F471112
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 633 | 353 | 586 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0030259|Ga0496126_0030259_3328_4209 |
| Length | 293 |
| Sequence | MGIIQLDGLINLRPGLDTAGHGAAENKGRRTSFINSFNRSNNMSKLQLEGKIAIITGGSSGIGLATAQRFVAEGAYVFITGRRQSELDKAVELIGANVTAVQGDVSKLADLDRLYATVKATKGRVDVVVANSGIVDPTGIDDVTSEHYDKTFDINAKGLLFTVQKALPLMGKGGAIVLTASIAAVKGMPGYGTYSASKAAVRSFARTWTQELKERGIRVNTLSPGPVDTPIIDTQASDKASADQLRDMFSTMIPLGRMGRPEEVAAAALFLASDESSFVAGIDLSVDGGMAQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 2 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 3 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 4 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 5 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 6 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 7 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 8 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 9 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 10 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 11 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 12 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 13 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 14 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 15 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 16 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 17 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 18 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 19 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 20 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 21 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 22 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 23 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 24 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 25 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 26 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 27 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 28 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 29 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 30 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 31 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 32 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 33 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 34 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 35 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 36 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 37 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 38 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 39 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 40 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 41 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 42 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 43 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 44 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 45 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 46 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 47 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 48 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 49 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 50 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 51 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 52 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 53 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 54 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 60 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 129 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 130 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 189 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 209 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 210 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 215 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 216 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 302 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 303 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 304 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 305 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 321 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 332 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 334 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 336 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 337 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 341 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 342 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 343 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 344 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 346 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 348 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 349 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 350 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 351 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 352 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 353 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.42 |
| Metatranscriptomes | 0.16 |
| Isolates | 7.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.43 |
| Nodule | 3 |
| Rhizoplane | 4.74 |
| Rhizosphere | 62.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10005957 | 3300001989 | Bacteria | 4612 |
| 2 | JGI24737J22298_10006139 | 3300001990 | Bacteria | 4116 |
| 3 | JGI25156J39149_1000392 | 3300002705 | Bacteria | 27503 |
| 4 | JGI25162J39368_1004766 | 3300002737 | Bacteria | 2977 |
| 5 | JGI25158J39367_1000058 | 3300002739 | Bacteria | 24608 |
| 6 | JGI25159J45721_1005559 | 3300002987 | Bacteria | 3943 |
| 7 | JGI25165J46597_1003207 | 3300003214 | Bacteria | 4291 |
| 8 | rootH1_10031460 | 3300003323 | Bacteria | 7779 |
| 9 | JGI25160J50197_1000091 | 3300003354 | Bacteria | 90359 |
| 10 | JGI25161J50226_1000027 | 3300003374 | Bacteria | 145847 |
| 11 | Ga0055526_1002309 | 3300003771 | Bacteria | 12999 |
| 12 | Ga0055526_1002486 | 3300003771 | Bacteria | 12436 |
| 13 | Ga0055526_1003148 | 3300003771 | Bacteria | 10686 |
| 14 | Ga0055524_1000769 | 3300003775 | Bacteria | 21606 |
| 15 | Ga0055524_1004005 | 3300003775 | Bacteria | 6948 |
| 16 | Ga0055524_1017004 | 3300003775 | Bacteria | 2581 |
| 17 | Ga0055524_1034279 | 3300003775 | Bacteria | 1407 |
| 18 | Ga0055528_1000083 | 3300003790 | Bacteria | 74840 |
| 19 | Ga0055528_1002171 | 3300003790 | Bacteria | 10759 |
| 20 | Ga0055528_1014332 | 3300003790 | Bacteria | 2939 |
| 21 | Ga0055540_1002498 | 3300003792 | Bacteria | 9634 |
| 22 | Ga0055540_1005083 | 3300003792 | Bacteria | 5680 |
| 23 | Ga0055540_1013326 | 3300003792 | Bacteria | 2520 |
| 24 | Ga0055543_1000100 | 3300004625 | Bacteria | 74795 |
| 25 | Ga0065165_1000317 | 3300005262 | Bacteria | 78478 |
| 26 | Ga0065165_1004450 | 3300005262 | Bacteria | 8685 |
| 27 | Ga0065165_1025517 | 3300005262 | Bacteria | 1963 |
| 28 | Ga0070658_10002980 | 3300005327 | Bacteria | 14021 |
| 29 | Ga0070670_100419583 | 3300005331 | Bacteria | 1183 |
| 30 | Ga0070666_10125226 | 3300005335 | Bacteria | 1784 |
| 31 | Ga0070680_100068527 | 3300005336 | Bacteria | 2912 |
| 32 | Ga0070682_100000010 | 3300005337 | Bacteria | 280957 |
| 33 | Ga0068868_100394240 | 3300005338 | Bacteria | 1193 |
| 34 | Ga0070669_100148401 | 3300005353 | Bacteria | 1813 |
| 35 | Ga0070671_100007684 | 3300005355 | Bacteria | 8619 |
| 36 | Ga0070667_100394680 | 3300005367 | Bacteria | 1258 |
| 37 | Ga0070667_100400971 | 3300005367 | Bacteria | 1248 |
| 38 | Ga0070713_100017981 | 3300005436 | Bacteria | 5366 |
| 39 | Ga0070713_100017990 | 3300005436 | Bacteria | 5364 |
| 40 | Ga0070701_10170882 | 3300005438 | Bacteria | 1266 |
| 41 | Ga0070708_100130358 | 3300005445 | Bacteria | 2327 |
| 42 | Ga0070708_100135918 | 3300005445 | Bacteria | 2277 |
| 43 | Ga0070708_100427362 | 3300005445 | Bacteria | 1249 |
| 44 | Ga0070663_100003650 | 3300005455 | Bacteria | 8916 |
| 45 | Ga0070681_10087697 | 3300005458 | Bacteria | 3064 |
| 46 | Ga0070681_10373025 | 3300005458 | Bacteria | 1337 |
| 47 | Ga0068867_100035589 | 3300005459 | Bacteria | 3612 |
| 48 | Ga0070707_100517689 | 3300005468 | Bacteria | 1155 |
| 49 | Ga0070707_100518728 | 3300005468 | Bacteria | 1154 |
| 50 | Ga0070698_100068467 | 3300005471 | Plasmid | 3567 |
| 51 | Ga0070698_100755514 | 3300005471 | Unclassified | 915 |
| 52 | Ga0070699_100308445 | 3300005518 | Bacteria | 1420 |
| 53 | Ga0070679_100450587 | 3300005530 | Bacteria | 1232 |
| 54 | Ga0070679_100826242 | 3300005530 | Bacteria | 870 |
| 55 | Ga0068853_100699781 | 3300005539 | Bacteria | 967 |
| 56 | Ga0070672_100009209 | 3300005543 | Bacteria | 6797 |
| 57 | Ga0070665_100010240 | 3300005548 | Bacteria | 9487 |
| 58 | Ga0070665_100302145 | 3300005548 | Bacteria | 1603 |
| 59 | Ga0070665_100486080 | 3300005548 | Bacteria | 1245 |
| 60 | Ga0070665_100526652 | 3300005548 | Bacteria | 1193 |
| 61 | Ga0068855_100000858 | 3300005563 | Bacteria | 37714 |
| 62 | Ga0068855_100014303 | 3300005563 | Bacteria | 9556 |
| 63 | Ga0068855_100054969 | 3300005563 | Bacteria | 4677 |
| 64 | Ga0068855_100056965 | 3300005563 | Bacteria | 4582 |
| 65 | Ga0068855_100085286 | 3300005563 | Bacteria | 3655 |
| 66 | Ga0068855_100260532 | 3300005563 | Bacteria | 1932 |
| 67 | Ga0068857_100180941 | 3300005577 | Bacteria | 1919 |
| 68 | Ga0068854_100048810 | 3300005578 | Bacteria | 3021 |
| 69 | Ga0068854_100330083 | 3300005578 | Bacteria | 1242 |
| 70 | Ga0068852_100019851 | 3300005616 | Bacteria | 5331 |
| 71 | Ga0068852_100041265 | 3300005616 | Bacteria | 3899 |
| 72 | Ga0068859_100590936 | 3300005617 | Bacteria | 1203 |
| 73 | Ga0068864_100021820 | 3300005618 | Bacteria | 5366 |
| 74 | Ga0068864_100358525 | 3300005618 | Bacteria | 1377 |
| 75 | Ga0068861_100339899 | 3300005719 | Bacteria | 1313 |
| 76 | Ga0068863_100310566 | 3300005841 | Bacteria | 1530 |
| 77 | Ga0068858_100001585 | 3300005842 | Bacteria | 23212 |
| 78 | Ga0068858_100124358 | 3300005842 | Bacteria | 2414 |
| 79 | Ga0068858_100492684 | 3300005842 | Bacteria | 1183 |
| 80 | Ga0068862_100108584 | 3300005844 | Bacteria | 2433 |
| 81 | Ga0081540_1133843 | 3300005983 | Bacteria | 1007 |
| 82 | Ga0070717_10019228 | 3300006028 | Bacteria | 5354 |
| 83 | Ga0070717_10041240 | 3300006028 | Bacteria | 3763 |
| 84 | Ga0070717_10138658 | 3300006028 | Bacteria | 2096 |
| 85 | Ga0075365_10029676 | 3300006038 | Bacteria | 3498 |
| 86 | Ga0075432_10010404 | 3300006058 | Bacteria | 3156 |
| 87 | Ga0070715_10078906 | 3300006163 | Bacteria | 1489 |
| 88 | Ga0075367_10035872 | 3300006178 | Bacteria | 2873 |
| 89 | Ga0075369_10061890 | 3300006186 | Bacteria | 1634 |
| 90 | Ga0097621_100071998 | 3300006237 | Bacteria | 2858 |
| 91 | Ga0075370_10003461 | 3300006353 | Bacteria | 7519 |
| 92 | Ga0075370_10032594 | 3300006353 | Bacteria | 2914 |
| 93 | Ga0075370_10166295 | 3300006353 | Bacteria | 1296 |
| 94 | Ga0075433_10225004 | 3300006852 | Unclassified | 1666 |
| 95 | Ga0075436_100306759 | 3300006914 | Bacteria | 1138 |
| 96 | Ga0097620_100590924 | 3300006931 | Bacteria | 1203 |
| 97 | Ga0075435_100097969 | 3300007076 | Bacteria | 2427 |
| 98 | Ga0105244_10000426 | 3300009036 | Bacteria | 39063 |
| 99 | Ga0105244_10014169 | 3300009036 | Bacteria | 4622 |
| 100 | Ga0105244_10033227 | 3300009036 | Bacteria | 2721 |
| 101 | Ga0105240_10000582 | 3300009093 | Bacteria | 67645 |
| 102 | Ga0105240_10041155 | 3300009093 | Bacteria | 5901 |
| 103 | Ga0105240_10441772 | 3300009093 | Bacteria | 1458 |
| 104 | Ga0105240_10570525 | 3300009093 | Bacteria | 1249 |
| 105 | Ga0105245_10008078 | 3300009098 | Bacteria | 9201 |
| 106 | Ga0105245_10129607 | 3300009098 | Bacteria | 2365 |
| 107 | Ga0105248_10002723 | 3300009177 | Bacteria | 19630 |
| 108 | Ga0105237_10005522 | 3300009545 | Bacteria | 14256 |
| 109 | Ga0105238_10002323 | 3300009551 | Bacteria | 19122 |
| 110 | Ga0105238_10086552 | 3300009551 | Bacteria | 3121 |
| 111 | Ga0105238_10205361 | 3300009551 | Bacteria | 1946 |
| 112 | Ga0105238_10249431 | 3300009551 | Bacteria | 1753 |
| 113 | Ga0105238_10296461 | 3300009551 | Bacteria | 1600 |
| 114 | Ga0105249_10484491 | 3300009553 | Bacteria | 1280 |
| 115 | Ga0105239_10026955 | 3300010375 | Bacteria | 6325 |
| 116 | Ga0105239_10030881 | 3300010375 | Bacteria | 5894 |
| 117 | Ga0105246_10117204 | 3300011119 | Bacteria | 1967 |
| 118 | Ga0157373_10021479 | 3300013100 | Bacteria | 4688 |
| 119 | Ga0157370_10020961 | 3300013104 | Bacteria | 6518 |
| 120 | Ga0157370_10115547 | 3300013104 | Bacteria | 2507 |
| 121 | Ga0157369_10019628 | 3300013105 | Bacteria | 7564 |
| 122 | Ga0157369_10045264 | 3300013105 | Bacteria | 4787 |
| 123 | Ga0157369_10071570 | 3300013105 | Bacteria | 3722 |
| 124 | Ga0157369_10091841 | 3300013105 | Bacteria | 3240 |
| 125 | Ga0157374_10000016 | 3300013296 | Bacteria | 293656 |
| 126 | Ga0157374_10188829 | 3300013296 | Bacteria | 2015 |
| 127 | Ga0163162_10057372 | 3300013306 | Bacteria | 3922 |
| 128 | Ga0163162_10070705 | 3300013306 | Bacteria | 3541 |
| 129 | Ga0163162_10090010 | 3300013306 | Bacteria | 3150 |
| 130 | Ga0157372_10545442 | 3300013307 | Bacteria | 1352 |
| 131 | Ga0157375_10001246 | 3300013308 | Bacteria | 22001 |
| 132 | Ga0157375_10083679 | 3300013308 | Bacteria | 3236 |
| 133 | Ga0182008_10024539 | 3300014497 | Bacteria | 3068 |
| 134 | Ga0157377_10000004 | 3300014745 | Bacteria | 430019 |
| 135 | Ga0157379_10219251 | 3300014968 | Bacteria | 1724 |
| 136 | Ga0157379_10292753 | 3300014968 | Bacteria | 1483 |
| 137 | Ga0157379_10402398 | 3300014968 | Bacteria | 1259 |
| 138 | Ga0157376_10917771 | 3300014969 | Bacteria | 894 |
| 139 | Ga0182007_10011773 | 3300015262 | Bacteria | 3390 |
| 140 | Ga0182005_1008225 | 3300015265 | Bacteria | 3084 |
| 141 | Ga0163161_10012991 | 3300017792 | Bacteria | 5786 |
| 142 | Ga0163161_10023633 | 3300017792 | Bacteria | 4337 |
| 143 | Ga0163161_10596121 | 3300017792 | Bacteria | 910 |
| 144 | Ga0224569_100965 | 3300022732 | Bacteria | 2445 |
| 145 | Ga0228598_1014728 | 3300024227 | Bacteria | 1546 |
| 146 | Ga0209436_100009 | 3300025208 | Bacteria | 143684 |
| 147 | Ga0209437_100456 | 3300025233 | Bacteria | 32812 |
| 148 | Ga0209677_100189 | 3300025253 | Bacteria | 50237 |
| 149 | Ga0209759_1000130 | 3300025256 | Bacteria | 130638 |
| 150 | Ga0209129_1003434 | 3300025258 | Bacteria | 6892 |
| 151 | Ga0209233_1000139 | 3300025261 | Bacteria | 197070 |
| 152 | Ga0209233_1008017 | 3300025261 | Bacteria | 3301 |
| 153 | Ga0209673_1000086 | 3300025273 | Bacteria | 210101 |
| 154 | Ga0209673_1001554 | 3300025273 | Bacteria | 20714 |
| 155 | Ga0209673_1005597 | 3300025273 | Bacteria | 6277 |
| 156 | Ga0209673_1010152 | 3300025273 | Bacteria | 3998 |
| 157 | Ga0209130_1000031 | 3300025284 | Bacteria | 322932 |
| 158 | Ga0209130_1006753 | 3300025284 | Bacteria | 3666 |
| 159 | Ga0209676_1010078 | 3300025292 | Bacteria | 3986 |
| 160 | Ga0209025_1002308 | 3300025294 | Bacteria | 20678 |
| 161 | Ga0209564_1001360 | 3300025295 | Bacteria | 25720 |
| 162 | Ga0209564_1001436 | 3300025295 | Bacteria | 24430 |
| 163 | Ga0209564_1002099 | 3300025295 | Bacteria | 17049 |
| 164 | Ga0209758_1008287 | 3300025297 | Bacteria | 6791 |
| 165 | Ga0209758_1008982 | 3300025297 | Bacteria | 6324 |
| 166 | Ga0209758_1027946 | 3300025297 | Bacteria | 2399 |
| 167 | Ga0209256_1003202 | 3300025299 | Bacteria | 11828 |
| 168 | Ga0209256_1004406 | 3300025299 | Bacteria | 8869 |
| 169 | Ga0209256_1004607 | 3300025299 | Bacteria | 8526 |
| 170 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 171 | Ga0207426_1000042 | 3300025302 | Bacteria | 433289 |
| 172 | Ga0209051_1000417 | 3300025303 | Bacteria | 58858 |
| 173 | Ga0209257_1000741 | 3300025304 | Bacteria | 49326 |
| 174 | Ga0207697_10071986 | 3300025315 | Bacteria | 1449 |
| 175 | Ga0207655_1000444 | 3300025728 | Bacteria | 54646 |
| 176 | Ga0207655_1009083 | 3300025728 | Bacteria | 6220 |
| 177 | Ga0207655_1018055 | 3300025728 | Bacteria | 3766 |
| 178 | Ga0207688_10039677 | 3300025901 | Bacteria | 2615 |
| 179 | Ga0207647_10011208 | 3300025904 | Bacteria | 6295 |
| 180 | Ga0207645_10034883 | 3300025907 | Bacteria | 3231 |
| 181 | Ga0207643_10133876 | 3300025908 | Bacteria | 1476 |
| 182 | Ga0207705_10000488 | 3300025909 | Bacteria | 33822 |
| 183 | Ga0207707_10002194 | 3300025912 | Bacteria | 17684 |
| 184 | Ga0207707_10504593 | 3300025912 | Bacteria | 1031 |
| 185 | Ga0207695_10000172 | 3300025913 | Bacteria | 190573 |
| 186 | Ga0207695_10000192 | 3300025913 | Bacteria | 173760 |
| 187 | Ga0207695_10000369 | 3300025913 | Bacteria | 103133 |
| 188 | Ga0207695_10000895 | 3300025913 | Bacteria | 53944 |
| 189 | Ga0207695_10008699 | 3300025913 | Bacteria | 12662 |
| 190 | Ga0207695_10065855 | 3300025913 | Bacteria | 3724 |
| 191 | Ga0207695_10099297 | 3300025913 | Bacteria | 2909 |
| 192 | Ga0207695_10371381 | 3300025913 | Bacteria | 1316 |
| 193 | Ga0207671_10004029 | 3300025914 | Bacteria | 14264 |
| 194 | Ga0207671_10365055 | 3300025914 | Bacteria | 1146 |
| 195 | Ga0207693_10282266 | 3300025915 | Bacteria | 1301 |
| 196 | Ga0207660_10032918 | 3300025917 | Bacteria | 3581 |
| 197 | Ga0207662_10009004 | 3300025918 | Bacteria | 5482 |
| 198 | Ga0207652_10052752 | 3300025921 | Bacteria | 3492 |
| 199 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 200 | Ga0207694_10000015 | 3300025924 | Bacteria | 363898 |
| 201 | Ga0207694_10001176 | 3300025924 | Bacteria | 22672 |
| 202 | Ga0207694_10053508 | 3300025924 | Bacteria | 3130 |
| 203 | Ga0207694_10059827 | 3300025924 | Bacteria | 2963 |
| 204 | Ga0207694_10155930 | 3300025924 | Bacteria | 1842 |
| 205 | Ga0207694_10227841 | 3300025924 | Bacteria | 1521 |
| 206 | Ga0207687_10115422 | 3300025927 | Bacteria | 2000 |
| 207 | Ga0207700_10142110 | 3300025928 | Bacteria | 1973 |
| 208 | Ga0207644_10044935 | 3300025931 | Bacteria | 3140 |
| 209 | Ga0207691_10007845 | 3300025940 | Bacteria | 10282 |
| 210 | Ga0207711_10064416 | 3300025941 | Bacteria | 3166 |
| 211 | Ga0207689_10003619 | 3300025942 | Bacteria | 14125 |
| 212 | Ga0207667_10000226 | 3300025949 | Bacteria | 79075 |
| 213 | Ga0207667_10000688 | 3300025949 | Bacteria | 43835 |
| 214 | Ga0207667_10003918 | 3300025949 | Bacteria | 18318 |
| 215 | Ga0207667_10132389 | 3300025949 | Bacteria | 2568 |
| 216 | Ga0207667_10327534 | 3300025949 | Bacteria | 1564 |
| 217 | Ga0207667_10375802 | 3300025949 | Bacteria | 1448 |
| 218 | Ga0207712_10175889 | 3300025961 | Bacteria | 1677 |
| 219 | Ga0207712_10276519 | 3300025961 | Bacteria | 1368 |
| 220 | Ga0207640_10002705 | 3300025981 | Bacteria | 9486 |
| 221 | Ga0207640_10014260 | 3300025981 | Bacteria | 4571 |
| 222 | Ga0207703_10000710 | 3300026035 | Bacteria | 32876 |
| 223 | Ga0207703_10168903 | 3300026035 | Bacteria | 1922 |
| 224 | Ga0207678_10613079 | 3300026067 | Bacteria | 955 |
| 225 | Ga0207708_10121825 | 3300026075 | Bacteria | 2032 |
| 226 | Ga0207641_10023082 | 3300026088 | Bacteria | 5126 |
| 227 | Ga0207676_10392694 | 3300026095 | Bacteria | 1294 |
| 228 | Ga0207674_10220479 | 3300026116 | Bacteria | 1845 |
| 229 | Ga0207675_100004808 | 3300026118 | Bacteria | 13008 |
| 230 | Ga0207683_10110751 | 3300026121 | Bacteria | 2458 |
| 231 | Ga0207698_10012397 | 3300026142 | Bacteria | 5576 |
| 232 | Ga0207428_10029491 | 3300027907 | Bacteria | 4547 |
| 233 | Ga0207428_10069116 | 3300027907 | Bacteria | 2777 |
| 234 | Ga0207428_10092807 | 3300027907 | Bacteria | 2342 |
| 235 | Ga0268266_10002620 | 3300028379 | Bacteria | 19042 |
| 236 | Ga0268266_10050625 | 3300028379 | Bacteria | 3564 |
| 237 | Ga0268266_10056862 | 3300028379 | Bacteria | 3364 |
| 238 | Ga0268266_10410715 | 3300028379 | Bacteria | 1281 |
| 239 | Ga0268264_10120370 | 3300028381 | Bacteria | 2313 |
| 240 | Ga0265319_1000750 | 3300028563 | Bacteria | 21154 |
| 241 | Ga0265334_10000308 | 3300028573 | Bacteria | 27268 |
| 242 | Ga0265334_10004009 | 3300028573 | Bacteria | 6613 |
| 243 | Ga0265318_10001385 | 3300028577 | Bacteria | 14400 |
| 244 | Ga0265318_10005572 | 3300028577 | Bacteria | 5903 |
| 245 | Ga0265318_10026473 | 3300028577 | Bacteria | 2283 |
| 246 | Ga0265318_10029488 | 3300028577 | Bacteria | 2139 |
| 247 | Ga0307515_10020150 | 3300028794 | Bacteria | 11922 |
| 248 | Ga0307515_10122194 | 3300028794 | Bacteria | 2939 |
| 249 | Ga0265338_10000014 | 3300028800 | Bacteria | 378751 |
| 250 | Ga0265338_10029945 | 3300028800 | Bacteria | 5381 |
| 251 | Ga0265338_10152419 | 3300028800 | Bacteria | 1794 |
| 252 | Ga0265324_10020438 | 3300029957 | Bacteria | 2379 |
| 253 | Ga0307512_10017920 | 3300030522 | Bacteria | 6481 |
| 254 | Ga0265762_1004864 | 3300030760 | Bacteria | 2405 |
| 255 | Ga0265330_10001572 | 3300031235 | Bacteria | 13096 |
| 256 | Ga0265330_10036303 | 3300031235 | Bacteria | 2197 |
| 257 | Ga0265332_10002126 | 3300031238 | Bacteria | 10235 |
| 258 | Ga0265332_10067061 | 3300031238 | Bacteria | 1530 |
| 259 | Ga0265328_10001332 | 3300031239 | Bacteria | 11393 |
| 260 | Ga0265328_10001639 | 3300031239 | Bacteria | 10280 |
| 261 | Ga0265320_10001040 | 3300031240 | Bacteria | 20589 |
| 262 | Ga0265320_10005672 | 3300031240 | Bacteria | 7970 |
| 263 | Ga0265320_10029550 | 3300031240 | Bacteria | 2835 |
| 264 | Ga0265320_10048377 | 3300031240 | Bacteria | 2075 |
| 265 | Ga0265325_10000388 | 3300031241 | Bacteria | 31115 |
| 266 | Ga0265329_10002535 | 3300031242 | Bacteria | 8246 |
| 267 | Ga0265329_10003575 | 3300031242 | Bacteria | 6728 |
| 268 | Ga0265329_10010487 | 3300031242 | Bacteria | 3397 |
| 269 | Ga0265340_10011964 | 3300031247 | Bacteria | 4591 |
| 270 | Ga0265340_10055087 | 3300031247 | Bacteria | 1916 |
| 271 | Ga0265340_10057668 | 3300031247 | Bacteria | 1865 |
| 272 | Ga0265339_10000534 | 3300031249 | Bacteria | 29685 |
| 273 | Ga0265331_10000252 | 3300031250 | Bacteria | 63468 |
| 274 | Ga0265331_10008114 | 3300031250 | Bacteria | 5997 |
| 275 | Ga0265331_10013733 | 3300031250 | Bacteria | 4342 |
| 276 | Ga0265331_10067829 | 3300031250 | Bacteria | 1673 |
| 277 | Ga0265331_10116463 | 3300031250 | Bacteria | 1223 |
| 278 | Ga0265327_10000183 | 3300031251 | Bacteria | 133191 |
| 279 | Ga0265316_10001882 | 3300031344 | Bacteria | 22039 |
| 280 | Ga0265316_10006557 | 3300031344 | Bacteria | 11100 |
| 281 | Ga0307513_10026610 | 3300031456 | Bacteria | 6664 |
| 282 | Ga0307513_10552971 | 3300031456 | Bacteria | 863 |
| 283 | Ga0265313_10006426 | 3300031595 | Bacteria | 8321 |
| 284 | Ga0265313_10057557 | 3300031595 | Bacteria | 1834 |
| 285 | Ga0265314_10000043 | 3300031711 | Bacteria | 208128 |
| 286 | Ga0265314_10001942 | 3300031711 | Bacteria | 22043 |
| 287 | Ga0265314_10002243 | 3300031711 | Bacteria | 20028 |
| 288 | Ga0265314_10012226 | 3300031711 | Bacteria | 7025 |
| 289 | Ga0265314_10049398 | 3300031711 | Bacteria | 2945 |
| 290 | Ga0265314_10053536 | 3300031711 | Bacteria | 2798 |
| 291 | Ga0265342_10005121 | 3300031712 | Bacteria | 10099 |
| 292 | Ga0265342_10008932 | 3300031712 | Bacteria | 7120 |
| 293 | Ga0265342_10012276 | 3300031712 | Bacteria | 5808 |
| 294 | Ga0307516_10005053 | 3300031730 | Bacteria | 15965 |
| 295 | Ga0307516_10016154 | 3300031730 | Bacteria | 7821 |
| 296 | Ga0307410_10118357 | 3300031852 | Bacteria | 1928 |
| 297 | Ga0307414_10008633 | 3300032004 | Bacteria | 5795 |
| 298 | Ga0307414_10035873 | 3300032004 | Bacteria | 3304 |
| 299 | Ga0307507_10042544 | 3300033179 | Bacteria | 4524 |
| 300 | Ga0307507_10147089 | 3300033179 | Bacteria | 1786 |
| 301 | Ga0307510_10000018 | 3300033180 | Bacteria | 192986 |
| 302 | Ga0373936_0002624 | 3300035113 | Bacteria | 6731 |
| 303 | Ga0373936_0009499 | 3300035113 | Unclassified | 3667 |
| 304 | Ga0373953_0094684 | 3300035117 | Bacteria | 1252 |
| 305 | Ga0373925_0000780 | 3300037068 | Bacteria | 29312 |
| 306 | Ga0395905_0068027 | 3300037471 | Bacteria | 3336 |
| 307 | Ga0395905_0120819 | 3300037471 | Bacteria | 2462 |
| 308 | Ga0439465_0008357 | 3300041413 | Bacteria | 3268 |
| 309 | Ga0451833_0539360 | 3300041491 | Bacteria | 999 |
| 310 | Ga0450908_002335 | 3300042184 | Bacteria | 3715 |
| 311 | Ga0466967_0054161 | 3300045976 | Bacteria | 3529 |
| 312 | Ga0495617_000007 | 3300046452 | Bacteria | 369986 |
| 313 | Ga0495617_000019 | 3300046452 | Bacteria | 247938 |
| 314 | Ga0495627_002755 | 3300046453 | Bacteria | 8168 |
| 315 | Ga0495592_0002444 | 3300046454 | Bacteria | 13101 |
| 316 | Ga0495603_0048088 | 3300046455 | Bacteria | 2540 |
| 317 | Ga0495591_002495 | 3300046458 | Bacteria | 10190 |
| 318 | Ga0495591_002907 | 3300046458 | Bacteria | 9173 |
| 319 | Ga0495629_0037008 | 3300046459 | Bacteria | 3440 |
| 320 | Ga0495629_0168384 | 3300046459 | Bacteria | 1521 |
| 321 | Ga0495638_0040488 | 3300046460 | Bacteria | 2952 |
| 322 | Ga0495641_0139985 | 3300046461 | Bacteria | 1081 |
| 323 | Ga0495651_0011212 | 3300046462 | Bacteria | 6888 |
| 324 | Ga0495651_0017288 | 3300046462 | Bacteria | 5587 |
| 325 | Ga0495651_0042368 | 3300046462 | Bacteria | 3534 |
| 326 | Ga0495653_0096514 | 3300046463 | Bacteria | 2149 |
| 327 | Ga0495653_0287174 | 3300046463 | Bacteria | 1077 |
| 328 | Ga0495650_0002151 | 3300046471 | Bacteria | 16727 |
| 329 | Ga0495650_0017329 | 3300046471 | Bacteria | 3614 |
| 330 | Ga0495650_0104766 | 3300046471 | Bacteria | 1058 |
| 331 | Ga0495580_0004420 | 3300046472 | Bacteria | 11810 |
| 332 | Ga0495580_0020357 | 3300046472 | Bacteria | 4910 |
| 333 | Ga0495662_0098974 | 3300046476 | Bacteria | 1426 |
| 334 | Ga0495662_0110777 | 3300046476 | Bacteria | 1345 |
| 335 | Ga0495664_0110844 | 3300046477 | Bacteria | 1656 |
| 336 | Ga0495594_0027403 | 3300046499 | Bacteria | 3070 |
| 337 | Ga0495596_0004482 | 3300046500 | Bacteria | 6790 |
| 338 | Ga0495607_0006912 | 3300046501 | Bacteria | 7910 |
| 339 | Ga0495607_0090686 | 3300046501 | Bacteria | 1656 |
| 340 | Ga0495583_0000007 | 3300046506 | Bacteria | 434661 |
| 341 | Ga0495606_0000129 | 3300046507 | Bacteria | 127929 |
| 342 | Ga0495606_0000905 | 3300046507 | Bacteria | 44064 |
| 343 | Ga0495606_0002750 | 3300046507 | Bacteria | 19735 |
| 344 | Ga0495606_0056820 | 3300046507 | Bacteria | 2524 |
| 345 | Ga0495608_0024678 | 3300046511 | Bacteria | 4108 |
| 346 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 347 | Ga0495610_0019796 | 3300046512 | Bacteria | 3753 |
| 348 | Ga0495618_0011633 | 3300046514 | Bacteria | 5339 |
| 349 | Ga0495620_0001004 | 3300046515 | Bacteria | 17443 |
| 350 | Ga0495628_0078895 | 3300046516 | Bacteria | 2560 |
| 351 | Ga0495628_0293532 | 3300046516 | Bacteria | 1204 |
| 352 | Ga0495630_0010642 | 3300046517 | Bacteria | 6641 |
| 353 | Ga0495630_0035317 | 3300046517 | Bacteria | 3736 |
| 354 | Ga0495630_0058223 | 3300046517 | Bacteria | 2896 |
| 355 | Ga0495631_0020910 | 3300046518 | Bacteria | 3052 |
| 356 | Ga0495632_0054441 | 3300046519 | Bacteria | 1961 |
| 357 | Ga0495643_0044006 | 3300046522 | Bacteria | 2427 |
| 358 | Ga0495648_0006062 | 3300046524 | Bacteria | 9921 |
| 359 | Ga0495648_0031022 | 3300046524 | Bacteria | 3525 |
| 360 | Ga0495666_0015692 | 3300046526 | Bacteria | 3773 |
| 361 | Ga0495666_0134458 | 3300046526 | Bacteria | 1154 |
| 362 | Ga0495652_0240150 | 3300046529 | Bacteria | 1348 |
| 363 | Ga0495652_0549058 | 3300046529 | Bacteria | 795 |
| 364 | Ga0495654_0000975 | 3300046530 | Bacteria | 21052 |
| 365 | Ga0495654_0002324 | 3300046530 | Bacteria | 12288 |
| 366 | Ga0495640_0009180 | 3300046533 | Bacteria | 7719 |
| 367 | Ga0495640_0022843 | 3300046533 | Bacteria | 4567 |
| 368 | Ga0495587_0006150 | 3300046536 | Bacteria | 7835 |
| 369 | Ga0495609_0000004 | 3300046538 | Bacteria | 697346 |
| 370 | Ga0495597_0003675 | 3300046542 | Bacteria | 8805 |
| 371 | Ga0495645_0066573 | 3300046543 | Bacteria | 2603 |
| 372 | Ga0495622_0006457 | 3300046557 | Bacteria | 5439 |
| 373 | Ga0495622_0016684 | 3300046557 | Bacteria | 3420 |
| 374 | Ga0495667_0307888 | 3300046559 | Bacteria | 1003 |
| 375 | Ga0495668_0000617 | 3300046616 | Bacteria | 43027 |
| 376 | Ga0495634_0042858 | 3300046642 | Bacteria | 3068 |
| 377 | Ga0495634_0061471 | 3300046642 | Bacteria | 2497 |
| 378 | Ga0495625_0003058 | 3300046660 | Bacteria | 17143 |
| 379 | Ga0495625_0014499 | 3300046660 | Bacteria | 6284 |
| 380 | Ga0495625_0070366 | 3300046660 | Bacteria | 2456 |
| 381 | Ga0495635_0006042 | 3300046663 | Bacteria | 8444 |
| 382 | Ga0495635_0071469 | 3300046663 | Bacteria | 2378 |
| 383 | Ga0495661_0000005 | 3300046665 | Bacteria | 433622 |
| 384 | Ga0495661_0050021 | 3300046665 | Bacteria | 2532 |
| 385 | Ga0495657_0087334 | 3300046675 | Bacteria | 2007 |
| 386 | Ga0495599_0017237 | 3300046678 | Bacteria | 4489 |
| 387 | Ga0495623_0024468 | 3300046679 | Bacteria | 3890 |
| 388 | Ga0495646_0253677 | 3300046680 | Bacteria | 941 |
| 389 | Ga0495613_0018759 | 3300046689 | Bacteria | 5156 |
| 390 | Ga0495613_0062229 | 3300046689 | Bacteria | 2732 |
| 391 | Ga0495624_0001660 | 3300046690 | Bacteria | 17062 |
| 392 | Ga0495624_0082711 | 3300046690 | Bacteria | 1986 |
| 393 | Ga0495670_0019459 | 3300046691 | Bacteria | 3345 |
| 394 | Ga0495671_0000149 | 3300046692 | Bacteria | 61282 |
| 395 | Ga0495671_0007514 | 3300046692 | Bacteria | 6206 |
| 396 | Ga0495649_0000120 | 3300046694 | Bacteria | 68590 |
| 397 | Ga0495649_0018977 | 3300046694 | Bacteria | 3863 |
| 398 | Ga0495589_0013524 | 3300046794 | Bacteria | 4210 |
| 399 | Ga0495589_0150735 | 3300046794 | Bacteria | 1110 |
| 400 | Ga0495600_0016310 | 3300046809 | Bacteria | 4712 |
| 401 | Ga0495600_0020333 | 3300046809 | Bacteria | 4246 |
| 402 | Ga0495600_0179024 | 3300046809 | Bacteria | 1366 |
| 403 | Ga0495660_0002670 | 3300046810 | Bacteria | 11292 |
| 404 | Ga0495660_0004430 | 3300046810 | Bacteria | 8494 |
| 405 | Ga0495581_0165908 | 3300047315 | Bacteria | 1291 |
| 406 | Ga0495604_0003124 | 3300047317 | Bacteria | 13238 |
| 407 | Ga0495604_0021114 | 3300047317 | Bacteria | 5195 |
| 408 | Ga0495604_0047208 | 3300047317 | Bacteria | 3355 |
| 409 | Ga0495674_0068531 | 3300047319 | Bacteria | 3070 |
| 410 | Ga0495672_0085495 | 3300047320 | Bacteria | 1747 |
| 411 | Ga0495676_0064798 | 3300047321 | Bacteria | 2839 |
| 412 | Ga0495680_0007407 | 3300047322 | Bacteria | 10065 |
| 413 | Ga0495680_0125777 | 3300047322 | Bacteria | 1888 |
| 414 | Ga0495683_0008864 | 3300047323 | Bacteria | 5367 |
| 415 | Ga0495687_001114 | 3300047443 | Bacteria | 26101 |
| 416 | Ga0495687_040591 | 3300047443 | Bacteria | 2049 |
| 417 | Ga0495675_0019041 | 3300047444 | Bacteria | 4359 |
| 418 | Ga0495675_0112200 | 3300047444 | Bacteria | 1701 |
| 419 | Ga0495675_0323820 | 3300047444 | Bacteria | 911 |
| 420 | Ga0495679_002387 | 3300047446 | Bacteria | 9597 |
| 421 | Ga0495679_004802 | 3300047446 | Bacteria | 6117 |
| 422 | Ga0495679_023074 | 3300047446 | Bacteria | 2117 |
| 423 | Ga0495673_0000017 | 3300047469 | Bacteria | 574970 |
| 424 | Ga0495673_0033596 | 3300047469 | Bacteria | 2379 |
| 425 | Ga0495684_0074463 | 3300047471 | Bacteria | 2580 |
| 426 | Ga0495686_0000198 | 3300047472 | Bacteria | 112699 |
| 427 | Ga0495686_0000333 | 3300047472 | Bacteria | 77831 |
| 428 | Ga0495686_0000710 | 3300047472 | Bacteria | 44890 |
| 429 | Ga0495686_0001821 | 3300047472 | Bacteria | 21486 |
| 430 | Ga0495686_0018020 | 3300047472 | Bacteria | 4747 |
| 431 | Ga0495686_0074741 | 3300047472 | Bacteria | 2079 |
| 432 | Ga0495686_0080841 | 3300047472 | Bacteria | 1985 |
| 433 | Ga0495686_0092259 | 3300047472 | Bacteria | 1837 |
| 434 | Ga0495686_0195305 | 3300047472 | Bacteria | 1164 |
| 435 | Ga0495593_0012574 | 3300047673 | Bacteria | 4833 |
| 436 | Ga0495593_0048003 | 3300047673 | Bacteria | 2270 |
| 437 | Ga0495602_0087443 | 3300048088 | Bacteria | 2597 |
| 438 | Ga0495602_0194032 | 3300048088 | Bacteria | 1554 |
| 439 | Ga0495602_0531848 | 3300048088 | Bacteria | 817 |
| 440 | Ga0495614_0007913 | 3300048089 | Bacteria | 4724 |
| 441 | Ga0496100_0000408 | 3300048903 | Bacteria | 20729 |
| 442 | Ga0496100_0003995 | 3300048903 | Bacteria | 7755 |
| 443 | Ga0496100_0030135 | 3300048903 | Bacteria | 3363 |
| 444 | Ga0496100_0655582 | 3300048903 | Bacteria | 817 |
| 445 | Ga0496101_0000237 | 3300048904 | Bacteria | 41085 |
| 446 | Ga0496101_0000741 | 3300048904 | Bacteria | 19422 |
| 447 | Ga0496102_0000007 | 3300048905 | Bacteria | 417224 |
| 448 | Ga0496102_0000675 | 3300048905 | Bacteria | 34171 |
| 449 | Ga0496102_0074271 | 3300048905 | Bacteria | 3125 |
| 450 | Ga0496102_0142798 | 3300048905 | Bacteria | 2245 |
| 451 | Ga0496103_0000071 | 3300048906 | Bacteria | 119931 |
| 452 | Ga0496103_0001123 | 3300048906 | Bacteria | 18590 |
| 453 | Ga0496103_0067581 | 3300048906 | Bacteria | 2232 |
| 454 | Ga0496104_0006567 | 3300048907 | Bacteria | 10231 |
| 455 | Ga0496104_0113893 | 3300048907 | Bacteria | 2593 |
| 456 | Ga0496105_0001384 | 3300048908 | Bacteria | 17029 |
| 457 | Ga0496105_0002949 | 3300048908 | Bacteria | 12496 |
| 458 | Ga0496105_0125315 | 3300048908 | Bacteria | 2117 |
| 459 | Ga0496107_0027099 | 3300048910 | Bacteria | 4068 |
| 460 | Ga0496107_0089835 | 3300048910 | Bacteria | 2243 |
| 461 | Ga0496110_0046248 | 3300048913 | Bacteria | 3807 |
| 462 | Ga0496112_0056946 | 3300048915 | Bacteria | 3848 |
| 463 | Ga0496112_0148415 | 3300048915 | Bacteria | 2313 |
| 464 | Ga0496112_0153010 | 3300048915 | Bacteria | 2274 |
| 465 | Ga0496113_0060153 | 3300048916 | Bacteria | 2863 |
| 466 | Ga0496115_0000013 | 3300048918 | Bacteria | 213060 |
| 467 | Ga0496115_0001836 | 3300048918 | Bacteria | 15209 |
| 468 | Ga0496115_0203976 | 3300048918 | Bacteria | 1633 |
| 469 | Ga0496115_0339004 | 3300048918 | Bacteria | 1227 |
| 470 | Ga0496116_0000033 | 3300048919 | Bacteria | 418191 |
| 471 | Ga0496116_0004586 | 3300048919 | Bacteria | 13100 |
| 472 | Ga0496116_0012188 | 3300048919 | Bacteria | 7034 |
| 473 | Ga0496116_0019853 | 3300048919 | Bacteria | 5129 |
| 474 | Ga0496116_0050759 | 3300048919 | Bacteria | 2761 |
| 475 | Ga0496116_0144325 | 3300048919 | Bacteria | 1333 |
| 476 | Ga0496117_0000025 | 3300048920 | Bacteria | 418106 |
| 477 | Ga0496117_0000105 | 3300048920 | Bacteria | 188970 |
| 478 | Ga0496117_0001301 | 3300048920 | Bacteria | 36722 |
| 479 | Ga0496117_0006113 | 3300048920 | Bacteria | 12322 |
| 480 | Ga0496117_0023459 | 3300048920 | Bacteria | 4915 |
| 481 | Ga0496118_0000023 | 3300048921 | Bacteria | 418106 |
| 482 | Ga0496118_0000168 | 3300048921 | Bacteria | 118938 |
| 483 | Ga0496118_0000928 | 3300048921 | Bacteria | 45801 |
| 484 | Ga0496118_0001539 | 3300048921 | Bacteria | 34281 |
| 485 | Ga0496118_0002320 | 3300048921 | Bacteria | 25836 |
| 486 | Ga0496118_0003433 | 3300048921 | Bacteria | 19953 |
| 487 | Ga0496118_0003510 | 3300048921 | Bacteria | 19666 |
| 488 | Ga0496118_0068921 | 3300048921 | Bacteria | 2565 |
| 489 | Ga0496118_0206669 | 3300048921 | Bacteria | 1156 |
| 490 | Ga0496118_0232324 | 3300048921 | Bacteria | 1063 |
| 491 | Ga0496119_0000708 | 3300048922 | Bacteria | 44757 |
| 492 | Ga0496119_0001159 | 3300048922 | Bacteria | 33015 |
| 493 | Ga0496119_0006900 | 3300048922 | Bacteria | 10367 |
| 494 | Ga0496119_0014245 | 3300048922 | Bacteria | 6243 |
| 495 | Ga0496119_0031328 | 3300048922 | Bacteria | 3570 |
| 496 | Ga0496119_0197038 | 3300048922 | Bacteria | 1045 |
| 497 | Ga0496120_0000281 | 3300048923 | Bacteria | 85648 |
| 498 | Ga0496120_0021522 | 3300048923 | Bacteria | 4075 |
| 499 | Ga0496120_0023864 | 3300048923 | Bacteria | 3822 |
| 500 | Ga0496120_0092308 | 3300048923 | Bacteria | 1615 |
| 501 | Ga0496121_0000168 | 3300048924 | Bacteria | 144896 |
| 502 | Ga0496121_0000642 | 3300048924 | Bacteria | 65239 |
| 503 | Ga0496121_0000993 | 3300048924 | Bacteria | 50722 |
| 504 | Ga0496121_0001151 | 3300048924 | Bacteria | 46359 |
| 505 | Ga0496121_0001605 | 3300048924 | Bacteria | 37523 |
| 506 | Ga0496121_0022990 | 3300048924 | Bacteria | 6023 |
| 507 | Ga0496121_0025389 | 3300048924 | Bacteria | 5623 |
| 508 | Ga0496121_0048199 | 3300048924 | Bacteria | 3627 |
| 509 | Ga0496121_0051063 | 3300048924 | Bacteria | 3486 |
| 510 | Ga0496121_0065636 | 3300048924 | Bacteria | 2952 |
| 511 | Ga0496121_0069065 | 3300048924 | Bacteria | 2854 |
| 512 | Ga0496121_0084224 | 3300048924 | Bacteria | 2508 |
| 513 | Ga0496121_0103486 | 3300048924 | Bacteria | 2190 |
| 514 | Ga0496121_0152393 | 3300048924 | Bacteria | 1699 |
| 515 | Ga0496121_0335274 | 3300048924 | Bacteria | 1013 |
| 516 | Ga0496121_0423608 | 3300048924 | Bacteria | 865 |
| 517 | Ga0496122_0000261 | 3300048925 | Bacteria | 118793 |
| 518 | Ga0496122_0014428 | 3300048925 | Bacteria | 7642 |
| 519 | Ga0496122_0034521 | 3300048925 | Bacteria | 4138 |
| 520 | Ga0496122_0067349 | 3300048925 | Bacteria | 2580 |
| 521 | Ga0496123_0000218 | 3300048926 | Bacteria | 116615 |
| 522 | Ga0496123_0286750 | 3300048926 | Bacteria | 793 |
| 523 | Ga0496124_0002073 | 3300048927 | Bacteria | 27131 |
| 524 | Ga0496124_0029645 | 3300048927 | Bacteria | 4870 |
| 525 | Ga0496124_0037817 | 3300048927 | Bacteria | 4194 |
| 526 | Ga0496124_0078295 | 3300048927 | Bacteria | 2725 |
| 527 | Ga0496125_0000312 | 3300048928 | Bacteria | 95519 |
| 528 | Ga0496125_0000766 | 3300048928 | Bacteria | 52572 |
| 529 | Ga0496125_0024470 | 3300048928 | Bacteria | 5552 |
| 530 | Ga0496125_0154936 | 3300048928 | Bacteria | 1567 |
| 531 | Ga0496125_0273019 | 3300048928 | Bacteria | 1052 |
| 532 | Ga0496126_0000189 | 3300048929 | Bacteria | 138921 |
| 533 | Ga0496126_0000559 | 3300048929 | Bacteria | 71584 |
| 534 | Ga0496126_0022212 | 3300048929 | Bacteria | 6177 |
| 535 | Ga0496126_0028662 | 3300048929 | Bacteria | 5302 |
| 536 | Ga0496126_0030259 | 3300048929 | Bacteria | 5131 |
| 537 | Ga0496126_0040617 | 3300048929 | Bacteria | 4312 |
| 538 | Ga0496126_0067880 | 3300048929 | Bacteria | 3185 |
| 539 | Ga0496126_0226165 | 3300048929 | Bacteria | 1569 |
| 540 | Ga0496126_0374912 | 3300048929 | Bacteria | 1159 |
| 541 | Ga0495682_0000428 | 3300049460 | Bacteria | 29486 |
| 542 | Ga0495682_0000711 | 3300049460 | Bacteria | 21787 |
| 543 | Ga0501031_0059763 | 3300049568 | Bacteria | 2484 |
| 544 | Ga0501032_0258839 | 3300049569 | Bacteria | 1129 |
| 545 | Ga0501033_0047542 | 3300049570 | Bacteria | 3190 |
| 546 | Ga0501034_0223576 | 3300049571 | Bacteria | 1834 |
| 547 | Ga0501035_0064778 | 3300049822 | Bacteria | 3247 |
| 548 | Ga0501044_0010325 | 3300049823 | Bacteria | 10141 |
| 549 | nmdc:mga0yw44_1193_c1 | 3300050492 | Bacteria | 10158 |
| 550 | nmdc:mga0k408_155364_c1 | 3300050493 | Bacteria | 1363 |
| 551 | nmdc:mga06z11_108975_c1 | 3300050494 | Bacteria | 1531 |
| 552 | nmdc:mga07m45_52153_c1 | 3300050496 | Bacteria | 2308 |
| 553 | nmdc:mga05p37_171997_c1 | 3300050507 | Bacteria | 2642 |
| 554 | nmdc:mga05p37_613462_c1 | 3300050507 | Bacteria | 1226 |
| 555 | nmdc:mga09592_268154_c1 | 3300050508 | Unclassified | 1481 |
| 556 | nmdc:mga0n895_152362_c1 | 3300050512 | Bacteria | 2343 |
| 557 | nmdc:mga0rr50_52214_c1 | 3300050513 | Bacteria | 3037 |
| 558 | nmdc:mga08x19_57176_c1 | 3300050514 | Bacteria | 2519 |
| 559 | nmdc:mga0a205_10501_c1 | 3300050515 | Bacteria | 8509 |
| 560 | nmdc:mga0a205_88801_c1 | 3300050515 | Bacteria | 2988 |
| 561 | nmdc:mga0sz30_39984_c1 | 3300050516 | Bacteria | 1970 |
| 562 | Ga0495619_0203053 | 3300053085 | Bacteria | 1372 |
| 563 | Ga0500643_001483 | 3300053087 | Bacteria | 13455 |
| 564 | Ga0500643_012565 | 3300053087 | Bacteria | 3028 |
| 565 | Ga0500644_0088354 | 3300053088 | Bacteria | 1155 |
| 566 | Ga0500651_0008177 | 3300053093 | Bacteria | 6139 |
| 567 | Ga0500566_0005153 | 3300053094 | Bacteria | 7785 |
| 568 | Ga0500591_105769 | 3300053115 | Bacteria | 1192 |
| 569 | Ga0500595_001400 | 3300053119 | Bacteria | 12943 |
| 570 | Ga0500597_000296 | 3300053120 | Bacteria | 10120 |
| 571 | Ga0500608_001747 | 3300053122 | Bacteria | 7762 |
| 572 | Ga0500618_005472 | 3300053125 | Bacteria | 3852 |
| 573 | Ga0500655_008745 | 3300053133 | Bacteria | 1821 |
| 574 | Ga0500559_0000006 | 3300053136 | Bacteria | 229895 |
| 575 | Ga0500559_0017817 | 3300053136 | Bacteria | 3003 |
| 576 | Ga0500559_0028952 | 3300053136 | Bacteria | 2369 |
| 577 | Ga0500559_0111707 | 3300053136 | Bacteria | 1266 |
| 578 | Ga0500590_000200 | 3300053148 | Bacteria | 18250 |
| 579 | Ga0500604_0000038 | 3300053151 | Bacteria | 50694 |
| 580 | Ga0500616_0000483 | 3300053153 | Bacteria | 51655 |
| 581 | Ga0500622_0002675 | 3300053156 | Bacteria | 12636 |
| 582 | Ga0500627_0055845 | 3300053158 | Bacteria | 1730 |
| 583 | Ga0500634_0024950 | 3300053161 | Bacteria | 3253 |
| 584 | Ga0500637_0096758 | 3300053178 | Bacteria | 1711 |
| 585 | Ga0500584_041143 | 3300053726 | Bacteria | 2119 |
| 586 | Ga0500645_000710 | 3300053730 | Bacteria | 20669 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050508 | nmdc:mga09592_268154_c1 | nmdc:mga09592_268154_c1_775_1461 | 224 |
| 2 | 3300003775 | Ga0055524_1017004 | Ga0055524_10170042 | 227 |
| 3 | 3300047443 | Ga0495687_040591 | Ga0495687_040591_249_1061 | 231 |
| 4 | 3300045976 | Ga0466967_0054161 | Ga0466967_0054161_1318_2082 | 232 |
| 5 | 3300025304 | Ga0209257_1000741 | Ga0209257_10007418 | 234 |
| 6 | 3300003323 | rootH1_10031460 | rootH1_1003146010 | 235 |
| 7 | 3300003771 | Ga0055526_1002309 | Ga0055526_100230911 | 235 |
| 8 | 3300003775 | Ga0055524_1000769 | Ga0055524_100076925 | 235 |
| 9 | 3300003790 | Ga0055528_1000083 | Ga0055528_100008343 | 235 |
| 10 | 3300003792 | Ga0055540_1002498 | Ga0055540_10024989 | 235 |
| 11 | 3300025273 | Ga0209673_1000086 | Ga0209673_1000086172 | 235 |
| 12 | 3300025292 | Ga0209676_1010078 | Ga0209676_10100783 | 235 |
| 13 | 3300025294 | Ga0209025_1002308 | Ga0209025_100230812 | 235 |
| 14 | 3300025295 | Ga0209564_1001360 | Ga0209564_100136025 | 235 |
| 15 | 3300025297 | Ga0209758_1027946 | Ga0209758_10279464 | 235 |
| 16 | 3300025299 | Ga0209256_1004607 | Ga0209256_10046076 | 235 |
| 17 | 3300025928 | Ga0207700_10142110 | Ga0207700_101421102 | 235 |
| 18 | 3300048920 | Ga0496117_0000105 | Ga0496117_0000105_52450_53205 | 235 |
| 19 | 3300048921 | Ga0496118_0000168 | Ga0496118_0000168_46145_46900 | 235 |
| 20 | 3300048924 | Ga0496121_0022990 | Ga0496121_0022990_1656_2384 | 235 |
| 21 | 3300048924 | Ga0496121_0051063 | Ga0496121_0051063_1524_2279 | 235 |
| 22 | 3300048929 | Ga0496126_0000559 | Ga0496126_0000559_31093_31821 | 235 |
| 23 | iso_pu_bacteria | 2517093000 | 2517097578 | 235 |
| 24 | iso_pu_bacteria | 2599185156 | 2599336369 | 236 |
| 25 | 3300005468 | Ga0070707_100517689 | Ga0070707_1005176892 | 237 |
| 26 | 3300046517 | Ga0495630_0010642 | Ga0495630_0010642_1247_1990 | 237 |
| 27 | 3300005436 | Ga0070713_100017990 | Ga0070713_1000179904 | 238 |
| 28 | iso_pu_bacteria | 2513237146 | 2513924673 | 238 |
| 29 | iso_pu_bacteria | 2599185170 | 2599416228 | 238 |
| 30 | iso_pu_bacteria | 2738543031 | 2739349450 | 238 |
| 31 | iso_pu_bacteria | 2838035591 | 2838036349 | 238 |
| 32 | 3300025924 | Ga0207694_10227841 | Ga0207694_102278411 | 239 |
| 33 | 3300048927 | Ga0496124_0078295 | Ga0496124_0078295_624_1358 | 239 |
| 34 | iso_pu_bacteria | 2643221687 | 2644485654 | 239 |
| 35 | 3300053125 | Ga0500618_005472 | Ga0500618_005472_2026_2802 | 240 |
| 36 | iso_pu_bacteria | 2510065019 | 2510135774 | 240 |
| 37 | iso_pu_bacteria | 2511231015 | 2511318212 | 240 |
| 38 | iso_pu_bacteria | 2512875024 | 2512962627 | 240 |
| 39 | iso_pu_bacteria | 2513237164 | 2514039895 | 240 |
| 40 | iso_pu_bacteria | 2517093000 | 2517099899 | 240 |
| 41 | iso_pu_bacteria | 2517287029 | 2517409031 | 240 |
| 42 | iso_pu_bacteria | 2582581304 | 2585255322 | 240 |
| 43 | iso_pu_bacteria | 2582581308 | 2585283283 | 240 |
| 44 | iso_pu_bacteria | 2585427527 | 2585534692 | 240 |
| 45 | iso_pu_bacteria | 2588253510 | 2588293128 | 240 |
| 46 | iso_pu_bacteria | 2615840626 | 2616312385 | 240 |
| 47 | iso_pu_bacteria | 2643221552 | 2643778426 | 240 |
| 48 | iso_pu_bacteria | 2643221592 | 2643971058 | 240 |
| 49 | iso_pu_bacteria | 2643221625 | 2644144221 | 240 |
| 50 | iso_pu_bacteria | 2643221648 | 2644275243 | 240 |
| 51 | iso_pu_bacteria | 2718218334 | 2721027466 | 240 |
| 52 | iso_pu_bacteria | 2734482264 | 2735836398 | 240 |
| 53 | iso_pu_bacteria | 2818991461 | 2819683518 | 240 |
| 54 | iso_pu_bacteria | 2841957949 | 2841960806 | 240 |
| 55 | iso_pu_bacteria | 2842780639 | 2842782873 | 240 |
| 56 | iso_pu_bacteria | 2844002411 | 2844004590 | 240 |
| 57 | iso_pu_bacteria | 2874590934 | 2874593066 | 240 |
| 58 | iso_pu_bacteria | 2876771140 | 2876772431 | 240 |
| 59 | iso_pu_bacteria | 2876818435 | 2876820821 | 240 |
| 60 | iso_pu_bacteria | 2879074833 | 2879077018 | 240 |
| 61 | iso_pu_bacteria | 2884811622 | 2884814481 | 240 |
| 62 | iso_pu_bacteria | 2894652903 | 2894656960 | 240 |
| 63 | iso_pu_bacteria | 2896154374 | 2896159006 | 240 |
| 64 | iso_pu_bacteria | 2900634093 | 2900640431 | 240 |
| 65 | iso_pu_bacteria | 642555113 | 642616930 | 240 |
| 66 | iso_pu_bacteria | 8024486573 | 8024490509 | 240 |
| 67 | iso_pu_bacteria | 8056155041 | 8056157532 | 240 |
| 68 | iso_pu_bacteria | 2738541297 | 2738825268 | 241 |
| 69 | iso_pu_bacteria | 2738541357 | 2739149065 | 241 |
| 70 | iso_pu_bacteria | 2738543003 | 2739190984 | 241 |
| 71 | iso_pu_bacteria | 2738543026 | 2739317461 | 241 |
| 72 | iso_pu_bacteria | 2738543029 | 2739335702 | 241 |
| 73 | iso_pu_bacteria | 2884836552 | 2884839196 | 242 |
| 74 | 3300003792 | Ga0055540_1005083 | Ga0055540_10050835 | 243 |
| 75 | 3300005445 | Ga0070708_100130358 | Ga0070708_1001303582 | 243 |
| 76 | 3300005468 | Ga0070707_100518728 | Ga0070707_1005187281 | 243 |
| 77 | 3300005471 | Ga0070698_100068467 | Ga0070698_1000684677 | 243 |
| 78 | 3300005471 | Ga0070698_100755514 | Ga0070698_1007555141 | 243 |
| 79 | 3300006028 | Ga0070717_10019228 | Ga0070717_100192286 | 243 |
| 80 | 3300006028 | Ga0070717_10138658 | Ga0070717_101386582 | 243 |
| 81 | 3300006852 | Ga0075433_10225004 | Ga0075433_102250042 | 243 |
| 82 | 3300006914 | Ga0075436_100306759 | Ga0075436_1003067592 | 243 |
| 83 | 3300007076 | Ga0075435_100097969 | Ga0075435_1000979691 | 243 |
| 84 | 3300025303 | Ga0209051_1000417 | Ga0209051_100041736 | 243 |
| 85 | 3300025915 | Ga0207693_10282266 | Ga0207693_102822662 | 243 |
| 86 | 3300050507 | nmdc:mga05p37_171997_c1 | nmdc:mga05p37_171997_c1_124_888 | 243 |
| 87 | 3300050507 | nmdc:mga05p37_613462_c1 | nmdc:mga05p37_613462_c1_15_779 | 243 |
| 88 | 3300050512 | nmdc:mga0n895_152362_c1 | nmdc:mga0n895_152362_c1_169_933 | 243 |
| 89 | 3300050513 | nmdc:mga0rr50_52214_c1 | nmdc:mga0rr50_52214_c1_1657_2421 | 243 |
| 90 | 3300050514 | nmdc:mga08x19_57176_c1 | nmdc:mga08x19_57176_c1_48_809 | 243 |
| 91 | 3300050515 | nmdc:mga0a205_10501_c1 | nmdc:mga0a205_10501_c1_6171_6935 | 243 |
| 92 | 3300050515 | nmdc:mga0a205_88801_c1 | nmdc:mga0a205_88801_c1_827_1591 | 243 |
| 93 | iso_pu_bacteria | 2818991450 | 2819618913 | 243 |
| 94 | 3300001989 | JGI24739J22299_10005957 | JGI24739J22299_100059574 | 244 |
| 95 | 3300001990 | JGI24737J22298_10006139 | JGI24737J22298_100061394 | 244 |
| 96 | 3300002705 | JGI25156J39149_1000392 | JGI25156J39149_100039217 | 244 |
| 97 | 3300002737 | JGI25162J39368_1004766 | JGI25162J39368_10047666 | 244 |
| 98 | 3300002739 | JGI25158J39367_1000058 | JGI25158J39367_10000582 | 244 |
| 99 | 3300002987 | JGI25159J45721_1005559 | JGI25159J45721_10055592 | 244 |
| 100 | 3300003214 | JGI25165J46597_1003207 | JGI25165J46597_10032076 | 244 |
| 101 | 3300003354 | JGI25160J50197_1000091 | JGI25160J50197_100009125 | 244 |
| 102 | 3300003374 | JGI25161J50226_1000027 | JGI25161J50226_100002735 | 244 |
| 103 | 3300003771 | Ga0055526_1002486 | Ga0055526_100248613 | 244 |
| 104 | 3300003771 | Ga0055526_1003148 | Ga0055526_10031486 | 244 |
| 105 | 3300003775 | Ga0055524_1004005 | Ga0055524_100400510 | 244 |
| 106 | 3300003775 | Ga0055524_1034279 | Ga0055524_10342792 | 244 |
| 107 | 3300003790 | Ga0055528_1002171 | Ga0055528_10021717 | 244 |
| 108 | 3300003790 | Ga0055528_1014332 | Ga0055528_10143321 | 244 |
| 109 | 3300003792 | Ga0055540_1013326 | Ga0055540_10133262 | 244 |
| 110 | 3300004625 | Ga0055543_1000100 | Ga0055543_100010054 | 244 |
| 111 | 3300005262 | Ga0065165_1000317 | Ga0065165_10003174 | 244 |
| 112 | 3300005262 | Ga0065165_1004450 | Ga0065165_10044505 | 244 |
| 113 | 3300005262 | Ga0065165_1025517 | Ga0065165_10255173 | 244 |
| 114 | 3300005327 | Ga0070658_10002980 | Ga0070658_100029803 | 244 |
| 115 | 3300005331 | Ga0070670_100419583 | Ga0070670_1004195832 | 244 |
| 116 | 3300005335 | Ga0070666_10125226 | Ga0070666_101252262 | 244 |
| 117 | 3300005336 | Ga0070680_100068527 | Ga0070680_1000685272 | 244 |
| 118 | 3300005337 | Ga0070682_100000010 | Ga0070682_100000010200 | 244 |
| 119 | 3300005338 | Ga0068868_100394240 | Ga0068868_1003942401 | 244 |
| 120 | 3300005353 | Ga0070669_100148401 | Ga0070669_1001484012 | 244 |
| 121 | 3300005355 | Ga0070671_100007684 | Ga0070671_1000076847 | 244 |
| 122 | 3300005367 | Ga0070667_100394680 | Ga0070667_1003946802 | 244 |
| 123 | 3300005367 | Ga0070667_100400971 | Ga0070667_1004009712 | 244 |
| 124 | 3300005436 | Ga0070713_100017981 | Ga0070713_1000179816 | 244 |
| 125 | 3300005438 | Ga0070701_10170882 | Ga0070701_101708822 | 244 |
| 126 | 3300005445 | Ga0070708_100135918 | Ga0070708_1001359182 | 244 |
| 127 | 3300005445 | Ga0070708_100427362 | Ga0070708_1004273622 | 244 |
| 128 | 3300005455 | Ga0070663_100003650 | Ga0070663_1000036507 | 244 |
| 129 | 3300005458 | Ga0070681_10087697 | Ga0070681_100876972 | 244 |
| 130 | 3300005458 | Ga0070681_10373025 | Ga0070681_103730252 | 244 |
| 131 | 3300005459 | Ga0068867_100035589 | Ga0068867_1000355894 | 244 |
| 132 | 3300005518 | Ga0070699_100308445 | Ga0070699_1003084452 | 244 |
| 133 | 3300005530 | Ga0070679_100450587 | Ga0070679_1004505872 | 244 |
| 134 | 3300005530 | Ga0070679_100826242 | Ga0070679_1008262421 | 244 |
| 135 | 3300005539 | Ga0068853_100699781 | Ga0068853_1006997811 | 244 |
| 136 | 3300005543 | Ga0070672_100009209 | Ga0070672_1000092092 | 244 |
| 137 | 3300005548 | Ga0070665_100010240 | Ga0070665_10001024013 | 244 |
| 138 | 3300005548 | Ga0070665_100302145 | Ga0070665_1003021452 | 244 |
| 139 | 3300005548 | Ga0070665_100486080 | Ga0070665_1004860802 | 244 |
| 140 | 3300005548 | Ga0070665_100526652 | Ga0070665_1005266522 | 244 |
| 141 | 3300005563 | Ga0068855_100000858 | Ga0068855_10000085815 | 244 |
| 142 | 3300005563 | Ga0068855_100014303 | Ga0068855_10001430310 | 244 |
| 143 | 3300005563 | Ga0068855_100054969 | Ga0068855_1000549693 | 244 |
| 144 | 3300005563 | Ga0068855_100056965 | Ga0068855_1000569654 | 244 |
| 145 | 3300005563 | Ga0068855_100085286 | Ga0068855_1000852863 | 244 |
| 146 | 3300005563 | Ga0068855_100260532 | Ga0068855_1002605322 | 244 |
| 147 | 3300005577 | Ga0068857_100180941 | Ga0068857_1001809412 | 244 |
| 148 | 3300005578 | Ga0068854_100048810 | Ga0068854_1000488102 | 244 |
| 149 | 3300005578 | Ga0068854_100330083 | Ga0068854_1003300832 | 244 |
| 150 | 3300005616 | Ga0068852_100019851 | Ga0068852_1000198514 | 244 |
| 151 | 3300005616 | Ga0068852_100041265 | Ga0068852_1000412655 | 244 |
| 152 | 3300005617 | Ga0068859_100590936 | Ga0068859_1005909361 | 244 |
| 153 | 3300005618 | Ga0068864_100021820 | Ga0068864_1000218205 | 244 |
| 154 | 3300005618 | Ga0068864_100358525 | Ga0068864_1003585252 | 244 |
| 155 | 3300005719 | Ga0068861_100339899 | Ga0068861_1003398991 | 244 |
| 156 | 3300005841 | Ga0068863_100310566 | Ga0068863_1003105661 | 244 |
| 157 | 3300005842 | Ga0068858_100001585 | Ga0068858_1000015855 | 244 |
| 158 | 3300005842 | Ga0068858_100124358 | Ga0068858_1001243583 | 244 |
| 159 | 3300005842 | Ga0068858_100492684 | Ga0068858_1004926842 | 244 |
| 160 | 3300005844 | Ga0068862_100108584 | Ga0068862_1001085842 | 244 |
| 161 | 3300005983 | Ga0081540_1133843 | Ga0081540_11338432 | 244 |
| 162 | 3300006028 | Ga0070717_10041240 | Ga0070717_100412402 | 244 |
| 163 | 3300006038 | Ga0075365_10029676 | Ga0075365_100296763 | 244 |
| 164 | 3300006058 | Ga0075432_10010404 | Ga0075432_100104043 | 244 |
| 165 | 3300006163 | Ga0070715_10078906 | Ga0070715_100789062 | 244 |
| 166 | 3300006178 | Ga0075367_10035872 | Ga0075367_100358721 | 244 |
| 167 | 3300006186 | Ga0075369_10061890 | Ga0075369_100618903 | 244 |
| 168 | 3300006237 | Ga0097621_100071998 | Ga0097621_1000719984 | 244 |
| 169 | 3300006353 | Ga0075370_10003461 | Ga0075370_100034615 | 244 |
| 170 | 3300006353 | Ga0075370_10032594 | Ga0075370_100325945 | 244 |
| 171 | 3300006353 | Ga0075370_10166295 | Ga0075370_101662951 | 244 |
| 172 | 3300006931 | Ga0097620_100590924 | Ga0097620_1005909241 | 244 |
| 173 | 3300009036 | Ga0105244_10000426 | Ga0105244_1000042643 | 244 |
| 174 | 3300009036 | Ga0105244_10014169 | Ga0105244_100141695 | 244 |
| 175 | 3300009036 | Ga0105244_10033227 | Ga0105244_100332272 | 244 |
| 176 | 3300009093 | Ga0105240_10000582 | Ga0105240_1000058218 | 244 |
| 177 | 3300009093 | Ga0105240_10041155 | Ga0105240_100411557 | 244 |
| 178 | 3300009093 | Ga0105240_10441772 | Ga0105240_104417722 | 244 |
| 179 | 3300009093 | Ga0105240_10570525 | Ga0105240_105705252 | 244 |
| 180 | 3300009098 | Ga0105245_10008078 | Ga0105245_100080788 | 244 |
| 181 | 3300009098 | Ga0105245_10129607 | Ga0105245_101296072 | 244 |
| 182 | 3300009177 | Ga0105248_10002723 | Ga0105248_1000272313 | 244 |
| 183 | 3300009545 | Ga0105237_10005522 | Ga0105237_100055225 | 244 |
| 184 | 3300009551 | Ga0105238_10002323 | Ga0105238_1000232315 | 244 |
| 185 | 3300009551 | Ga0105238_10086552 | Ga0105238_100865522 | 244 |
| 186 | 3300009551 | Ga0105238_10205361 | Ga0105238_102053612 | 244 |
| 187 | 3300009551 | Ga0105238_10249431 | Ga0105238_102494312 | 244 |
| 188 | 3300009551 | Ga0105238_10296461 | Ga0105238_102964611 | 244 |
| 189 | 3300009553 | Ga0105249_10484491 | Ga0105249_104844912 | 244 |
| 190 | 3300010375 | Ga0105239_10026955 | Ga0105239_1002695510 | 244 |
| 191 | 3300010375 | Ga0105239_10030881 | Ga0105239_100308816 | 244 |
| 192 | 3300011119 | Ga0105246_10117204 | Ga0105246_101172041 | 244 |
| 193 | 3300013100 | Ga0157373_10021479 | Ga0157373_100214795 | 244 |
| 194 | 3300013104 | Ga0157370_10020961 | Ga0157370_100209615 | 244 |
| 195 | 3300013104 | Ga0157370_10115547 | Ga0157370_101155473 | 244 |
| 196 | 3300013105 | Ga0157369_10019628 | Ga0157369_100196282 | 244 |
| 197 | 3300013105 | Ga0157369_10045264 | Ga0157369_100452645 | 244 |
| 198 | 3300013105 | Ga0157369_10071570 | Ga0157369_100715702 | 244 |
| 199 | 3300013105 | Ga0157369_10091841 | Ga0157369_100918413 | 244 |
| 200 | 3300013296 | Ga0157374_10000016 | Ga0157374_10000016264 | 244 |
| 201 | 3300013296 | Ga0157374_10188829 | Ga0157374_101888292 | 244 |
| 202 | 3300013306 | Ga0163162_10057372 | Ga0163162_100573724 | 244 |
| 203 | 3300013306 | Ga0163162_10070705 | Ga0163162_100707053 | 244 |
| 204 | 3300013306 | Ga0163162_10090010 | Ga0163162_100900104 | 244 |
| 205 | 3300013307 | Ga0157372_10545442 | Ga0157372_105454421 | 244 |
| 206 | 3300013308 | Ga0157375_10001246 | Ga0157375_1000124614 | 244 |
| 207 | 3300013308 | Ga0157375_10083679 | Ga0157375_100836794 | 244 |
| 208 | 3300014497 | Ga0182008_10024539 | Ga0182008_100245391 | 244 |
| 209 | 3300014745 | Ga0157377_10000004 | Ga0157377_10000004221 | 244 |
| 210 | 3300014968 | Ga0157379_10219251 | Ga0157379_102192512 | 244 |
| 211 | 3300014968 | Ga0157379_10292753 | Ga0157379_102927532 | 244 |
| 212 | 3300014968 | Ga0157379_10402398 | Ga0157379_104023981 | 244 |
| 213 | 3300014969 | Ga0157376_10917771 | Ga0157376_109177711 | 244 |
| 214 | 3300015262 | Ga0182007_10011773 | Ga0182007_100117733 | 244 |
| 215 | 3300015265 | Ga0182005_1008225 | Ga0182005_10082252 | 244 |
| 216 | 3300017792 | Ga0163161_10012991 | Ga0163161_100129912 | 244 |
| 217 | 3300017792 | Ga0163161_10023633 | Ga0163161_100236336 | 244 |
| 218 | 3300017792 | Ga0163161_10596121 | Ga0163161_105961211 | 244 |
| 219 | 3300022732 | Ga0224569_100965 | Ga0224569_1009653 | 244 |
| 220 | 3300024227 | Ga0228598_1014728 | Ga0228598_10147282 | 244 |
| 221 | 3300025208 | Ga0209436_100009 | Ga0209436_10000969 | 244 |
| 222 | 3300025233 | Ga0209437_100456 | Ga0209437_10045622 | 244 |
| 223 | 3300025253 | Ga0209677_100189 | Ga0209677_10018920 | 244 |
| 224 | 3300025256 | Ga0209759_1000130 | Ga0209759_100013020 | 244 |
| 225 | 3300025258 | Ga0209129_1003434 | Ga0209129_10034347 | 244 |
| 226 | 3300025261 | Ga0209233_1000139 | Ga0209233_1000139113 | 244 |
| 227 | 3300025261 | Ga0209233_1008017 | Ga0209233_10080172 | 244 |
| 228 | 3300025273 | Ga0209673_1001554 | Ga0209673_100155420 | 244 |
| 229 | 3300025273 | Ga0209673_1005597 | Ga0209673_10055974 | 244 |
| 230 | 3300025273 | Ga0209673_1010152 | Ga0209673_10101523 | 244 |
| 231 | 3300025284 | Ga0209130_1000031 | Ga0209130_1000031272 | 244 |
| 232 | 3300025284 | Ga0209130_1006753 | Ga0209130_10067533 | 244 |
| 233 | 3300025295 | Ga0209564_1001436 | Ga0209564_10014364 | 244 |
| 234 | 3300025295 | Ga0209564_1002099 | Ga0209564_100209914 | 244 |
| 235 | 3300025297 | Ga0209758_1008287 | Ga0209758_10082872 | 244 |
| 236 | 3300025297 | Ga0209758_1008982 | Ga0209758_10089827 | 244 |
| 237 | 3300025299 | Ga0209256_1003202 | Ga0209256_10032028 | 244 |
| 238 | 3300025299 | Ga0209256_1004406 | Ga0209256_10044063 | 244 |
| 239 | 3300025302 | Ga0207426_1000004 | Ga0207426_100000491 | 244 |
| 240 | 3300025302 | Ga0207426_1000042 | Ga0207426_1000042137 | 244 |
| 241 | 3300025315 | Ga0207697_10071986 | Ga0207697_100719862 | 244 |
| 242 | 3300025728 | Ga0207655_1000444 | Ga0207655_100044435 | 244 |
| 243 | 3300025728 | Ga0207655_1009083 | Ga0207655_10090833 | 244 |
| 244 | 3300025728 | Ga0207655_1018055 | Ga0207655_10180552 | 244 |
| 245 | 3300025901 | Ga0207688_10039677 | Ga0207688_100396773 | 244 |
| 246 | 3300025904 | Ga0207647_10011208 | Ga0207647_100112082 | 244 |
| 247 | 3300025907 | Ga0207645_10034883 | Ga0207645_100348833 | 244 |
| 248 | 3300025908 | Ga0207643_10133876 | Ga0207643_101338762 | 244 |
| 249 | 3300025909 | Ga0207705_10000488 | Ga0207705_1000048812 | 244 |
| 250 | 3300025912 | Ga0207707_10002194 | Ga0207707_1000219411 | 244 |
| 251 | 3300025912 | Ga0207707_10504593 | Ga0207707_105045931 | 244 |
| 252 | 3300025913 | Ga0207695_10000172 | Ga0207695_1000017273 | 244 |
| 253 | 3300025913 | Ga0207695_10000192 | Ga0207695_1000019210 | 244 |
| 254 | 3300025913 | Ga0207695_10000369 | Ga0207695_1000036963 | 244 |
| 255 | 3300025913 | Ga0207695_10000895 | Ga0207695_1000089545 | 244 |
| 256 | 3300025913 | Ga0207695_10008699 | Ga0207695_100086995 | 244 |
| 257 | 3300025913 | Ga0207695_10065855 | Ga0207695_100658553 | 244 |
| 258 | 3300025913 | Ga0207695_10099297 | Ga0207695_100992973 | 244 |
| 259 | 3300025913 | Ga0207695_10371381 | Ga0207695_103713812 | 244 |
| 260 | 3300025914 | Ga0207671_10004029 | Ga0207671_100040295 | 244 |
| 261 | 3300025914 | Ga0207671_10365055 | Ga0207671_103650552 | 244 |
| 262 | 3300025917 | Ga0207660_10032918 | Ga0207660_100329183 | 244 |
| 263 | 3300025918 | Ga0207662_10009004 | Ga0207662_100090049 | 244 |
| 264 | 3300025921 | Ga0207652_10052752 | Ga0207652_100527522 | 244 |
| 265 | 3300025924 | Ga0207694_10000001 | Ga0207694_10000001203 | 244 |
| 266 | 3300025924 | Ga0207694_10000015 | Ga0207694_10000015240 | 244 |
| 267 | 3300025924 | Ga0207694_10001176 | Ga0207694_1000117621 | 244 |
| 268 | 3300025924 | Ga0207694_10053508 | Ga0207694_100535082 | 244 |
| 269 | 3300025924 | Ga0207694_10059827 | Ga0207694_100598272 | 244 |
| 270 | 3300025924 | Ga0207694_10155930 | Ga0207694_101559302 | 244 |
| 271 | 3300025927 | Ga0207687_10115422 | Ga0207687_101154222 | 244 |
| 272 | 3300025931 | Ga0207644_10044935 | Ga0207644_100449352 | 244 |
| 273 | 3300025940 | Ga0207691_10007845 | Ga0207691_100078452 | 244 |
| 274 | 3300025941 | Ga0207711_10064416 | Ga0207711_100644164 | 244 |
| 275 | 3300025942 | Ga0207689_10003619 | Ga0207689_1000361913 | 244 |
| 276 | 3300025949 | Ga0207667_10000226 | Ga0207667_1000022664 | 244 |
| 277 | 3300025949 | Ga0207667_10000688 | Ga0207667_100006885 | 244 |
| 278 | 3300025949 | Ga0207667_10003918 | Ga0207667_1000391810 | 244 |
| 279 | 3300025949 | Ga0207667_10132389 | Ga0207667_101323892 | 244 |
| 280 | 3300025949 | Ga0207667_10327534 | Ga0207667_103275342 | 244 |
| 281 | 3300025949 | Ga0207667_10375802 | Ga0207667_103758022 | 244 |
| 282 | 3300025961 | Ga0207712_10175889 | Ga0207712_101758892 | 244 |
| 283 | 3300025961 | Ga0207712_10276519 | Ga0207712_102765191 | 244 |
| 284 | 3300025981 | Ga0207640_10002705 | Ga0207640_100027055 | 244 |
| 285 | 3300025981 | Ga0207640_10014260 | Ga0207640_100142602 | 244 |
| 286 | 3300026035 | Ga0207703_10000710 | Ga0207703_100007108 | 244 |
| 287 | 3300026035 | Ga0207703_10168903 | Ga0207703_101689031 | 244 |
| 288 | 3300026067 | Ga0207678_10613079 | Ga0207678_106130792 | 244 |
| 289 | 3300026075 | Ga0207708_10121825 | Ga0207708_101218253 | 244 |
| 290 | 3300026088 | Ga0207641_10023082 | Ga0207641_100230823 | 244 |
| 291 | 3300026095 | Ga0207676_10392694 | Ga0207676_103926941 | 244 |
| 292 | 3300026116 | Ga0207674_10220479 | Ga0207674_102204792 | 244 |
| 293 | 3300026118 | Ga0207675_100004808 | Ga0207675_10000480811 | 244 |
| 294 | 3300026121 | Ga0207683_10110751 | Ga0207683_101107512 | 244 |
| 295 | 3300026142 | Ga0207698_10012397 | Ga0207698_100123977 | 244 |
| 296 | 3300027907 | Ga0207428_10029491 | Ga0207428_100294912 | 244 |
| 297 | 3300027907 | Ga0207428_10069116 | Ga0207428_100691161 | 244 |
| 298 | 3300027907 | Ga0207428_10092807 | Ga0207428_100928071 | 244 |
| 299 | 3300028379 | Ga0268266_10002620 | Ga0268266_100026202 | 244 |
| 300 | 3300028379 | Ga0268266_10050625 | Ga0268266_100506254 | 244 |
| 301 | 3300028379 | Ga0268266_10056862 | Ga0268266_100568623 | 244 |
| 302 | 3300028379 | Ga0268266_10410715 | Ga0268266_104107152 | 244 |
| 303 | 3300028381 | Ga0268264_10120370 | Ga0268264_101203702 | 244 |
| 304 | 3300028563 | Ga0265319_1000750 | Ga0265319_100075022 | 244 |
| 305 | 3300028573 | Ga0265334_10000308 | Ga0265334_1000030816 | 244 |
| 306 | 3300028573 | Ga0265334_10004009 | Ga0265334_100040094 | 244 |
| 307 | 3300028577 | Ga0265318_10001385 | Ga0265318_100013857 | 244 |
| 308 | 3300028577 | Ga0265318_10005572 | Ga0265318_100055722 | 244 |
| 309 | 3300028577 | Ga0265318_10026473 | Ga0265318_100264732 | 244 |
| 310 | 3300028577 | Ga0265318_10029488 | Ga0265318_100294884 | 244 |
| 311 | 3300028794 | Ga0307515_10020150 | Ga0307515_100201504 | 244 |
| 312 | 3300028794 | Ga0307515_10122194 | Ga0307515_101221942 | 244 |
| 313 | 3300028800 | Ga0265338_10000014 | Ga0265338_10000014209 | 244 |
| 314 | 3300028800 | Ga0265338_10029945 | Ga0265338_100299454 | 244 |
| 315 | 3300028800 | Ga0265338_10152419 | Ga0265338_101524192 | 244 |
| 316 | 3300029957 | Ga0265324_10020438 | Ga0265324_100204383 | 244 |
| 317 | 3300030522 | Ga0307512_10017920 | Ga0307512_100179209 | 244 |
| 318 | 3300030760 | Ga0265762_1004864 | Ga0265762_10048642 | 244 |
| 319 | 3300031235 | Ga0265330_10001572 | Ga0265330_1000157212 | 244 |
| 320 | 3300031235 | Ga0265330_10036303 | Ga0265330_100363031 | 244 |
| 321 | 3300031238 | Ga0265332_10002126 | Ga0265332_100021267 | 244 |
| 322 | 3300031238 | Ga0265332_10067061 | Ga0265332_100670612 | 244 |
| 323 | 3300031239 | Ga0265328_10001332 | Ga0265328_100013327 | 244 |
| 324 | 3300031239 | Ga0265328_10001639 | Ga0265328_100016397 | 244 |
| 325 | 3300031240 | Ga0265320_10001040 | Ga0265320_100010402 | 244 |
| 326 | 3300031240 | Ga0265320_10005672 | Ga0265320_100056729 | 244 |
| 327 | 3300031240 | Ga0265320_10029550 | Ga0265320_100295502 | 244 |
| 328 | 3300031240 | Ga0265320_10048377 | Ga0265320_100483772 | 244 |
| 329 | 3300031241 | Ga0265325_10000388 | Ga0265325_1000038816 | 244 |
| 330 | 3300031242 | Ga0265329_10002535 | Ga0265329_1000253510 | 244 |
| 331 | 3300031242 | Ga0265329_10003575 | Ga0265329_100035758 | 244 |
| 332 | 3300031242 | Ga0265329_10010487 | Ga0265329_100104872 | 244 |
| 333 | 3300031247 | Ga0265340_10011964 | Ga0265340_100119642 | 244 |
| 334 | 3300031247 | Ga0265340_10055087 | Ga0265340_100550872 | 244 |
| 335 | 3300031247 | Ga0265340_10057668 | Ga0265340_100576682 | 244 |
| 336 | 3300031249 | Ga0265339_10000534 | Ga0265339_100005345 | 244 |
| 337 | 3300031250 | Ga0265331_10000252 | Ga0265331_1000025240 | 244 |
| 338 | 3300031250 | Ga0265331_10008114 | Ga0265331_100081147 | 244 |
| 339 | 3300031250 | Ga0265331_10013733 | Ga0265331_100137335 | 244 |
| 340 | 3300031250 | Ga0265331_10067829 | Ga0265331_100678292 | 244 |
| 341 | 3300031250 | Ga0265331_10116463 | Ga0265331_101164632 | 244 |
| 342 | 3300031251 | Ga0265327_10000183 | Ga0265327_1000018376 | 244 |
| 343 | 3300031344 | Ga0265316_10001882 | Ga0265316_100018827 | 244 |
| 344 | 3300031344 | Ga0265316_10006557 | Ga0265316_100065579 | 244 |
| 345 | 3300031456 | Ga0307513_10026610 | Ga0307513_100266107 | 244 |
| 346 | 3300031456 | Ga0307513_10552971 | Ga0307513_105529711 | 244 |
| 347 | 3300031595 | Ga0265313_10006426 | Ga0265313_1000642611 | 244 |
| 348 | 3300031595 | Ga0265313_10057557 | Ga0265313_100575572 | 244 |
| 349 | 3300031711 | Ga0265314_10000043 | Ga0265314_1000004317 | 244 |
| 350 | 3300031711 | Ga0265314_10001942 | Ga0265314_1000194215 | 244 |
| 351 | 3300031711 | Ga0265314_10002243 | Ga0265314_100022434 | 244 |
| 352 | 3300031711 | Ga0265314_10012226 | Ga0265314_100122265 | 244 |
| 353 | 3300031711 | Ga0265314_10049398 | Ga0265314_100493982 | 244 |
| 354 | 3300031711 | Ga0265314_10053536 | Ga0265314_100535363 | 244 |
| 355 | 3300031712 | Ga0265342_10005121 | Ga0265342_100051217 | 244 |
| 356 | 3300031712 | Ga0265342_10008932 | Ga0265342_100089325 | 244 |
| 357 | 3300031712 | Ga0265342_10012276 | Ga0265342_100122763 | 244 |
| 358 | 3300031730 | Ga0307516_10005053 | Ga0307516_1000505314 | 244 |
| 359 | 3300031730 | Ga0307516_10016154 | Ga0307516_100161542 | 244 |
| 360 | 3300031852 | Ga0307410_10118357 | Ga0307410_101183572 | 244 |
| 361 | 3300032004 | Ga0307414_10008633 | Ga0307414_100086332 | 244 |
| 362 | 3300032004 | Ga0307414_10035873 | Ga0307414_100358734 | 244 |
| 363 | 3300033179 | Ga0307507_10042544 | Ga0307507_100425444 | 244 |
| 364 | 3300033179 | Ga0307507_10147089 | Ga0307507_101470892 | 244 |
| 365 | 3300033180 | Ga0307510_10000018 | Ga0307510_1000001845 | 244 |
| 366 | 3300035113 | Ga0373936_0002624 | Ga0373936_0002624_5243_5986 | 244 |
| 367 | 3300035113 | Ga0373936_0009499 | Ga0373936_0009499_2072_2821 | 244 |
| 368 | 3300035117 | Ga0373953_0094684 | Ga0373953_0094684_442_1176 | 244 |
| 369 | 3300037068 | Ga0373925_0000780 | Ga0373925_0000780_24422_25156 | 244 |
| 370 | 3300037471 | Ga0395905_0068027 | Ga0395905_0068027_1670_2413 | 244 |
| 371 | 3300037471 | Ga0395905_0120819 | Ga0395905_0120819_238_972 | 244 |
| 372 | 3300041413 | Ga0439465_0008357 | Ga0439465_0008357_2106_2849 | 244 |
| 373 | 3300041491 | Ga0451833_0539360 | Ga0451833_0539360_104_844 | 244 |
| 374 | 3300042184 | Ga0450908_002335 | Ga0450908_002335_415_1158 | 244 |
| 375 | 3300046452 | Ga0495617_000007 | Ga0495617_000007_94937_95692 | 244 |
| 376 | 3300046452 | Ga0495617_000019 | Ga0495617_000019_26150_26893 | 244 |
| 377 | 3300046453 | Ga0495627_002755 | Ga0495627_002755_7276_8025 | 244 |
| 378 | 3300046454 | Ga0495592_0002444 | Ga0495592_0002444_4625_5368 | 244 |
| 379 | 3300046455 | Ga0495603_0048088 | Ga0495603_0048088_113_856 | 244 |
| 380 | 3300046458 | Ga0495591_002495 | Ga0495591_002495_2881_3630 | 244 |
| 381 | 3300046458 | Ga0495591_002907 | Ga0495591_002907_2676_3419 | 244 |
| 382 | 3300046459 | Ga0495629_0037008 | Ga0495629_0037008_852_1595 | 244 |
| 383 | 3300046459 | Ga0495629_0168384 | Ga0495629_0168384_447_1190 | 244 |
| 384 | 3300046460 | Ga0495638_0040488 | Ga0495638_0040488_1818_2561 | 244 |
| 385 | 3300046461 | Ga0495641_0139985 | Ga0495641_0139985_121_864 | 244 |
| 386 | 3300046462 | Ga0495651_0011212 | Ga0495651_0011212_3408_4157 | 244 |
| 387 | 3300046462 | Ga0495651_0017288 | Ga0495651_0017288_3184_3927 | 244 |
| 388 | 3300046462 | Ga0495651_0042368 | Ga0495651_0042368_753_1496 | 244 |
| 389 | 3300046463 | Ga0495653_0096514 | Ga0495653_0096514_419_1162 | 244 |
| 390 | 3300046463 | Ga0495653_0287174 | Ga0495653_0287174_312_1055 | 244 |
| 391 | 3300046471 | Ga0495650_0002151 | Ga0495650_0002151_13294_14049 | 244 |
| 392 | 3300046471 | Ga0495650_0017329 | Ga0495650_0017329_2004_2753 | 244 |
| 393 | 3300046471 | Ga0495650_0104766 | Ga0495650_0104766_229_963 | 244 |
| 394 | 3300046472 | Ga0495580_0004420 | Ga0495580_0004420_9549_10292 | 244 |
| 395 | 3300046472 | Ga0495580_0020357 | Ga0495580_0020357_920_1663 | 244 |
| 396 | 3300046476 | Ga0495662_0098974 | Ga0495662_0098974_83_826 | 244 |
| 397 | 3300046476 | Ga0495662_0110777 | Ga0495662_0110777_469_1212 | 244 |
| 398 | 3300046477 | Ga0495664_0110844 | Ga0495664_0110844_726_1469 | 244 |
| 399 | 3300046499 | Ga0495594_0027403 | Ga0495594_0027403_398_1147 | 244 |
| 400 | 3300046500 | Ga0495596_0004482 | Ga0495596_0004482_2402_3145 | 244 |
| 401 | 3300046501 | Ga0495607_0006912 | Ga0495607_0006912_2115_2858 | 244 |
| 402 | 3300046501 | Ga0495607_0090686 | Ga0495607_0090686_816_1559 | 244 |
| 403 | 3300046506 | Ga0495583_0000007 | Ga0495583_0000007_426478_427227 | 244 |
| 404 | 3300046507 | Ga0495606_0000129 | Ga0495606_0000129_53772_54527 | 244 |
| 405 | 3300046507 | Ga0495606_0000905 | Ga0495606_0000905_26483_27226 | 244 |
| 406 | 3300046507 | Ga0495606_0002750 | Ga0495606_0002750_2051_2800 | 244 |
| 407 | 3300046507 | Ga0495606_0056820 | Ga0495606_0056820_906_1649 | 244 |
| 408 | 3300046511 | Ga0495608_0024678 | Ga0495608_0024678_2222_2965 | 244 |
| 409 | 3300046512 | Ga0495610_0000004 | Ga0495610_0000004_523799_524554 | 244 |
| 410 | 3300046512 | Ga0495610_0019796 | Ga0495610_0019796_1235_1984 | 244 |
| 411 | 3300046514 | Ga0495618_0011633 | Ga0495618_0011633_4476_5219 | 244 |
| 412 | 3300046515 | Ga0495620_0001004 | Ga0495620_0001004_14001_14744 | 244 |
| 413 | 3300046516 | Ga0495628_0078895 | Ga0495628_0078895_359_1102 | 244 |
| 414 | 3300046516 | Ga0495628_0293532 | Ga0495628_0293532_23_766 | 244 |
| 415 | 3300046517 | Ga0495630_0035317 | Ga0495630_0035317_1972_2715 | 244 |
| 416 | 3300046517 | Ga0495630_0058223 | Ga0495630_0058223_580_1323 | 244 |
| 417 | 3300046518 | Ga0495631_0020910 | Ga0495631_0020910_1367_2116 | 244 |
| 418 | 3300046519 | Ga0495632_0054441 | Ga0495632_0054441_522_1265 | 244 |
| 419 | 3300046522 | Ga0495643_0044006 | Ga0495643_0044006_965_1699 | 244 |
| 420 | 3300046524 | Ga0495648_0006062 | Ga0495648_0006062_2202_2957 | 244 |
| 421 | 3300046524 | Ga0495648_0031022 | Ga0495648_0031022_2344_3087 | 244 |
| 422 | 3300046526 | Ga0495666_0015692 | Ga0495666_0015692_200_943 | 244 |
| 423 | 3300046526 | Ga0495666_0134458 | Ga0495666_0134458_80_823 | 244 |
| 424 | 3300046529 | Ga0495652_0240150 | Ga0495652_0240150_567_1310 | 244 |
| 425 | 3300046529 | Ga0495652_0549058 | Ga0495652_0549058_31_774 | 244 |
| 426 | 3300046530 | Ga0495654_0000975 | Ga0495654_0000975_7343_8092 | 244 |
| 427 | 3300046530 | Ga0495654_0002324 | Ga0495654_0002324_7425_8180 | 244 |
| 428 | 3300046533 | Ga0495640_0009180 | Ga0495640_0009180_1952_2695 | 244 |
| 429 | 3300046533 | Ga0495640_0022843 | Ga0495640_0022843_3609_4358 | 244 |
| 430 | 3300046536 | Ga0495587_0006150 | Ga0495587_0006150_265_1008 | 244 |
| 431 | 3300046538 | Ga0495609_0000004 | Ga0495609_0000004_475602_476351 | 244 |
| 432 | 3300046542 | Ga0495597_0003675 | Ga0495597_0003675_628_1377 | 244 |
| 433 | 3300046543 | Ga0495645_0066573 | Ga0495645_0066573_782_1525 | 244 |
| 434 | 3300046557 | Ga0495622_0006457 | Ga0495622_0006457_4261_5004 | 244 |
| 435 | 3300046557 | Ga0495622_0016684 | Ga0495622_0016684_1605_2354 | 244 |
| 436 | 3300046559 | Ga0495667_0307888 | Ga0495667_0307888_186_929 | 244 |
| 437 | 3300046616 | Ga0495668_0000617 | Ga0495668_0000617_6878_7633 | 244 |
| 438 | 3300046642 | Ga0495634_0042858 | Ga0495634_0042858_1634_2377 | 244 |
| 439 | 3300046642 | Ga0495634_0061471 | Ga0495634_0061471_1492_2241 | 244 |
| 440 | 3300046660 | Ga0495625_0003058 | Ga0495625_0003058_11124_11858 | 244 |
| 441 | 3300046660 | Ga0495625_0014499 | Ga0495625_0014499_797_1531 | 244 |
| 442 | 3300046660 | Ga0495625_0070366 | Ga0495625_0070366_729_1472 | 244 |
| 443 | 3300046663 | Ga0495635_0006042 | Ga0495635_0006042_3751_4500 | 244 |
| 444 | 3300046663 | Ga0495635_0071469 | Ga0495635_0071469_724_1467 | 244 |
| 445 | 3300046665 | Ga0495661_0000005 | Ga0495661_0000005_232165_232914 | 244 |
| 446 | 3300046665 | Ga0495661_0050021 | Ga0495661_0050021_626_1369 | 244 |
| 447 | 3300046675 | Ga0495657_0087334 | Ga0495657_0087334_98_841 | 244 |
| 448 | 3300046678 | Ga0495599_0017237 | Ga0495599_0017237_895_1638 | 244 |
| 449 | 3300046679 | Ga0495623_0024468 | Ga0495623_0024468_779_1522 | 244 |
| 450 | 3300046680 | Ga0495646_0253677 | Ga0495646_0253677_23_766 | 244 |
| 451 | 3300046689 | Ga0495613_0018759 | Ga0495613_0018759_2600_3343 | 244 |
| 452 | 3300046689 | Ga0495613_0062229 | Ga0495613_0062229_966_1715 | 244 |
| 453 | 3300046690 | Ga0495624_0001660 | Ga0495624_0001660_14801_15544 | 244 |
| 454 | 3300046690 | Ga0495624_0082711 | Ga0495624_0082711_900_1649 | 244 |
| 455 | 3300046691 | Ga0495670_0019459 | Ga0495670_0019459_2174_2923 | 244 |
| 456 | 3300046692 | Ga0495671_0000149 | Ga0495671_0000149_4257_5012 | 244 |
| 457 | 3300046692 | Ga0495671_0007514 | Ga0495671_0007514_725_1474 | 244 |
| 458 | 3300046694 | Ga0495649_0000120 | Ga0495649_0000120_16837_17580 | 244 |
| 459 | 3300046694 | Ga0495649_0018977 | Ga0495649_0018977_1935_2678 | 244 |
| 460 | 3300046794 | Ga0495589_0013524 | Ga0495589_0013524_1798_2547 | 244 |
| 461 | 3300046794 | Ga0495589_0150735 | Ga0495589_0150735_165_914 | 244 |
| 462 | 3300046809 | Ga0495600_0016310 | Ga0495600_0016310_1163_1906 | 244 |
| 463 | 3300046809 | Ga0495600_0020333 | Ga0495600_0020333_2921_3670 | 244 |
| 464 | 3300046809 | Ga0495600_0179024 | Ga0495600_0179024_572_1315 | 244 |
| 465 | 3300046810 | Ga0495660_0002670 | Ga0495660_0002670_7251_8000 | 244 |
| 466 | 3300046810 | Ga0495660_0004430 | Ga0495660_0004430_1263_2018 | 244 |
| 467 | 3300047315 | Ga0495581_0165908 | Ga0495581_0165908_438_1181 | 244 |
| 468 | 3300047317 | Ga0495604_0003124 | Ga0495604_0003124_2706_3449 | 244 |
| 469 | 3300047317 | Ga0495604_0021114 | Ga0495604_0021114_2487_3236 | 244 |
| 470 | 3300047317 | Ga0495604_0047208 | Ga0495604_0047208_117_860 | 244 |
| 471 | 3300047319 | Ga0495674_0068531 | Ga0495674_0068531_692_1435 | 244 |
| 472 | 3300047320 | Ga0495672_0085495 | Ga0495672_0085495_899_1642 | 244 |
| 473 | 3300047321 | Ga0495676_0064798 | Ga0495676_0064798_247_996 | 244 |
| 474 | 3300047322 | Ga0495680_0007407 | Ga0495680_0007407_7385_8128 | 244 |
| 475 | 3300047322 | Ga0495680_0125777 | Ga0495680_0125777_383_1126 | 244 |
| 476 | 3300047323 | Ga0495683_0008864 | Ga0495683_0008864_2834_3577 | 244 |
| 477 | 3300047443 | Ga0495687_001114 | Ga0495687_001114_19480_20223 | 244 |
| 478 | 3300047444 | Ga0495675_0019041 | Ga0495675_0019041_566_1309 | 244 |
| 479 | 3300047444 | Ga0495675_0112200 | Ga0495675_0112200_32_775 | 244 |
| 480 | 3300047444 | Ga0495675_0323820 | Ga0495675_0323820_40_774 | 244 |
| 481 | 3300047446 | Ga0495679_002387 | Ga0495679_002387_3231_3974 | 244 |
| 482 | 3300047446 | Ga0495679_004802 | Ga0495679_004802_1553_2308 | 244 |
| 483 | 3300047446 | Ga0495679_023074 | Ga0495679_023074_789_1544 | 244 |
| 484 | 3300047469 | Ga0495673_0000017 | Ga0495673_0000017_193766_194521 | 244 |
| 485 | 3300047469 | Ga0495673_0033596 | Ga0495673_0033596_750_1493 | 244 |
| 486 | 3300047471 | Ga0495684_0074463 | Ga0495684_0074463_166_909 | 244 |
| 487 | 3300047472 | Ga0495686_0000198 | Ga0495686_0000198_33600_34343 | 244 |
| 488 | 3300047472 | Ga0495686_0000333 | Ga0495686_0000333_73012_73767 | 244 |
| 489 | 3300047472 | Ga0495686_0000710 | Ga0495686_0000710_13007_13741 | 244 |
| 490 | 3300047472 | Ga0495686_0001821 | Ga0495686_0001821_18901_19644 | 244 |
| 491 | 3300047472 | Ga0495686_0018020 | Ga0495686_0018020_1992_2735 | 244 |
| 492 | 3300047472 | Ga0495686_0074741 | Ga0495686_0074741_18_752 | 244 |
| 493 | 3300047472 | Ga0495686_0080841 | Ga0495686_0080841_44_799 | 244 |
| 494 | 3300047472 | Ga0495686_0092259 | Ga0495686_0092259_213_968 | 244 |
| 495 | 3300047472 | Ga0495686_0195305 | Ga0495686_0195305_16_759 | 244 |
| 496 | 3300047673 | Ga0495593_0012574 | Ga0495593_0012574_2950_3693 | 244 |
| 497 | 3300047673 | Ga0495593_0048003 | Ga0495593_0048003_1053_1802 | 244 |
| 498 | 3300048088 | Ga0495602_0087443 | Ga0495602_0087443_935_1678 | 244 |
| 499 | 3300048088 | Ga0495602_0194032 | Ga0495602_0194032_132_875 | 244 |
| 500 | 3300048088 | Ga0495602_0531848 | Ga0495602_0531848_18_767 | 244 |
| 501 | 3300048089 | Ga0495614_0007913 | Ga0495614_0007913_2817_3560 | 244 |
| 502 | 3300048903 | Ga0496100_0000408 | Ga0496100_0000408_19017_19760 | 244 |
| 503 | 3300048903 | Ga0496100_0003995 | Ga0496100_0003995_1819_2571 | 244 |
| 504 | 3300048903 | Ga0496100_0030135 | Ga0496100_0030135_1584_2318 | 244 |
| 505 | 3300048903 | Ga0496100_0655582 | Ga0496100_0655582_35_769 | 244 |
| 506 | 3300048904 | Ga0496101_0000237 | Ga0496101_0000237_10348_11100 | 244 |
| 507 | 3300048904 | Ga0496101_0000741 | Ga0496101_0000741_17464_18207 | 244 |
| 508 | 3300048905 | Ga0496102_0000007 | Ga0496102_0000007_117766_118518 | 244 |
| 509 | 3300048905 | Ga0496102_0000675 | Ga0496102_0000675_15961_16704 | 244 |
| 510 | 3300048905 | Ga0496102_0074271 | Ga0496102_0074271_1072_1815 | 244 |
| 511 | 3300048905 | Ga0496102_0142798 | Ga0496102_0142798_557_1300 | 244 |
| 512 | 3300048906 | Ga0496103_0000071 | Ga0496103_0000071_1408_2160 | 244 |
| 513 | 3300048906 | Ga0496103_0001123 | Ga0496103_0001123_16021_16764 | 244 |
| 514 | 3300048906 | Ga0496103_0067581 | Ga0496103_0067581_118_861 | 244 |
| 515 | 3300048907 | Ga0496104_0006567 | Ga0496104_0006567_689_1432 | 244 |
| 516 | 3300048907 | Ga0496104_0113893 | Ga0496104_0113893_566_1315 | 244 |
| 517 | 3300048908 | Ga0496105_0001384 | Ga0496105_0001384_3980_4729 | 244 |
| 518 | 3300048908 | Ga0496105_0002949 | Ga0496105_0002949_1374_2117 | 244 |
| 519 | 3300048908 | Ga0496105_0125315 | Ga0496105_0125315_1322_2056 | 244 |
| 520 | 3300048910 | Ga0496107_0027099 | Ga0496107_0027099_2411_3163 | 244 |
| 521 | 3300048910 | Ga0496107_0089835 | Ga0496107_0089835_254_988 | 244 |
| 522 | 3300048913 | Ga0496110_0046248 | Ga0496110_0046248_913_1656 | 244 |
| 523 | 3300048915 | Ga0496112_0056946 | Ga0496112_0056946_1097_1840 | 244 |
| 524 | 3300048915 | Ga0496112_0148415 | Ga0496112_0148415_1252_1995 | 244 |
| 525 | 3300048915 | Ga0496112_0153010 | Ga0496112_0153010_1168_1902 | 244 |
| 526 | 3300048916 | Ga0496113_0060153 | Ga0496113_0060153_833_1582 | 244 |
| 527 | 3300048918 | Ga0496115_0000013 | Ga0496115_0000013_195763_196506 | 244 |
| 528 | 3300048918 | Ga0496115_0001836 | Ga0496115_0001836_6852_7586 | 244 |
| 529 | 3300048918 | Ga0496115_0203976 | Ga0496115_0203976_237_986 | 244 |
| 530 | 3300048918 | Ga0496115_0339004 | Ga0496115_0339004_102_845 | 244 |
| 531 | 3300048919 | Ga0496116_0000033 | Ga0496116_0000033_299653_300405 | 244 |
| 532 | 3300048919 | Ga0496116_0004586 | Ga0496116_0004586_9873_10607 | 244 |
| 533 | 3300048919 | Ga0496116_0012188 | Ga0496116_0012188_2199_2942 | 244 |
| 534 | 3300048919 | Ga0496116_0019853 | Ga0496116_0019853_3282_4025 | 244 |
| 535 | 3300048919 | Ga0496116_0050759 | Ga0496116_0050759_470_1249 | 244 |
| 536 | 3300048919 | Ga0496116_0144325 | Ga0496116_0144325_279_1031 | 244 |
| 537 | 3300048920 | Ga0496117_0000025 | Ga0496117_0000025_299583_300335 | 244 |
| 538 | 3300048920 | Ga0496117_0001301 | Ga0496117_0001301_18521_19264 | 244 |
| 539 | 3300048920 | Ga0496117_0006113 | Ga0496117_0006113_5542_6285 | 244 |
| 540 | 3300048920 | Ga0496117_0023459 | Ga0496117_0023459_2536_3279 | 244 |
| 541 | 3300048921 | Ga0496118_0000023 | Ga0496118_0000023_117772_118524 | 244 |
| 542 | 3300048921 | Ga0496118_0000928 | Ga0496118_0000928_16999_17742 | 244 |
| 543 | 3300048921 | Ga0496118_0001539 | Ga0496118_0001539_15946_16689 | 244 |
| 544 | 3300048921 | Ga0496118_0002320 | Ga0496118_0002320_14733_15467 | 244 |
| 545 | 3300048921 | Ga0496118_0003433 | Ga0496118_0003433_16405_17148 | 244 |
| 546 | 3300048921 | Ga0496118_0003510 | Ga0496118_0003510_15358_16092 | 244 |
| 547 | 3300048921 | Ga0496118_0068921 | Ga0496118_0068921_1637_2380 | 244 |
| 548 | 3300048921 | Ga0496118_0206669 | Ga0496118_0206669_157_891 | 244 |
| 549 | 3300048921 | Ga0496118_0232324 | Ga0496118_0232324_175_918 | 244 |
| 550 | 3300048922 | Ga0496119_0000708 | Ga0496119_0000708_31727_32461 | 244 |
| 551 | 3300048922 | Ga0496119_0001159 | Ga0496119_0001159_21893_22645 | 244 |
| 552 | 3300048922 | Ga0496119_0006900 | Ga0496119_0006900_6523_7266 | 244 |
| 553 | 3300048922 | Ga0496119_0014245 | Ga0496119_0014245_5095_5838 | 244 |
| 554 | 3300048922 | Ga0496119_0031328 | Ga0496119_0031328_830_1573 | 244 |
| 555 | 3300048922 | Ga0496119_0197038 | Ga0496119_0197038_85_828 | 244 |
| 556 | 3300048923 | Ga0496120_0000281 | Ga0496120_0000281_64095_64847 | 244 |
| 557 | 3300048923 | Ga0496120_0021522 | Ga0496120_0021522_1798_2547 | 244 |
| 558 | 3300048923 | Ga0496120_0023864 | Ga0496120_0023864_1417_2160 | 244 |
| 559 | 3300048923 | Ga0496120_0092308 | Ga0496120_0092308_327_1070 | 244 |
| 560 | 3300048924 | Ga0496121_0000168 | Ga0496121_0000168_25279_26028 | 244 |
| 561 | 3300048924 | Ga0496121_0000642 | Ga0496121_0000642_28443_29195 | 244 |
| 562 | 3300048924 | Ga0496121_0000993 | Ga0496121_0000993_45785_46528 | 244 |
| 563 | 3300048924 | Ga0496121_0001151 | Ga0496121_0001151_36373_37122 | 244 |
| 564 | 3300048924 | Ga0496121_0001605 | Ga0496121_0001605_18502_19245 | 244 |
| 565 | 3300048924 | Ga0496121_0025389 | Ga0496121_0025389_773_1516 | 244 |
| 566 | 3300048924 | Ga0496121_0048199 | Ga0496121_0048199_1549_2283 | 244 |
| 567 | 3300048924 | Ga0496121_0065636 | Ga0496121_0065636_371_1114 | 244 |
| 568 | 3300048924 | Ga0496121_0069065 | Ga0496121_0069065_2069_2812 | 244 |
| 569 | 3300048924 | Ga0496121_0084224 | Ga0496121_0084224_145_888 | 244 |
| 570 | 3300048924 | Ga0496121_0103486 | Ga0496121_0103486_615_1364 | 244 |
| 571 | 3300048924 | Ga0496121_0152393 | Ga0496121_0152393_237_971 | 244 |
| 572 | 3300048924 | Ga0496121_0335274 | Ga0496121_0335274_167_901 | 244 |
| 573 | 3300048924 | Ga0496121_0423608 | Ga0496121_0423608_109_852 | 244 |
| 574 | 3300048925 | Ga0496122_0000261 | Ga0496122_0000261_12255_12989 | 244 |
| 575 | 3300048925 | Ga0496122_0014428 | Ga0496122_0014428_685_1434 | 244 |
| 576 | 3300048925 | Ga0496122_0034521 | Ga0496122_0034521_53_787 | 244 |
| 577 | 3300048925 | Ga0496122_0067349 | Ga0496122_0067349_1705_2448 | 244 |
| 578 | 3300048926 | Ga0496123_0000218 | Ga0496123_0000218_9816_10550 | 244 |
| 579 | 3300048926 | Ga0496123_0286750 | Ga0496123_0286750_21_764 | 244 |
| 580 | 3300048927 | Ga0496124_0002073 | Ga0496124_0002073_26055_26810 | 244 |
| 581 | 3300048927 | Ga0496124_0029645 | Ga0496124_0029645_2971_3714 | 244 |
| 582 | 3300048927 | Ga0496124_0037817 | Ga0496124_0037817_3394_4137 | 244 |
| 583 | 3300048928 | Ga0496125_0000312 | Ga0496125_0000312_91475_92218 | 244 |
| 584 | 3300048928 | Ga0496125_0000766 | Ga0496125_0000766_1883_2617 | 244 |
| 585 | 3300048928 | Ga0496125_0024470 | Ga0496125_0024470_1029_1772 | 244 |
| 586 | 3300048928 | Ga0496125_0154936 | Ga0496125_0154936_292_1026 | 244 |
| 587 | 3300048928 | Ga0496125_0273019 | Ga0496125_0273019_61_804 | 244 |
| 588 | 3300048929 | Ga0496126_0000189 | Ga0496126_0000189_12860_13612 | 244 |
| 589 | 3300048929 | Ga0496126_0022212 | Ga0496126_0022212_3320_4069 | 244 |
| 590 | 3300048929 | Ga0496126_0028662 | Ga0496126_0028662_1032_1775 | 244 |
| 591 | 3300048929 | Ga0496126_0030259 | Ga0496126_0030259_3328_4209 | 244 |
| 592 | 3300048929 | Ga0496126_0040617 | Ga0496126_0040617_3398_4141 | 244 |
| 593 | 3300048929 | Ga0496126_0067880 | Ga0496126_0067880_872_1606 | 244 |
| 594 | 3300048929 | Ga0496126_0226165 | Ga0496126_0226165_193_936 | 244 |
| 595 | 3300048929 | Ga0496126_0374912 | Ga0496126_0374912_333_1082 | 244 |
| 596 | 3300049460 | Ga0495682_0000428 | Ga0495682_0000428_9111_9854 | 244 |
| 597 | 3300049460 | Ga0495682_0000711 | Ga0495682_0000711_16085_16834 | 244 |
| 598 | 3300049568 | Ga0501031_0059763 | Ga0501031_0059763_105_854 | 244 |
| 599 | 3300049569 | Ga0501032_0258839 | Ga0501032_0258839_322_1071 | 244 |
| 600 | 3300049570 | Ga0501033_0047542 | Ga0501033_0047542_1576_2310 | 244 |
| 601 | 3300049571 | Ga0501034_0223576 | Ga0501034_0223576_1085_1819 | 244 |
| 602 | 3300049822 | Ga0501035_0064778 | Ga0501035_0064778_83_817 | 244 |
| 603 | 3300049823 | Ga0501044_0010325 | Ga0501044_0010325_7819_8553 | 244 |
| 604 | 3300050492 | nmdc:mga0yw44_1193_c1 | nmdc:mga0yw44_1193_c1_1472_2215 | 244 |
| 605 | 3300050493 | nmdc:mga0k408_155364_c1 | nmdc:mga0k408_155364_c1_361_1095 | 244 |
| 606 | 3300050494 | nmdc:mga06z11_108975_c1 | nmdc:mga06z11_108975_c1_521_1264 | 244 |
| 607 | 3300050496 | nmdc:mga07m45_52153_c1 | nmdc:mga07m45_52153_c1_254_988 | 244 |
| 608 | 3300050516 | nmdc:mga0sz30_39984_c1 | nmdc:mga0sz30_39984_c1_528_1280 | 244 |
| 609 | 3300053085 | Ga0495619_0203053 | Ga0495619_0203053_61_954 | 244 |
| 610 | 3300053087 | Ga0500643_001483 | Ga0500643_001483_11255_11998 | 244 |
| 611 | 3300053087 | Ga0500643_012565 | Ga0500643_012565_574_1308 | 244 |
| 612 | 3300053088 | Ga0500644_0088354 | Ga0500644_0088354_403_1137 | 244 |
| 613 | 3300053093 | Ga0500651_0008177 | Ga0500651_0008177_5387_6121 | 244 |
| 614 | 3300053094 | Ga0500566_0005153 | Ga0500566_0005153_3263_3997 | 244 |
| 615 | 3300053115 | Ga0500591_105769 | Ga0500591_105769_381_1124 | 244 |
| 616 | 3300053119 | Ga0500595_001400 | Ga0500595_001400_5751_6485 | 244 |
| 617 | 3300053120 | Ga0500597_000296 | Ga0500597_000296_7193_7927 | 244 |
| 618 | 3300053122 | Ga0500608_001747 | Ga0500608_001747_6639_7382 | 244 |
| 619 | 3300053133 | Ga0500655_008745 | Ga0500655_008745_138_881 | 244 |
| 620 | 3300053136 | Ga0500559_0000006 | Ga0500559_0000006_196040_196774 | 244 |
| 621 | 3300053136 | Ga0500559_0017817 | Ga0500559_0017817_667_1401 | 244 |
| 622 | 3300053136 | Ga0500559_0028952 | Ga0500559_0028952_565_1314 | 244 |
| 623 | 3300053136 | Ga0500559_0111707 | Ga0500559_0111707_191_925 | 244 |
| 624 | 3300053148 | Ga0500590_000200 | Ga0500590_000200_437_1330 | 244 |
| 625 | 3300053151 | Ga0500604_0000038 | Ga0500604_0000038_29803_30546 | 244 |
| 626 | 3300053153 | Ga0500616_0000483 | Ga0500616_0000483_41312_42046 | 244 |
| 627 | 3300053156 | Ga0500622_0002675 | Ga0500622_0002675_10407_11150 | 244 |
| 628 | 3300053158 | Ga0500627_0055845 | Ga0500627_0055845_295_1038 | 244 |
| 629 | 3300053161 | Ga0500634_0024950 | Ga0500634_0024950_265_999 | 244 |
| 630 | 3300053178 | Ga0500637_0096758 | Ga0500637_0096758_379_1128 | 244 |
| 631 | 3300053726 | Ga0500584_041143 | Ga0500584_041143_703_1437 | 244 |
| 632 | 3300053730 | Ga0500645_000710 | Ga0500645_000710_1686_2432 | 244 |
| 633 | iso_pu_bacteria | 2884852848 | 2884855487 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4i5d-assembly1.cif.gz_A | crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form | 0.9866 | 1 | 244 |
| 4fgs-assembly1.cif.gz_B | crystal structure of a probable dehydrogenase protein | 0.9865 | 1 | 244 |
| 4bmn-assembly1.cif.gz_B | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9861 | 1 | 244 |
| 4fgs-assembly1.cif.gz_D | crystal structure of a probable dehydrogenase protein | 0.984 | 1 | 244 |
| 4bmn-assembly1.cif.gz_D | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9826 | 1 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4bmnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9722 | 1 | 244 | 3.40.50.720 |
| 4npcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9641 | 2 | 244 | 3.40.50.720 |
| af_C6T421_12_106_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9637 | 2 | 84 | 3.40.50.720 |
| 5itvA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9591 | 1 | 244 | 3.40.50.720 |
| af_I6YCF0_1_258_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9582 | 1 | 237 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7KXK9-F1-model_v4 | deleted | 0.9924 | 1 | 168 |
|
| AF-A0A559M2Z8-F1-model_v4 | Putative oxidoreductase | 0.9906 | 2 | 151 |
GO:0016491
|
| AF-A0A2V6STH1-F1-model_v4 | Oxidoreductase | 0.9893 | 1 | 181 |
GO:0016491
|
| AF-A0A436AKS0-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9891 | 1 | 134 |
GO:0016491
|
| AF-A0A4R7QM76-F1-model_v4 | deleted | 0.9867 | 1 | 186 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar