1_100122612 | 157 |
| 103 | 3300003320 | rootH2_10021444 | rootH2_1002144413 | 157 |
| 104 | 3300003320 | rootH2_10163983 | rootH2_101639832 | 157 |
| 105 | 3300003322 | rootL2_10017333 | rootL2_100173338 | 157 |
| 106 | 3300003323 | rootH1_10007236 | rootH1_1000723611 | 157 |
| 107 | 3300003323 | rootH1_10123432 | rootH1_101234322 | 157 |
| 108 | 3300003781 | Ga0055536_1000006 | Ga0055536_1000006147 | 157 |
| 109 | 3300003791 | Ga0055530_10003370 | Ga0055530_100033703 | 157 |
| 110 | 3300004799 | Ga0058863_11132184 | Ga0058863_111321842 | 157 |
| 111 | 3300004800 | Ga0058861_10544333 | Ga0058861_105443332 | 157 |
| 112 | 3300005288 | Ga0065714_10002307 | Ga0065714_1000230727 | 157 |
| 113 | 3300005288 | Ga0065714_10004556 | Ga0065714_100045568 | 157 |
| 114 | 3300005288 | Ga0065714_10013498 | Ga0065714_100134982 | 157 |
| 115 | 3300005288 | Ga0065714_10171551 | Ga0065714_101715511 | 157 |
| 116 | 3300005289 | Ga0065704_10000425 | Ga0065704_1000042513 | 157 |
| 117 | 3300005289 | Ga0065704_10037577 | Ga0065704_100375772 | 157 |
| 118 | 3300005289 | Ga0065704_10091506 | Ga0065704_100915061 | 157 |
| 119 | 3300005293 | Ga0065715_10820055 | Ga0065715_108200551 | 157 |
| 120 | 3300005327 | Ga0070658_10000058 | Ga0070658_100000584 | 157 |
| 121 | 3300005327 | Ga0070658_10199513 | Ga0070658_101995132 | 157 |
| 122 | 3300005327 | Ga0070658_10374165 | Ga0070658_103741653 | 157 |
| 123 | 3300005327 | Ga0070658_10381425 | Ga0070658_103814252 | 157 |
| 124 | 3300005327 | Ga0070658_10623627 | Ga0070658_106236271 | 157 |
| 125 | 3300005327 | Ga0070658_10669752 | Ga0070658_106697521 | 157 |
| 126 | 3300005328 | Ga0070676_10002416 | Ga0070676_100024167 | 157 |
| 127 | 3300005329 | Ga0070683_100106209 | Ga0070683_1001062094 | 157 |
| 128 | 3300005334 | Ga0068869_100288693 | Ga0068869_1002886932 | 157 |
| 129 | 3300005336 | Ga0070680_100050557 | Ga0070680_1000505573 | 157 |
| 130 | 3300005336 | Ga0070680_100398285 | Ga0070680_1003982851 | 157 |
| 131 | 3300005338 | Ga0068868_100031260 | Ga0068868_1000312605 | 157 |
| 132 | 3300005339 | Ga0070660_100027913 | Ga0070660_1000279138 | 157 |
| 133 | 3300005339 | Ga0070660_100368814 | Ga0070660_1003688142 | 157 |
| 134 | 3300005344 | Ga0070661_100268696 | Ga0070661_1002686963 | 157 |
| 135 | 3300005354 | Ga0070675_101564256 | Ga0070675_1015642561 | 157 |
| 136 | 3300005355 | Ga0070671_100017668 | Ga0070671_1000176683 | 157 |
| 137 | 3300005366 | Ga0070659_100000766 | Ga0070659_10000076611 | 157 |
| 138 | 3300005366 | Ga0070659_100016158 | Ga0070659_1000161585 | 157 |
| 139 | 3300005366 | Ga0070659_100131080 | Ga0070659_1001310802 | 157 |
| 140 | 3300005455 | Ga0070663_100048593 | Ga0070663_1000485933 | 157 |
| 141 | 3300005456 | Ga0070678_100135001 | Ga0070678_1001350012 | 157 |
| 142 | 3300005457 | Ga0070662_100000043 | Ga0070662_10000004336 | 157 |
| 143 | 3300005458 | Ga0070681_10002600 | Ga0070681_1000260016 | 157 |
| 144 | 3300005459 | Ga0068867_100086395 | Ga0068867_1000863954 | 157 |
| 145 | 3300005530 | Ga0070679_100005033 | Ga0070679_10000503312 | 157 |
| 146 | 3300005535 | Ga0070684_100301504 | Ga0070684_1003015041 | 157 |
| 147 | 3300005535 | Ga0070684_101304246 | Ga0070684_1013042461 | 157 |
| 148 | 3300005539 | Ga0068853_100026336 | Ga0068853_1000263364 | 157 |
| 149 | 3300005539 | Ga0068853_100092816 | Ga0068853_1000928163 | 157 |
| 150 | 3300005539 | Ga0068853_100262356 | Ga0068853_1002623562 | 157 |
| 151 | 3300005539 | Ga0068853_100531774 | Ga0068853_1005317742 | 157 |
| 152 | 3300005548 | Ga0070665_100000017 | Ga0070665_100000017206 | 157 |
| 153 | 3300005563 | Ga0068855_100000060 | Ga0068855_10000006034 | 157 |
| 154 | 3300005563 | Ga0068855_100000489 | Ga0068855_10000048925 | 157 |
| 155 | 3300005563 | Ga0068855_100005005 | Ga0068855_1000050054 | 157 |
| 156 | 3300005563 | Ga0068855_100042809 | Ga0068855_1000428098 | 157 |
| 157 | 3300005563 | Ga0068855_100093441 | Ga0068855_1000934414 | 157 |
| 158 | 3300005563 | Ga0068855_100325758 | Ga0068855_1003257582 | 157 |
| 159 | 3300005563 | Ga0068855_100490007 | Ga0068855_1004900072 | 157 |
| 160 | 3300005577 | Ga0068857_100007916 | Ga0068857_1000079165 | 157 |
| 161 | 3300005577 | Ga0068857_100197778 | Ga0068857_1001977781 | 157 |
| 162 | 3300005578 | Ga0068854_100355733 | Ga0068854_1003557332 | 157 |
| 163 | 3300005614 | Ga0068856_100000040 | Ga0068856_10000004040 | 157 |
| 164 | 3300005614 | Ga0068856_100006135 | Ga0068856_1000061359 | 157 |
| 165 | 3300005614 | Ga0068856_100015573 | Ga0068856_1000155737 | 157 |
| 166 | 3300005614 | Ga0068856_100300340 | Ga0068856_1003003402 | 157 |
| 167 | 3300005614 | Ga0068856_100310564 | Ga0068856_1003105642 | 157 |
| 168 | 3300005614 | Ga0068856_100403441 | Ga0068856_1004034412 | 157 |
| 169 | 3300005616 | Ga0068852_100001476 | Ga0068852_10000147615 | 157 |
| 170 | 3300005616 | Ga0068852_101534264 | Ga0068852_1015342642 | 157 |
| 171 | 3300005617 | Ga0068859_102138690 | Ga0068859_1021386901 | 157 |
| 172 | 3300005618 | Ga0068864_100319501 | Ga0068864_1003195012 | 157 |
| 173 | 3300005718 | Ga0068866_10045008 | Ga0068866_100450083 | 157 |
| 174 | 3300005840 | Ga0068870_10035732 | Ga0068870_100357323 | 157 |
| 175 | 3300005841 | Ga0068863_101586957 | Ga0068863_1015869571 | 157 |
| 176 | 3300005842 | Ga0068858_100163125 | Ga0068858_1001631253 | 157 |
| 177 | 3300005842 | Ga0068858_100220214 | Ga0068858_1002202144 | 157 |
| 178 | 3300005843 | Ga0068860_100780885 | Ga0068860_1007808852 | 157 |
| 179 | 3300005844 | Ga0068862_100169619 | Ga0068862_1001696193 | 157 |
| 180 | 3300006195 | Ga0075366_10001904 | Ga0075366_100019044 | 157 |
| 181 | 3300006195 | Ga0075366_10003458 | Ga0075366_100034585 | 157 |
| 182 | 3300006195 | Ga0075366_10005500 | Ga0075366_100055001 | 157 |
| 183 | 3300006195 | Ga0075366_10128355 | Ga0075366_101283552 | 157 |
| 184 | 3300006237 | Ga0097621_100000099 | Ga0097621_10000009918 | 157 |
| 185 | 3300006237 | Ga0097621_101025510 | Ga0097621_1010255102 | 157 |
| 186 | 3300006353 | Ga0075370_10172582 | Ga0075370_101725821 | 157 |
| 187 | 3300006358 | Ga0068871_100000290 | Ga0068871_1000002906 | 157 |
| 188 | 3300006881 | Ga0068865_100005903 | Ga0068865_1000059035 | 157 |
| 189 | 3300006881 | Ga0068865_100933051 | Ga0068865_1009330511 | 157 |
| 190 | 3300006931 | Ga0097620_102138977 | Ga0097620_1021389771 | 157 |
| 191 | 3300009036 | Ga0105244_10132016 | Ga0105244_101320162 | 157 |
| 192 | 3300009093 | Ga0105240_10011079 | Ga0105240_1001107911 | 157 |
| 193 | 3300009093 | Ga0105240_10034592 | Ga0105240_100345923 | 157 |
| 194 | 3300009093 | Ga0105240_10114183 | Ga0105240_101141833 | 157 |
| 195 | 3300009093 | Ga0105240_10120468 | Ga0105240_101204684 | 157 |
| 196 | 3300009093 | Ga0105240_10184210 | Ga0105240_101842101 | 157 |
| 197 | 3300009093 | Ga0105240_10447706 | Ga0105240_104477061 | 157 |
| 198 | 3300009093 | Ga0105240_10738482 | Ga0105240_107384821 | 157 |
| 199 | 3300009093 | Ga0105240_10962389 | Ga0105240_109623891 | 157 |
| 200 | 3300009148 | Ga0105243_10049063 | Ga0105243_100490634 | 157 |
| 201 | 3300009148 | Ga0105243_10190265 | Ga0105243_101902652 | 157 |
| 202 | 3300009174 | Ga0105241_10001269 | Ga0105241_100012692 | 157 |
| 203 | 3300009174 | Ga0105241_10011955 | Ga0105241_100119553 | 157 |
| 204 | 3300009174 | Ga0105241_10053940 | Ga0105241_100539403 | 157 |
| 205 | 3300009174 | Ga0105241_10162486 | Ga0105241_101624862 | 157 |
| 206 | 3300009176 | Ga0105242_10225915 | Ga0105242_102259152 | 157 |
| 207 | 3300009545 | Ga0105237_10001359 | Ga0105237_1000135924 | 157 |
| 208 | 3300009545 | Ga0105237_10002200 | Ga0105237_100022002 | 157 |
| 209 | 3300009545 | Ga0105237_10004303 | Ga0105237_1000430316 | 157 |
| 210 | 3300009545 | Ga0105237_10006338 | Ga0105237_100063387 | 157 |
| 211 | 3300009545 | Ga0105237_10013563 | Ga0105237_100135636 | 157 |
| 212 | 3300009545 | Ga0105237_10078586 | Ga0105237_100785862 | 157 |
| 213 | 3300009545 | Ga0105237_10089329 | Ga0105237_100893293 | 157 |
| 214 | 3300009545 | Ga0105237_10121520 | Ga0105237_101215203 | 157 |
| 215 | 3300009545 | Ga0105237_10122779 | Ga0105237_101227793 | 157 |
| 216 | 3300009545 | Ga0105237_10407357 | Ga0105237_104073572 | 157 |
| 217 | 3300009545 | Ga0105237_12031337 | Ga0105237_120313371 | 157 |
| 218 | 3300009551 | Ga0105238_10273348 | Ga0105238_102733482 | 157 |
| 219 | 3300009551 | Ga0105238_10559830 | Ga0105238_105598302 | 157 |
| 220 | 3300009553 | Ga0105249_10214518 | Ga0105249_102145183 | 157 |
| 221 | 3300009553 | Ga0105249_10727608 | Ga0105249_107276082 | 157 |
| 222 | 3300010375 | Ga0105239_10000008 | Ga0105239_10000008143 | 157 |
| 223 | 3300010375 | Ga0105239_10002395 | Ga0105239_100023951 | 157 |
| 224 | 3300010375 | Ga0105239_10079442 | Ga0105239_100794421 | 157 |
| 225 | 3300010375 | Ga0105239_10152189 | Ga0105239_101521893 | 157 |
| 226 | 3300010375 | Ga0105239_10192263 | Ga0105239_101922633 | 157 |
| 227 | 3300010375 | Ga0105239_10591045 | Ga0105239_105910453 | 157 |
| 228 | 3300010375 | Ga0105239_10780464 | Ga0105239_107804642 | 157 |
| 229 | 3300010375 | Ga0105239_10813238 | Ga0105239_108132381 | 157 |
| 230 | 3300013100 | Ga0157373_10000090 | Ga0157373_1000009051 | 157 |
| 231 | 3300013100 | Ga0157373_10001836 | Ga0157373_1000183611 | 157 |
| 232 | 3300013100 | Ga0157373_10001855 | Ga0157373_1000185515 | 157 |
| 233 | 3300013100 | Ga0157373_10006316 | Ga0157373_100063162 | 157 |
| 234 | 3300013100 | Ga0157373_10091329 | Ga0157373_100913292 | 157 |
| 235 | 3300013100 | Ga0157373_10408456 | Ga0157373_104084561 | 157 |
| 236 | 3300013100 | Ga0157373_11261670 | Ga0157373_112616701 | 157 |
| 237 | 3300013102 | Ga0157371_10000117 | Ga0157371_1000011758 | 157 |
| 238 | 3300013102 | Ga0157371_10000836 | Ga0157371_1000083624 | 157 |
| 239 | 3300013102 | Ga0157371_10003113 | Ga0157371_100031136 | 157 |
| 240 | 3300013102 | Ga0157371_10005385 | Ga0157371_1000538512 | 157 |
| 241 | 3300013102 | Ga0157371_10008918 | Ga0157371_100089184 | 157 |
| 242 | 3300013102 | Ga0157371_10010708 | Ga0157371_100107085 | 157 |
| 243 | 3300013102 | Ga0157371_10080148 | Ga0157371_100801483 | 157 |
| 244 | 3300013102 | Ga0157371_10440863 | Ga0157371_104408632 | 157 |
| 245 | 3300013102 | Ga0157371_10847201 | Ga0157371_108472011 | 157 |
| 246 | 3300013104 | Ga0157370_10001636 | Ga0157370_1000163620 | 157 |
| 247 | 3300013104 | Ga0157370_10023420 | Ga0157370_100234201 | 157 |
| 248 | 3300013104 | Ga0157370_10035281 | Ga0157370_100352812 | 157 |
| 249 | 3300013104 | Ga0157370_10046282 | Ga0157370_100462823 | 157 |
| 250 | 3300013104 | Ga0157370_10047550 | Ga0157370_100475501 | 157 |
| 251 | 3300013104 | Ga0157370_10148167 | Ga0157370_101481672 | 157 |
| 252 | 3300013104 | Ga0157370_10291805 | Ga0157370_102918052 | 157 |
| 253 | 3300013104 | Ga0157370_10300416 | Ga0157370_103004162 | 157 |
| 254 | 3300013105 | Ga0157369_10000047 | Ga0157369_10000047101 | 157 |
| 255 | 3300013105 | Ga0157369_10008223 | Ga0157369_1000822312 | 157 |
| 256 | 3300013105 | Ga0157369_10010084 | Ga0157369_100100843 | 157 |
| 257 | 3300013105 | Ga0157369_10032151 | Ga0157369_100321512 | 157 |
| 258 | 3300013105 | Ga0157369_10602349 | Ga0157369_106023492 | 157 |
| 259 | 3300013105 | Ga0157369_11284029 | Ga0157369_112840291 | 157 |
| 260 | 3300013105 | Ga0157369_11286251 | Ga0157369_112862512 | 157 |
| 261 | 3300013105 | Ga0157369_11287139 | Ga0157369_112871391 | 157 |
| 262 | 3300013296 | Ga0157374_10000360 | Ga0157374_1000036039 | 157 |
| 263 | 3300013296 | Ga0157374_10001750 | Ga0157374_1000175011 | 157 |
| 264 | 3300013296 | Ga0157374_10289041 | Ga0157374_102890412 | 157 |
| 265 | 3300013296 | Ga0157374_10397197 | Ga0157374_103971972 | 157 |
| 266 | 3300013296 | Ga0157374_10545805 | Ga0157374_105458052 | 157 |
| 267 | 3300013296 | Ga0157374_10578723 | Ga0157374_105787232 | 157 |
| 268 | 3300013296 | Ga0157374_10906424 | Ga0157374_109064241 | 157 |
| 269 | 3300013296 | Ga0157374_10954419 | Ga0157374_109544191 | 157 |
| 270 | 3300013296 | Ga0157374_11921353 | Ga0157374_119213531 | 157 |
| 271 | 3300013297 | Ga0157378_10027617 | Ga0157378_100276173 | 157 |
| 272 | 3300013297 | Ga0157378_10101595 | Ga0157378_101015954 | 157 |
| 273 | 3300013297 | Ga0157378_10424599 | Ga0157378_104245991 | 157 |
| 274 | 3300013297 | Ga0157378_10759567 | Ga0157378_107595672 | 157 |
| 275 | 3300013306 | Ga0163162_10000051 | Ga0163162_1000005184 | 157 |
| 276 | 3300013306 | Ga0163162_10002853 | Ga0163162_1000285313 | 157 |
| 277 | 3300013306 | Ga0163162_10003445 | Ga0163162_100034453 | 157 |
| 278 | 3300013306 | Ga0163162_10060266 | Ga0163162_100602664 | 157 |
| 279 | 3300013306 | Ga0163162_10216979 | Ga0163162_102169792 | 157 |
| 280 | 3300013306 | Ga0163162_10822470 | Ga0163162_108224702 | 157 |
| 281 | 3300013307 | Ga0157372_10000009 | Ga0157372_1000000974 | 157 |
| 282 | 3300013307 | Ga0157372_10000158 | Ga0157372_1000015845 | 157 |
| 283 | 3300013307 | Ga0157372_10021408 | Ga0157372_100214083 | 157 |
| 284 | 3300013307 | Ga0157372_10080696 | Ga0157372_100806962 | 157 |
| 285 | 3300013307 | Ga0157372_10396617 | Ga0157372_103966172 | 157 |
| 286 | 3300013307 | Ga0157372_10410618 | Ga0157372_104106183 | 157 |
| 287 | 3300013307 | Ga0157372_10533190 | Ga0157372_105331902 | 157 |
| 288 | 3300013307 | Ga0157372_10572830 | Ga0157372_105728302 | 157 |
| 289 | 3300013307 | Ga0157372_10651208 | Ga0157372_106512082 | 157 |
| 290 | 3300013308 | Ga0157375_10005633 | Ga0157375_100056337 | 157 |
| 291 | 3300013308 | Ga0157375_10060012 | Ga0157375_100600123 | 157 |
| 292 | 3300013308 | Ga0157375_10288143 | Ga0157375_102881432 | 157 |
| 293 | 3300013308 | Ga0157375_11837521 | Ga0157375_118375211 | 157 |
| 294 | 3300014326 | Ga0157380_10003722 | Ga0157380_100037226 | 157 |
| 295 | 3300014326 | Ga0157380_10231164 | Ga0157380_102311644 | 157 |
| 296 | 3300014497 | Ga0182008_10000022 | Ga0182008_1000002220 | 157 |
| 297 | 3300014497 | Ga0182008_10000132 | Ga0182008_100001328 | 157 |
| 298 | 3300014497 | Ga0182008_10030340 | Ga0182008_100303403 | 157 |
| 299 | 3300014497 | Ga0182008_10170899 | Ga0182008_101708992 | 157 |
| 300 | 3300014497 | Ga0182008_10185586 | Ga0182008_101855862 | 157 |
| 301 | 3300014745 | Ga0157377_10011833 | Ga0157377_100118332 | 157 |
| 302 | 3300014745 | Ga0157377_10550770 | Ga0157377_105507701 | 157 |
| 303 | 3300014969 | Ga0157376_10115178 | Ga0157376_101151782 | 157 |
| 304 | 3300015261 | Ga0182006_1000179 | Ga0182006_100017911 | 157 |
| 305 | 3300015261 | Ga0182006_1000182 | Ga0182006_100018212 | 157 |
| 306 | 3300015261 | Ga0182006_1002331 | Ga0182006_10023317 | 157 |
| 307 | 3300015262 | Ga0182007_10000005 | Ga0182007_10000005186 | 157 |
| 308 | 3300015262 | Ga0182007_10006614 | Ga0182007_100066146 | 157 |
| 309 | 3300015262 | Ga0182007_10106538 | Ga0182007_101065381 | 157 |
| 310 | 3300015682 | Ga0183373_1002 | Ga0183373_1002773 | 157 |
| 311 | 3300017792 | Ga0163161_10000787 | Ga0163161_100007876 | 157 |
| 312 | 3300017792 | Ga0163161_10000800 | Ga0163161_1000080014 | 157 |
| 313 | 3300017792 | Ga0163161_10000838 | Ga0163161_1000083810 | 157 |
| 314 | 3300017792 | Ga0163161_10007400 | Ga0163161_100074004 | 157 |
| 315 | 3300017792 | Ga0163161_10028641 | Ga0163161_100286412 | 157 |
| 316 | 3300017792 | Ga0163161_10033006 | Ga0163161_100330061 | 157 |
| 317 | 3300017792 | Ga0163161_10253362 | Ga0163161_102533621 | 157 |
| 318 | 3300020077 | Ga0206351_10102194 | Ga0206351_101021941 | 157 |
| 319 | 3300020077 | Ga0206351_10975742 | Ga0206351_109757421 | 157 |
| 320 | 3300020078 | Ga0206352_10899470 | Ga0206352_108994701 | 157 |
| 321 | 3300020078 | Ga0206352_11031737 | Ga0206352_110317371 | 157 |
| 322 | 3300020080 | Ga0206350_10335256 | Ga0206350_103352561 | 157 |
| 323 | 3300020081 | Ga0206354_11258126 | Ga0206354_112581261 | 157 |
| 324 | 3300022467 | Ga0224712_10137680 | Ga0224712_101376801 | 157 |
| 325 | 3300025230 | Ga0209563_107553 | Ga0209563_1075532 | 157 |
| 326 | 3300025231 | Ga0207427_100159 | Ga0207427_10015972 | 157 |
| 327 | 3300025233 | Ga0209437_100021 | Ga0209437_10002192 | 157 |
| 328 | 3300025233 | Ga0209437_100144 | Ga0209437_100144130 | 157 |
| 329 | 3300025242 | Ga0209258_120069 | Ga0209258_1200692 | 157 |
| 330 | 3300025245 | Ga0207425_1000003 | Ga0207425_1000003606 | 157 |
| 331 | 3300025250 | Ga0209026_1003403 | Ga0209026_10034035 | 157 |
| 332 | 3300025250 | Ga0209026_1004215 | Ga0209026_10042153 | 157 |
| 333 | 3300025250 | Ga0209026_1019768 | Ga0209026_10197681 | 157 |
| 334 | 3300025254 | Ga0209148_1018019 | Ga0209148_10180192 | 157 |
| 335 | 3300025258 | Ga0209129_1000014 | Ga0209129_1000014227 | 157 |
| 336 | 3300025258 | Ga0209129_1035887 | Ga0209129_10358871 | 157 |
| 337 | 3300025261 | Ga0209233_1000035 | Ga0209233_1000035545 | 157 |
| 338 | 3300025261 | Ga0209233_1000524 | Ga0209233_100052415 | 157 |
| 339 | 3300025261 | Ga0209233_1016027 | Ga0209233_10160271 | 157 |
| 340 | 3300025261 | Ga0209233_1020888 | Ga0209233_10208883 | 157 |
| 341 | 3300025272 | Ga0209455_1000854 | Ga0209455_100085416 | 157 |
| 342 | 3300025292 | Ga0209676_1000039 | Ga0209676_1000039239 | 157 |
| 343 | 3300025294 | Ga0209025_1000007 | Ga0209025_1000007605 | 157 |
| 344 | 3300025297 | Ga0209758_1000012 | Ga0209758_1000012606 | 157 |
| 345 | 3300025298 | Ga0209050_1000033 | Ga0209050_1000033209 | 157 |
| 346 | 3300025321 | Ga0207656_10000027 | Ga0207656_1000002737 | 157 |
| 347 | 3300025904 | Ga0207647_10000036 | Ga0207647_1000003616 | 157 |
| 348 | 3300025904 | Ga0207647_10000135 | Ga0207647_1000013552 | 157 |
| 349 | 3300025904 | Ga0207647_10032124 | Ga0207647_100321243 | 157 |
| 350 | 3300025907 | Ga0207645_10000312 | Ga0207645_1000031235 | 157 |
| 351 | 3300025909 | Ga0207705_10000090 | Ga0207705_10000090104 | 157 |
| 352 | 3300025909 | Ga0207705_10145411 | Ga0207705_101454112 | 157 |
| 353 | 3300025909 | Ga0207705_10152355 | Ga0207705_101523552 | 157 |
| 354 | 3300025909 | Ga0207705_10221646 | Ga0207705_102216462 | 157 |
| 355 | 3300025909 | Ga0207705_10248913 | Ga0207705_102489133 | 157 |
| 356 | 3300025909 | Ga0207705_10570876 | Ga0207705_105708762 | 157 |
| 357 | 3300025909 | Ga0207705_10906025 | Ga0207705_109060251 | 157 |
| 358 | 3300025911 | Ga0207654_10012162 | Ga0207654_100121623 | 157 |
| 359 | 3300025911 | Ga0207654_10066304 | Ga0207654_100663044 | 157 |
| 360 | 3300025911 | Ga0207654_10188108 | Ga0207654_101881082 | 157 |
| 361 | 3300025911 | Ga0207654_10695942 | Ga0207654_106959421 | 157 |
| 362 | 3300025912 | Ga0207707_10090091 | Ga0207707_100900913 | 157 |
| 363 | 3300025913 | Ga0207695_10000197 | Ga0207695_1000019760 | 157 |
| 364 | 3300025913 | Ga0207695_10048999 | Ga0207695_100489996 | 157 |
| 365 | 3300025913 | Ga0207695_10060894 | Ga0207695_100608944 | 157 |
| 366 | 3300025913 | Ga0207695_10119332 | Ga0207695_101193321 | 157 |
| 367 | 3300025913 | Ga0207695_10302353 | Ga0207695_103023533 | 157 |
| 368 | 3300025913 | Ga0207695_10325922 | Ga0207695_103259222 | 157 |
| 369 | 3300025913 | Ga0207695_10461738 | Ga0207695_104617382 | 157 |
| 370 | 3300025913 | Ga0207695_10525930 | Ga0207695_105259302 | 157 |
| 371 | 3300025914 | Ga0207671_10000514 | Ga0207671_1000051433 | 157 |
| 372 | 3300025914 | Ga0207671_10000516 | Ga0207671_1000051645 | 157 |
| 373 | 3300025914 | Ga0207671_10004576 | Ga0207671_100045767 | 157 |
| 374 | 3300025914 | Ga0207671_10050514 | Ga0207671_100505146 | 157 |
| 375 | 3300025914 | Ga0207671_10106783 | Ga0207671_101067832 | 157 |
| 376 | 3300025914 | Ga0207671_10149620 | Ga0207671_101496203 | 157 |
| 377 | 3300025914 | Ga0207671_10225797 | Ga0207671_102257972 | 157 |
| 378 | 3300025916 | Ga0207663_10575116 | Ga0207663_105751161 | 157 |
| 379 | 3300025917 | Ga0207660_10061068 | Ga0207660_100610683 | 157 |
| 380 | 3300025919 | Ga0207657_10070315 | Ga0207657_100703151 | 157 |
| 381 | 3300025919 | Ga0207657_10426756 | Ga0207657_104267562 | 157 |
| 382 | 3300025919 | Ga0207657_10950276 | Ga0207657_109502761 | 157 |
| 383 | 3300025921 | Ga0207652_10027483 | Ga0207652_100274835 | 157 |
| 384 | 3300025921 | Ga0207652_10322330 | Ga0207652_103223302 | 157 |
| 385 | 3300025924 | Ga0207694_10199409 | Ga0207694_101994092 | 157 |
| 386 | 3300025924 | Ga0207694_10285577 | Ga0207694_102855772 | 157 |
| 387 | 3300025929 | Ga0207664_10737332 | Ga0207664_107373322 | 157 |
| 388 | 3300025931 | Ga0207644_10004264 | Ga0207644_100042644 | 157 |
| 389 | 3300025932 | Ga0207690_10003074 | Ga0207690_100030748 | 157 |
| 390 | 3300025932 | Ga0207690_10048622 | Ga0207690_100486222 | 157 |
| 391 | 3300025932 | Ga0207690_10105159 | Ga0207690_101051593 | 157 |
| 392 | 3300025933 | Ga0207706_10000466 | Ga0207706_1000046637 | 157 |
| 393 | 3300025933 | Ga0207706_10356900 | Ga0207706_103569001 | 157 |
| 394 | 3300025934 | Ga0207686_10223896 | Ga0207686_102238962 | 157 |
| 395 | 3300025935 | Ga0207709_10142418 | Ga0207709_101424182 | 157 |
| 396 | 3300025935 | Ga0207709_10407925 | Ga0207709_104079251 | 157 |
| 397 | 3300025938 | Ga0207704_10000123 | Ga0207704_100001232 | 157 |
| 398 | 3300025940 | Ga0207691_10144358 | Ga0207691_101443581 | 157 |
| 399 | 3300025944 | Ga0207661_10080160 | Ga0207661_100801604 | 157 |
| 400 | 3300025949 | Ga0207667_10000033 | Ga0207667_10000033255 | 157 |
| 401 | 3300025949 | Ga0207667_10000408 | Ga0207667_1000040832 | 157 |
| 402 | 3300025949 | Ga0207667_10038475 | Ga0207667_100384754 | 157 |
| 403 | 3300025949 | Ga0207667_10072414 | Ga0207667_100724145 | 157 |
| 404 | 3300025949 | Ga0207667_10097087 | Ga0207667_100970872 | 157 |
| 405 | 3300025949 | Ga0207667_10819348 | Ga0207667_108193481 | 157 |
| 406 | 3300025949 | Ga0207667_12173215 | Ga0207667_121732151 | 157 |
| 407 | 3300025960 | Ga0207651_10606751 | Ga0207651_106067511 | 157 |
| 408 | 3300025961 | Ga0207712_10130332 | Ga0207712_101303323 | 157 |
| 409 | 3300025961 | Ga0207712_10844810 | Ga0207712_108448102 | 157 |
| 410 | 3300025981 | Ga0207640_10104052 | Ga0207640_101040523 | 157 |
| 411 | 3300025981 | Ga0207640_10343801 | Ga0207640_103438012 | 157 |
| 412 | 3300025981 | Ga0207640_11005212 | Ga0207640_110052122 | 157 |
| 413 | 3300026023 | Ga0207677_10039733 | Ga0207677_100397334 | 157 |
| 414 | 3300026035 | Ga0207703_10214543 | Ga0207703_102145433 | 157 |
| 415 | 3300026041 | Ga0207639_10008486 | Ga0207639_100084866 | 157 |
| 416 | 3300026041 | Ga0207639_10061537 | Ga0207639_100615372 | 157 |
| 417 | 3300026041 | Ga0207639_10220250 | Ga0207639_102202503 | 157 |
| 418 | 3300026067 | Ga0207678_10021343 | Ga0207678_100213432 | 157 |
| 419 | 3300026078 | Ga0207702_10000042 | Ga0207702_1000004213 | 157 |
| 420 | 3300026078 | Ga0207702_10017181 | Ga0207702_100171816 | 157 |
| 421 | 3300026078 | Ga0207702_10041295 | Ga0207702_100412952 | 157 |
| 422 | 3300026078 | Ga0207702_10143412 | Ga0207702_101434123 | 157 |
| 423 | 3300026089 | Ga0207648_10000913 | Ga0207648_100009134 | 157 |
| 424 | 3300026116 | Ga0207674_10052917 | Ga0207674_100529174 | 157 |
| 425 | 3300026121 | Ga0207683_10042837 | Ga0207683_100428376 | 157 |
| 426 | 3300026142 | Ga0207698_10158689 | Ga0207698_101586891 | 157 |
| 427 | 3300026142 | Ga0207698_10420779 | Ga0207698_104207792 | 157 |
| 428 | 3300026142 | Ga0207698_11137856 | Ga0207698_111378562 | 157 |
| 429 | 3300026142 | Ga0207698_11339857 | Ga0207698_113398571 | 157 |
| 430 | 3300026142 | Ga0207698_12241605 | Ga0207698_122416051 | 157 |
| 431 | 3300028379 | Ga0268266_10000037 | Ga0268266_10000037112 | 157 |
| 432 | 3300028381 | Ga0268264_10689495 | Ga0268264_106894952 | 157 |
| 433 | 3300028654 | Ga0265322_10000666 | Ga0265322_100006668 | 157 |
| 434 | 3300028786 | Ga0307517_10008846 | Ga0307517_1000884610 | 157 |
| 435 | 3300028794 | Ga0307515_10000299 | Ga0307515_10000299121 | 157 |
| 436 | 3300028794 | Ga0307515_10017355 | Ga0307515_1001735513 | 157 |
| 437 | 3300028794 | Ga0307515_10027268 | Ga0307515_1002726810 | 157 |
| 438 | 3300028794 | Ga0307515_10129864 | Ga0307515_101298643 | 157 |
| 439 | 3300028794 | Ga0307515_10430276 | Ga0307515_104302761 | 157 |
| 440 | 3300028800 | Ga0265338_10011196 | Ga0265338_100111966 | 157 |
| 441 | 3300030732 | Ga0316176_1017512 | Ga0316176_101751219 | 157 |
| 442 | 3300030742 | Ga0316183_1098725 | Ga0316183_109872520 | 157 |
| 443 | 3300030744 | Ga0316181_1132426 | Ga0316181_11324264 | 157 |
| 444 | 3300030744 | Ga0316181_1167703 | Ga0316181_11677031 | 157 |
| 445 | 3300030744 | Ga0316181_1199287 | Ga0316181_11992871 | 157 |
| 446 | 3300030745 | Ga0316182_1262601 | Ga0316182_12626012 | 157 |
| 447 | 3300031250 | Ga0265331_10074885 | Ga0265331_100748852 | 157 |
| 448 | 3300031251 | Ga0265327_10000172 | Ga0265327_1000017284 | 157 |
| 449 | 3300031251 | Ga0265327_10112526 | Ga0265327_101125262 | 157 |
| 450 | 3300031507 | Ga0307509_10117242 | Ga0307509_101172422 | 157 |
| 451 | 3300031507 | Ga0307509_10332984 | Ga0307509_103329841 | 157 |
| 452 | 3300031548 | Ga0307408_100000628 | Ga0307408_10000062810 | 157 |
| 453 | 3300031548 | Ga0307408_100000671 | Ga0307408_1000006718 | 157 |
| 454 | 3300031548 | Ga0307408_100001834 | Ga0307408_1000018345 | 157 |
| 455 | 3300031727 | Ga0316576_10889536 | Ga0316576_108895361 | 157 |
| 456 | 3300031728 | Ga0316578_10545908 | Ga0316578_105459081 | 157 |
| 457 | 3300031728 | Ga0316578_10671347 | Ga0316578_106713471 | 157 |
| 458 | 3300031731 | Ga0307405_10000009 | Ga0307405_1000000987 | 157 |
| 459 | 3300031731 | Ga0307405_10030688 | Ga0307405_100306883 | 157 |
| 460 | 3300031824 | Ga0307413_10415852 | Ga0307413_104158522 | 157 |
| 461 | 3300031824 | Ga0307413_10999963 | Ga0307413_109999631 | 157 |
| 462 | 3300031901 | Ga0307406_11010840 | Ga0307406_110108402 | 157 |
| 463 | 3300031903 | Ga0307407_10000001 | Ga0307407_10000001264 | 157 |
| 464 | 3300031911 | Ga0307412_10000001 | Ga0307412_1000000149 | 157 |
| 465 | 3300031911 | Ga0307412_10011880 | Ga0307412_100118805 | 157 |
| 466 | 3300031911 | Ga0307412_10115157 | Ga0307412_101151573 | 157 |
| 467 | 3300031911 | Ga0307412_10223081 | Ga0307412_102230811 | 157 |
| 468 | 3300031911 | Ga0307412_10228184 | Ga0307412_102281841 | 157 |
| 469 | 3300031911 | Ga0307412_10665734 | Ga0307412_106657342 | 157 |
| 470 | 3300031911 | Ga0307412_11582711 | Ga0307412_115827111 | 157 |
| 471 | 3300031995 | Ga0307409_100000833 | Ga0307409_1000008338 | 157 |
| 472 | 3300031995 | Ga0307409_101546022 | Ga0307409_1015460221 | 157 |
| 473 | 3300032002 | Ga0307416_100000008 | Ga0307416_100000008125 | 157 |
| 474 | 3300032002 | Ga0307416_100358950 | Ga0307416_1003589502 | 157 |
| 475 | 3300032004 | Ga0307414_10000268 | Ga0307414_100002687 | 157 |
| 476 | 3300032004 | Ga0307414_10001436 | Ga0307414_1000143613 | 157 |
| 477 | 3300032004 | Ga0307414_10005701 | Ga0307414_100057014 | 157 |
| 478 | 3300032004 | Ga0307414_10017760 | Ga0307414_100177604 | 157 |
| 479 | 3300032004 | Ga0307414_10020240 | Ga0307414_100202404 | 157 |
| 480 | 3300032004 | Ga0307414_10021383 | Ga0307414_100213836 | 157 |
| 481 | 3300032004 | Ga0307414_10040328 | Ga0307414_100403285 | 157 |
| 482 | 3300032004 | Ga0307414_10078558 | Ga0307414_100785582 | 157 |
| 483 | 3300032004 | Ga0307414_10151219 | Ga0307414_101512192 | 157 |
| 484 | 3300032004 | Ga0307414_10199112 | Ga0307414_101991123 | 157 |
| 485 | 3300032004 | Ga0307414_10213712 | Ga0307414_102137122 | 157 |
| 486 | 3300032004 | Ga0307414_10225625 | Ga0307414_102256253 | 157 |
| 487 | 3300032004 | Ga0307414_10247602 | Ga0307414_102476022 | 157 |
| 488 | 3300032004 | Ga0307414_10416579 | Ga0307414_104165792 | 157 |
| 489 | 3300032004 | Ga0307414_10423324 | Ga0307414_104233241 | 157 |
| 490 | 3300032004 | Ga0307414_10829705 | Ga0307414_108297051 | 157 |
| 491 | 3300032004 | Ga0307414_11098145 | Ga0307414_110981451 | 157 |
| 492 | 3300032005 | Ga0307411_10226670 | Ga0307411_102266702 | 157 |
| 493 | 3300032005 | Ga0307411_10241333 | Ga0307411_102413332 | 157 |
| 494 | 3300033179 | Ga0307507_10000313 | Ga0307507_1000031362 | 157 |
| 495 | 3300033180 | Ga0307510_10001091 | Ga0307510_1000109124 | 157 |
| 496 | 3300035115 | Ga0373941_0003096 | Ga0373941_0003096_1110_1583 | 157 |
| 497 | 3300035398 | Ga0316574_0125076 | Ga0316574_0125076_1019_1492 | 157 |
| 498 | 3300035398 | Ga0316574_0197547 | Ga0316574_0197547_678_1151 | 157 |
| 499 | 3300036712 | Ga0316584_0058280 | Ga0316584_0058280_1827_2300 | 157 |
| 500 | 3300037312 | Ga0395899_0000011 | Ga0395899_0000011_27594_28067 | 157 |
| 501 | 3300037312 | Ga0395899_0000780 | Ga0395899_0000780_5019_5492 | 157 |
| 502 | 3300037312 | Ga0395899_0004206 | Ga0395899_0004206_7427_7900 | 157 |
| 503 | 3300037418 | Ga0395900_0000478 | Ga0395900_0000478_14047_14520 | 157 |
| 504 | 3300037418 | Ga0395900_0001720 | Ga0395900_0001720_17388_17861 | 157 |
| 505 | 3300037418 | Ga0395900_0006013 | Ga0395900_0006013_11380_11853 | 157 |
| 506 | 3300037466 | Ga0395898_0053528 | Ga0395898_0053528_3217_3690 | 157 |
| 507 | 3300037466 | Ga0395898_0057445 | Ga0395898_0057445_2403_2876 | 157 |
| 508 | 3300037471 | Ga0395905_0000705 | Ga0395905_0000705_11355_11828 | 157 |
| 509 | 3300037471 | Ga0395905_0002686 | Ga0395905_0002686_609_1082 | 157 |
| 510 | 3300037471 | Ga0395905_0004170 | Ga0395905_0004170_12432_12905 | 157 |
| 511 | 3300038443 | Ga0395901_0001267 | Ga0395901_0001267_6076_6549 | 157 |
| 512 | 3300038443 | Ga0395901_0026240 | Ga0395901_0026240_1800_2273 | 157 |
| 513 | 3300039447 | Ga0436361_0530171 | Ga0436361_0530171_10529_11002 | 157 |
| 514 | 3300041452 | Ga0451793_0105024 | Ga0451793_0105024_348_821 | 157 |
| 515 | 3300041453 | Ga0451797_1468381 | Ga0451797_1468381_145_618 | 157 |
| 516 | 3300041458 | Ga0451798_1002939 | Ga0451798_1002939_19_492 | 157 |
| 517 | 3300041486 | Ga0451807_1307333 | Ga0451807_1307333_44_520 | 157 |
| 518 | 3300041505 | Ga0451849_0358896 | Ga0451849_0358896_27_500 | 157 |
| 519 | 3300042005 | Ga0439448_0118018 | Ga0439448_0118018_308_781 | 157 |
| 520 | 3300042876 | Ga0451577_0000935 | Ga0451577_0000935_2473_2961 | 157 |
| 521 | 3300044673 | Ga0453683_0001745 | Ga0453683_0001745_15373_15861 | 157 |
| 522 | 3300044673 | Ga0453683_0114321 | Ga0453683_0114321_695_1183 | 157 |
| 523 | 3300044684 | Ga0466966_0064372 | Ga0466966_0064372_1734_2207 | 157 |
| 524 | 3300044693 | Ga0466961_0035332 | Ga0466961_0035332_1976_2449 | 157 |
| 525 | 3300044712 | Ga0453684_0000696 | Ga0453684_0000696_77798_78286 | 157 |
| 526 | 3300044712 | Ga0453684_0326412 | Ga0453684_0326412_137_613 | 157 |
| 527 | 3300044712 | Ga0453684_0570966 | Ga0453684_0570966_87_560 | 157 |
| 528 | 3300044765 | Ga0466970_0049594 | Ga0466970_0049594_1095_1568 | 157 |
| 529 | 3300045049 | Ga0466959_0027729 | Ga0466959_0027729_85_558 | 157 |
| 530 | 3300045049 | Ga0466959_0128403 | Ga0466959_0128403_449_922 | 157 |
| 531 | 3300045051 | Ga0451576_0027949 | Ga0451576_0027949_857_1330 | 157 |
| 532 | 3300045051 | Ga0451576_0107623 | Ga0451576_0107623_47_538 | 157 |
| 533 | 3300045836 | Ga0466958_0029480 | Ga0466958_0029480_2663_3136 | 157 |
| 534 | 3300046459 | Ga0495629_0121174 | Ga0495629_0121174_1258_1731 | 157 |
| 535 | 3300046471 | Ga0495650_0000050 | Ga0495650_0000050_62376_62849 | 157 |
| 536 | 3300046492 | Ga0495585_0000198 | Ga0495585_0000198_3325_3798 | 157 |
| 537 | 3300046492 | Ga0495585_0001607 | Ga0495585_0001607_3677_4150 | 157 |
| 538 | 3300046501 | Ga0495607_0255244 | Ga0495607_0255244_110_583 | 157 |
| 539 | 3300046506 | Ga0495583_0148676 | Ga0495583_0148676_486_959 | 157 |
| 540 | 3300046507 | Ga0495606_0000213 | Ga0495606_0000213_82835_83371 | 157 |
| 541 | 3300046507 | Ga0495606_0002949 | Ga0495606_0002949_14739_15212 | 157 |
| 542 | 3300046507 | Ga0495606_0015650 | Ga0495606_0015650_2591_3067 | 157 |
| 543 | 3300046507 | Ga0495606_0017631 | Ga0495606_0017631_2100_2573 | 157 |
| 544 | 3300046507 | Ga0495606_0028874 | Ga0495606_0028874_3374_3847 | 157 |
| 545 | 3300046507 | Ga0495606_0183159 | Ga0495606_0183159_507_980 | 157 |
| 546 | 3300046507 | Ga0495606_0242785 | Ga0495606_0242785_339_812 | 157 |
| 547 | 3300046511 | Ga0495608_0464603 | Ga0495608_0464603_135_608 | 157 |
| 548 | 3300046512 | Ga0495610_0000076 | Ga0495610_0000076_51306_51779 | 157 |
| 549 | 3300046512 | Ga0495610_0000696 | Ga0495610_0000696_14746_15219 | 157 |
| 550 | 3300046512 | Ga0495610_0001134 | Ga0495610_0001134_10768_11241 | 157 |
| 551 | 3300046513 | Ga0495616_0000433 | Ga0495616_0000433_20778_21251 | 157 |
| 552 | 3300046513 | Ga0495616_0022684 | Ga0495616_0022684_549_1022 | 157 |
| 553 | 3300046518 | Ga0495631_0011938 | Ga0495631_0011938_3391_3864 | 157 |
| 554 | 3300046518 | Ga0495631_0051578 | Ga0495631_0051578_1125_1598 | 157 |
| 555 | 3300046518 | Ga0495631_0171908 | Ga0495631_0171908_151_624 | 157 |
| 556 | 3300046520 | Ga0495637_0033328 | Ga0495637_0033328_992_1465 | 157 |
| 557 | 3300046523 | Ga0495644_0030789 | Ga0495644_0030789_814_1287 | 157 |
| 558 | 3300046524 | Ga0495648_0004911 | Ga0495648_0004911_4716_5189 | 157 |
| 559 | 3300046524 | Ga0495648_0007028 | Ga0495648_0007028_1626_2099 | 157 |
| 560 | 3300046528 | Ga0495642_0150214 | Ga0495642_0150214_449_922 | 157 |
| 561 | 3300046529 | Ga0495652_0170280 | Ga0495652_0170280_671_1144 | 157 |
| 562 | 3300046529 | Ga0495652_0318317 | Ga0495652_0318317_402_875 | 157 |
| 563 | 3300046529 | Ga0495652_0860419 | Ga0495652_0860419_35_508 | 157 |
| 564 | 3300046530 | Ga0495654_0223566 | Ga0495654_0223566_53_526 | 157 |
| 565 | 3300046538 | Ga0495609_0002985 | Ga0495609_0002985_2265_2738 | 157 |
| 566 | 3300046538 | Ga0495609_0011292 | Ga0495609_0011292_1347_1820 | 157 |
| 567 | 3300046539 | Ga0495621_0123436 | Ga0495621_0123436_72_545 | 157 |
| 568 | 3300046557 | Ga0495622_0066925 | Ga0495622_0066925_119_592 | 157 |
| 569 | 3300046558 | Ga0495633_0000295 | Ga0495633_0000295_54771_55244 | 157 |
| 570 | 3300046558 | Ga0495633_0004623 | Ga0495633_0004623_3458_3931 | 157 |
| 571 | 3300046558 | Ga0495633_0016647 | Ga0495633_0016647_682_1155 | 157 |
| 572 | 3300046616 | Ga0495668_0000121 | Ga0495668_0000121_4853_5326 | 157 |
| 573 | 3300046660 | Ga0495625_0000105 | Ga0495625_0000105_73442_73915 | 157 |
| 574 | 3300046660 | Ga0495625_0000316 | Ga0495625_0000316_38416_38889 | 157 |
| 575 | 3300046660 | Ga0495625_0002036 | Ga0495625_0002036_14091_14564 | 157 |
| 576 | 3300046660 | Ga0495625_0015634 | Ga0495625_0015634_343_816 | 157 |
| 577 | 3300046660 | Ga0495625_0058128 | Ga0495625_0058128_2255_2728 | 157 |
| 578 | 3300046660 | Ga0495625_0079580 | Ga0495625_0079580_1615_2088 | 157 |
| 579 | 3300046660 | Ga0495625_0098382 | Ga0495625_0098382_527_1000 | 157 |
| 580 | 3300046660 | Ga0495625_0461379 | Ga0495625_0461379_23_496 | 157 |
| 581 | 3300046665 | Ga0495661_0001116 | Ga0495661_0001116_5655_6128 | 157 |
| 582 | 3300046665 | Ga0495661_0021682 | Ga0495661_0021682_166_639 | 157 |
| 583 | 3300046665 | Ga0495661_0107213 | Ga0495661_0107213_706_1179 | 157 |
| 584 | 3300046683 | Ga0495658_0376779 | Ga0495658_0376779_101_574 | 157 |
| 585 | 3300046683 | Ga0495658_0388747 | Ga0495658_0388747_155_628 | 157 |
| 586 | 3300046683 | Ga0495658_0690920 | Ga0495658_0690920_151_624 | 157 |
| 587 | 3300046684 | Ga0495669_0228285 | Ga0495669_0228285_82_555 | 157 |
| 588 | 3300046691 | Ga0495670_0136694 | Ga0495670_0136694_714_1187 | 157 |
| 589 | 3300046694 | Ga0495649_0000011 | Ga0495649_0000011_51027_51500 | 157 |
| 590 | 3300046794 | Ga0495589_0053508 | Ga0495589_0053508_515_988 | 157 |
| 591 | 3300046810 | Ga0495660_0014777 | Ga0495660_0014777_2362_2835 | 157 |
| 592 | 3300046810 | Ga0495660_0089654 | Ga0495660_0089654_596_1069 | 157 |
| 593 | 3300047320 | Ga0495672_0216411 | Ga0495672_0216411_328_801 | 157 |
| 594 | 3300047443 | Ga0495687_000249 | Ga0495687_000249_10688_11161 | 157 |
| 595 | 3300047443 | Ga0495687_000556 | Ga0495687_000556_37054_37527 | 157 |
| 596 | 3300047469 | Ga0495673_0017458 | Ga0495673_0017458_1576_2049 | 157 |
| 597 | 3300047470 | Ga0495681_0294079 | Ga0495681_0294079_49_522 | 157 |
| 598 | 3300047472 | Ga0495686_0000306 | Ga0495686_0000306_58743_59216 | 157 |
| 599 | 3300047472 | Ga0495686_0006170 | Ga0495686_0006170_452_925 | 157 |
| 600 | 3300047472 | Ga0495686_0011257 | Ga0495686_0011257_365_838 | 157 |
| 601 | 3300047472 | Ga0495686_0054555 | Ga0495686_0054555_819_1292 | 157 |
| 602 | 3300047472 | Ga0495686_0083731 | Ga0495686_0083731_788_1261 | 157 |
| 603 | 3300048088 | Ga0495602_0253515 | Ga0495602_0253515_599_1072 | 157 |
| 604 | 3300048089 | Ga0495614_0012346 | Ga0495614_0012346_1750_2223 | 157 |
| 605 | 3300048918 | Ga0496115_0533308 | Ga0496115_0533308_434_907 | 157 |
| 606 | 3300048929 | Ga0496126_0408942 | Ga0496126_0408942_601_1074 | 157 |
| 607 | 3300049459 | Ga0495678_004962 | Ga0495678_004962_3859_4332 | 157 |
| 608 | 3300049460 | Ga0495682_0130090 | Ga0495682_0130090_261_734 | 157 |
| 609 | 3300049532 | Ga0501316_031660 | Ga0501316_031660_67_540 | 157 |
| 610 | 3300049570 | Ga0501033_0358777 | Ga0501033_0358777_322_795 | 157 |
| 611 | 3300049571 | Ga0501034_0674197 | Ga0501034_0674197_81_554 | 157 |
| 612 | 3300049649 | Ga0501198_017809 | Ga0501198_017809_459_932 | 157 |
| 613 | 3300049665 | Ga0501227_085631 | Ga0501227_085631_146_619 | 157 |
| 614 | 3300049671 | Ga0501238_032085 | Ga0501238_032085_104_577 | 157 |
| 615 | 3300049673 | Ga0501240_016056 | Ga0501240_016056_44_517 | 157 |
| 616 | 3300049758 | Ga0501241_002026 | Ga0501241_002026_1903_2376 | 157 |
| 617 | 3300049770 | Ga0501273_056872 | Ga0501273_056872_58_531 | 157 |
| 618 | 3300049850 | Ga0501204_025641 | Ga0501204_025641_176_649 | 157 |
| 619 | 3300050493 | nmdc:mga0k408_148394_c1 | nmdc:mga0k408_148394_c1_392_961 | 157 |
| 620 | 3300050493 | nmdc:mga0k408_20927_c1 | nmdc:mga0k408_20927_c1_1937_2410 | 157 |
| 621 | 3300050493 | nmdc:mga0k408_275_c2 | nmdc:mga0k408_275_c2_17454_17927 | 157 |
| 622 | 3300050493 | nmdc:mga0k408_66_c1 | nmdc:mga0k408_66_c1_17578_18051 | 157 |
| 623 | 3300050496 | nmdc:mga07m45_103476_c1 | nmdc:mga07m45_103476_c1_1056_1529 | 157 |
| 624 | 3300053080 | Ga0500635_0000412 | Ga0500635_0000412_2320_2793 | 157 |
| 625 | 3300053080 | Ga0500635_0069511 | Ga0500635_0069511_110_583 | 157 |
| 626 | 3300053086 | Ga0500578_0341928 | Ga0500578_0341928_321_794 | 157 |
| 627 | 3300053093 | Ga0500651_0001193 | Ga0500651_0001193_2237_2710 | 157 |
| 628 | 3300053111 | Ga0500572_079552 | Ga0500572_079552_101_574 | 157 |
| 629 | 3300053122 | Ga0500608_000596 | Ga0500608_000596_4690_5163 | 157 |
| 630 | 3300053122 | Ga0500608_008269 | Ga0500608_008269_698_1171 | 157 |
| 631 | 3300053125 | Ga0500618_000033 | Ga0500618_000033_48434_48907 | 157 |
| 632 | 3300053154 | Ga0500619_121475 | Ga0500619_121475_54_527 | 157 |
| 633 | 3300053156 | Ga0500622_0001136 | Ga0500622_0001136_12448_12921 | 157 |
| 634 | 3300053157 | Ga0500624_000712 | Ga0500624_000712_6064_6537 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gd5-assembly1.cif.gz_A | structural basis for budding by the escrtiii factor chmp3 | 0.8687 | 9 | 71 |
| 2gd5-assembly2.cif.gz_C | structural basis for budding by the escrtiii factor chmp3 | 0.8581 | 9 | 68 |
| 2gd5-assembly2.cif.gz_D | structural basis for budding by the escrtiii factor chmp3 | 0.8573 | 9 | 68 |
| 7qnl-assembly1.cif.gz_AAA | lov2-darpin fusion - d4_deltalov | 0.8495 | 15 | 67 |
| 7zcg-assembly1.cif.gz_B | chmp2a-chmp3 heterodimer (430 angstrom diameter) | 0.8444 | 12 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXW7_4_78_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.8989 | 2 | 76 | 1.10.287.180 |
| af_Q2FXW7_4_78_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.8882 | 2 | 76 | 1.10.287.180 |
| af_P0A6W5_1_75_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.8838 | 6 | 76 | 1.10.287.180 |
| af_Q2FXW7_79_158_3.10.50.30 | Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain | 0.8788 | 81 | 156 | 3.10.50.30 |
| af_P9WMT9_4_78_1.10.287.180 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain | 0.876 | 2 | 77 | 1.10.287.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661Z7U8-F1-model_v4 | Transcription elongation factor GreA/GreB C-terminal domain-containing protein | 0.9893 | 92 | 157 |
GO:0003677
GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A6L8Q7V6-F1-model_v4 | GreA/GreB family elongation factor | 0.9875 | 90 | 157 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A7V8KLB0-F1-model_v4 | deleted | 0.9826 | 88 | 157 |
|
| AF-A0A3C1WF27-F1-model_v4 | Transcription elongation factor GreA | 0.9811 | 87 | 156 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A661Z7U8-F1-model_v4 | Transcription elongation factor GreA/GreB C-terminal domain-containing protein | 0.9605 | 92 | 157 |
GO:0003677
GO:0006354 GO:0032784 GO:0070063 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar