F471112

General Info

Members Datasets Scaffolds Average Seq Length
633 353 586 246

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0030259|Ga0496126_0030259_3328_4209
Length 293
Sequence MGIIQLDGLINLRPGLDTAGHGAAENKGRRTSFINSFNRSNNMSKLQLEGKIAIITGGSSGIGLATAQRFVAEGAYVFITGRRQSELDKAVELIGANVTAVQGDVSKLADLDRLYATVKATKGRVDVVVANSGIVDPTGIDDVTSEHYDKTFDINAKGLLFTVQKALPLMGKGGAIVLTASIAAVKGMPGYGTYSASKAAVRSFARTWTQELKERGIRVNTLSPGPVDTPIIDTQASDKASADQLRDMFSTMIPLGRMGRPEEVAAAALFLASDESSFVAGIDLSVDGGMAQV

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2511231015 Pseudomonas sp. GM49 Isolate Nodule
3 2512875024 Mesorhizobium loti R88b Isolate Nodule
4 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
5 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
6 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
7 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
8 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
9 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
10 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
11 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
12 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
13 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
14 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
15 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
16 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
17 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
18 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
19 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
20 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
21 2734482264 Dyella sp. AD052 Isolate Unclassified
22 2738541297 Duganella sp. GV083 Isolate Unclassified
23 2738541357 Duganella sp. GV053 Isolate Unclassified
24 2738543003 Duganella sp. GV066 Isolate Unclassified
25 2738543026 Duganella sp. GV089 Isolate Unclassified
26 2738543029 Duganella sp. GV039 Isolate Unclassified
27 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
28 2818991450 Burkholderia sp. 604 Isolate Unclassified
29 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
30 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
31 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
32 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
33 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
34 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
35 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
36 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
37 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
38 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
39 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
40 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
41 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
42 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
43 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
47 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
48 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
49 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
50 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
51 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
52 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
53 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
57 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
58 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
59 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
63 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
64 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
129 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
130 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
189 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
193 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
216 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
320 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
328 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
333 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
334 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
335 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
338 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
339 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
340 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
341 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
342 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
343 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
344 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
345 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
346 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
347 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
348 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
349 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
350 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
351 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
352 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
353 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.42
Metatranscriptomes 0.16
Isolates 7.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.43
Nodule 3
Rhizoplane 4.74
Rhizosphere 62.24
Stem 0
Stem Tuber 0
Unclassified 16.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005957 3300001989 Bacteria 4612
2 JGI24737J22298_10006139 3300001990 Bacteria 4116
3 JGI25156J39149_1000392 3300002705 Bacteria 27503
4 JGI25162J39368_1004766 3300002737 Bacteria 2977
5 JGI25158J39367_1000058 3300002739 Bacteria 24608
6 JGI25159J45721_1005559 3300002987 Bacteria 3943
7 JGI25165J46597_1003207 3300003214 Bacteria 4291
8 rootH1_10031460 3300003323 Bacteria 7779
9 JGI25160J50197_1000091 3300003354 Bacteria 90359
10 JGI25161J50226_1000027 3300003374 Bacteria 145847
11 Ga0055526_1002309 3300003771 Bacteria 12999
12 Ga0055526_1002486 3300003771 Bacteria 12436
13 Ga0055526_1003148 3300003771 Bacteria 10686
14 Ga0055524_1000769 3300003775 Bacteria 21606
15 Ga0055524_1004005 3300003775 Bacteria 6948
16 Ga0055524_1017004 3300003775 Bacteria 2581
17 Ga0055524_1034279 3300003775 Bacteria 1407
18 Ga0055528_1000083 3300003790 Bacteria 74840
19 Ga0055528_1002171 3300003790 Bacteria 10759
20 Ga0055528_1014332 3300003790 Bacteria 2939
21 Ga0055540_1002498 3300003792 Bacteria 9634
22 Ga0055540_1005083 3300003792 Bacteria 5680
23 Ga0055540_1013326 3300003792 Bacteria 2520
24 Ga0055543_1000100 3300004625 Bacteria 74795
25 Ga0065165_1000317 3300005262 Bacteria 78478
26 Ga0065165_1004450 3300005262 Bacteria 8685
27 Ga0065165_1025517 3300005262 Bacteria 1963
28 Ga0070658_10002980 3300005327 Bacteria 14021
29 Ga0070670_100419583 3300005331 Bacteria 1183
30 Ga0070666_10125226 3300005335 Bacteria 1784
31 Ga0070680_100068527 3300005336 Bacteria 2912
32 Ga0070682_100000010 3300005337 Bacteria 280957
33 Ga0068868_100394240 3300005338 Bacteria 1193
34 Ga0070669_100148401 3300005353 Bacteria 1813
35 Ga0070671_100007684 3300005355 Bacteria 8619
36 Ga0070667_100394680 3300005367 Bacteria 1258
37 Ga0070667_100400971 3300005367 Bacteria 1248
38 Ga0070713_100017981 3300005436 Bacteria 5366
39 Ga0070713_100017990 3300005436 Bacteria 5364
40 Ga0070701_10170882 3300005438 Bacteria 1266
41 Ga0070708_100130358 3300005445 Bacteria 2327
42 Ga0070708_100135918 3300005445 Bacteria 2277
43 Ga0070708_100427362 3300005445 Bacteria 1249
44 Ga0070663_100003650 3300005455 Bacteria 8916
45 Ga0070681_10087697 3300005458 Bacteria 3064
46 Ga0070681_10373025 3300005458 Bacteria 1337
47 Ga0068867_100035589 3300005459 Bacteria 3612
48 Ga0070707_100517689 3300005468 Bacteria 1155
49 Ga0070707_100518728 3300005468 Bacteria 1154
50 Ga0070698_100068467 3300005471 Plasmid 3567
51 Ga0070698_100755514 3300005471 Unclassified 915
52 Ga0070699_100308445 3300005518 Bacteria 1420
53 Ga0070679_100450587 3300005530 Bacteria 1232
54 Ga0070679_100826242 3300005530 Bacteria 870
55 Ga0068853_100699781 3300005539 Bacteria 967
56 Ga0070672_100009209 3300005543 Bacteria 6797
57 Ga0070665_100010240 3300005548 Bacteria 9487
58 Ga0070665_100302145 3300005548 Bacteria 1603
59 Ga0070665_100486080 3300005548 Bacteria 1245
60 Ga0070665_100526652 3300005548 Bacteria 1193
61 Ga0068855_100000858 3300005563 Bacteria 37714
62 Ga0068855_100014303 3300005563 Bacteria 9556
63 Ga0068855_100054969 3300005563 Bacteria 4677
64 Ga0068855_100056965 3300005563 Bacteria 4582
65 Ga0068855_100085286 3300005563 Bacteria 3655
66 Ga0068855_100260532 3300005563 Bacteria 1932
67 Ga0068857_100180941 3300005577 Bacteria 1919
68 Ga0068854_100048810 3300005578 Bacteria 3021
69 Ga0068854_100330083 3300005578 Bacteria 1242
70 Ga0068852_100019851 3300005616 Bacteria 5331
71 Ga0068852_100041265 3300005616 Bacteria 3899
72 Ga0068859_100590936 3300005617 Bacteria 1203
73 Ga0068864_100021820 3300005618 Bacteria 5366
74 Ga0068864_100358525 3300005618 Bacteria 1377
75 Ga0068861_100339899 3300005719 Bacteria 1313
76 Ga0068863_100310566 3300005841 Bacteria 1530
77 Ga0068858_100001585 3300005842 Bacteria 23212
78 Ga0068858_100124358 3300005842 Bacteria 2414
79 Ga0068858_100492684 3300005842 Bacteria 1183
80 Ga0068862_100108584 3300005844 Bacteria 2433
81 Ga0081540_1133843 3300005983 Bacteria 1007
82 Ga0070717_10019228 3300006028 Bacteria 5354
83 Ga0070717_10041240 3300006028 Bacteria 3763
84 Ga0070717_10138658 3300006028 Bacteria 2096
85 Ga0075365_10029676 3300006038 Bacteria 3498
86 Ga0075432_10010404 3300006058 Bacteria 3156
87 Ga0070715_10078906 3300006163 Bacteria 1489
88 Ga0075367_10035872 3300006178 Bacteria 2873
89 Ga0075369_10061890 3300006186 Bacteria 1634
90 Ga0097621_100071998 3300006237 Bacteria 2858
91 Ga0075370_10003461 3300006353 Bacteria 7519
92 Ga0075370_10032594 3300006353 Bacteria 2914
93 Ga0075370_10166295 3300006353 Bacteria 1296
94 Ga0075433_10225004 3300006852 Unclassified 1666
95 Ga0075436_100306759 3300006914 Bacteria 1138
96 Ga0097620_100590924 3300006931 Bacteria 1203
97 Ga0075435_100097969 3300007076 Bacteria 2427
98 Ga0105244_10000426 3300009036 Bacteria 39063
99 Ga0105244_10014169 3300009036 Bacteria 4622
100 Ga0105244_10033227 3300009036 Bacteria 2721
101 Ga0105240_10000582 3300009093 Bacteria 67645
102 Ga0105240_10041155 3300009093 Bacteria 5901
103 Ga0105240_10441772 3300009093 Bacteria 1458
104 Ga0105240_10570525 3300009093 Bacteria 1249
105 Ga0105245_10008078 3300009098 Bacteria 9201
106 Ga0105245_10129607 3300009098 Bacteria 2365
107 Ga0105248_10002723 3300009177 Bacteria 19630
108 Ga0105237_10005522 3300009545 Bacteria 14256
109 Ga0105238_10002323 3300009551 Bacteria 19122
110 Ga0105238_10086552 3300009551 Bacteria 3121
111 Ga0105238_10205361 3300009551 Bacteria 1946
112 Ga0105238_10249431 3300009551 Bacteria 1753
113 Ga0105238_10296461 3300009551 Bacteria 1600
114 Ga0105249_10484491 3300009553 Bacteria 1280
115 Ga0105239_10026955 3300010375 Bacteria 6325
116 Ga0105239_10030881 3300010375 Bacteria 5894
117 Ga0105246_10117204 3300011119 Bacteria 1967
118 Ga0157373_10021479 3300013100 Bacteria 4688
119 Ga0157370_10020961 3300013104 Bacteria 6518
120 Ga0157370_10115547 3300013104 Bacteria 2507
121 Ga0157369_10019628 3300013105 Bacteria 7564
122 Ga0157369_10045264 3300013105 Bacteria 4787
123 Ga0157369_10071570 3300013105 Bacteria 3722
124 Ga0157369_10091841 3300013105 Bacteria 3240
125 Ga0157374_10000016 3300013296 Bacteria 293656
126 Ga0157374_10188829 3300013296 Bacteria 2015
127 Ga0163162_10057372 3300013306 Bacteria 3922
128 Ga0163162_10070705 3300013306 Bacteria 3541
129 Ga0163162_10090010 3300013306 Bacteria 3150
130 Ga0157372_10545442 3300013307 Bacteria 1352
131 Ga0157375_10001246 3300013308 Bacteria 22001
132 Ga0157375_10083679 3300013308 Bacteria 3236
133 Ga0182008_10024539 3300014497 Bacteria 3068
134 Ga0157377_10000004 3300014745 Bacteria 430019
135 Ga0157379_10219251 3300014968 Bacteria 1724
136 Ga0157379_10292753 3300014968 Bacteria 1483
137 Ga0157379_10402398 3300014968 Bacteria 1259
138 Ga0157376_10917771 3300014969 Bacteria 894
139 Ga0182007_10011773 3300015262 Bacteria 3390
140 Ga0182005_1008225 3300015265 Bacteria 3084
141 Ga0163161_10012991 3300017792 Bacteria 5786
142 Ga0163161_10023633 3300017792 Bacteria 4337
143 Ga0163161_10596121 3300017792 Bacteria 910
144 Ga0224569_100965 3300022732 Bacteria 2445
145 Ga0228598_1014728 3300024227 Bacteria 1546
146 Ga0209436_100009 3300025208 Bacteria 143684
147 Ga0209437_100456 3300025233 Bacteria 32812
148 Ga0209677_100189 3300025253 Bacteria 50237
149 Ga0209759_1000130 3300025256 Bacteria 130638
150 Ga0209129_1003434 3300025258 Bacteria 6892
151 Ga0209233_1000139 3300025261 Bacteria 197070
152 Ga0209233_1008017 3300025261 Bacteria 3301
153 Ga0209673_1000086 3300025273 Bacteria 210101
154 Ga0209673_1001554 3300025273 Bacteria 20714
155 Ga0209673_1005597 3300025273 Bacteria 6277
156 Ga0209673_1010152 3300025273 Bacteria 3998
157 Ga0209130_1000031 3300025284 Bacteria 322932
158 Ga0209130_1006753 3300025284 Bacteria 3666
159 Ga0209676_1010078 3300025292 Bacteria 3986
160 Ga0209025_1002308 3300025294 Bacteria 20678
161 Ga0209564_1001360 3300025295 Bacteria 25720
162 Ga0209564_1001436 3300025295 Bacteria 24430
163 Ga0209564_1002099 3300025295 Bacteria 17049
164 Ga0209758_1008287 3300025297 Bacteria 6791
165 Ga0209758_1008982 3300025297 Bacteria 6324
166 Ga0209758_1027946 3300025297 Bacteria 2399
167 Ga0209256_1003202 3300025299 Bacteria 11828
168 Ga0209256_1004406 3300025299 Bacteria 8869
169 Ga0209256_1004607 3300025299 Bacteria 8526
170 Ga0207426_1000004 3300025302 Bacteria 1047900
171 Ga0207426_1000042 3300025302 Bacteria 433289
172 Ga0209051_1000417 3300025303 Bacteria 58858
173 Ga0209257_1000741 3300025304 Bacteria 49326
174 Ga0207697_10071986 3300025315 Bacteria 1449
175 Ga0207655_1000444 3300025728 Bacteria 54646
176 Ga0207655_1009083 3300025728 Bacteria 6220
177 Ga0207655_1018055 3300025728 Bacteria 3766
178 Ga0207688_10039677 3300025901 Bacteria 2615
179 Ga0207647_10011208 3300025904 Bacteria 6295
180 Ga0207645_10034883 3300025907 Bacteria 3231
181 Ga0207643_10133876 3300025908 Bacteria 1476
182 Ga0207705_10000488 3300025909 Bacteria 33822
183 Ga0207707_10002194 3300025912 Bacteria 17684
184 Ga0207707_10504593 3300025912 Bacteria 1031
185 Ga0207695_10000172 3300025913 Bacteria 190573
186 Ga0207695_10000192 3300025913 Bacteria 173760
187 Ga0207695_10000369 3300025913 Bacteria 103133
188 Ga0207695_10000895 3300025913 Bacteria 53944
189 Ga0207695_10008699 3300025913 Bacteria 12662
190 Ga0207695_10065855 3300025913 Bacteria 3724
191 Ga0207695_10099297 3300025913 Bacteria 2909
192 Ga0207695_10371381 3300025913 Bacteria 1316
193 Ga0207671_10004029 3300025914 Bacteria 14264
194 Ga0207671_10365055 3300025914 Bacteria 1146
195 Ga0207693_10282266 3300025915 Bacteria 1301
196 Ga0207660_10032918 3300025917 Bacteria 3581
197 Ga0207662_10009004 3300025918 Bacteria 5482
198 Ga0207652_10052752 3300025921 Bacteria 3492
199 Ga0207694_10000001 3300025924 Bacteria 4078485
200 Ga0207694_10000015 3300025924 Bacteria 363898
201 Ga0207694_10001176 3300025924 Bacteria 22672
202 Ga0207694_10053508 3300025924 Bacteria 3130
203 Ga0207694_10059827 3300025924 Bacteria 2963
204 Ga0207694_10155930 3300025924 Bacteria 1842
205 Ga0207694_10227841 3300025924 Bacteria 1521
206 Ga0207687_10115422 3300025927 Bacteria 2000
207 Ga0207700_10142110 3300025928 Bacteria 1973
208 Ga0207644_10044935 3300025931 Bacteria 3140
209 Ga0207691_10007845 3300025940 Bacteria 10282
210 Ga0207711_10064416 3300025941 Bacteria 3166
211 Ga0207689_10003619 3300025942 Bacteria 14125
212 Ga0207667_10000226 3300025949 Bacteria 79075
213 Ga0207667_10000688 3300025949 Bacteria 43835
214 Ga0207667_10003918 3300025949 Bacteria 18318
215 Ga0207667_10132389 3300025949 Bacteria 2568
216 Ga0207667_10327534 3300025949 Bacteria 1564
217 Ga0207667_10375802 3300025949 Bacteria 1448
218 Ga0207712_10175889 3300025961 Bacteria 1677
219 Ga0207712_10276519 3300025961 Bacteria 1368
220 Ga0207640_10002705 3300025981 Bacteria 9486
221 Ga0207640_10014260 3300025981 Bacteria 4571
222 Ga0207703_10000710 3300026035 Bacteria 32876
223 Ga0207703_10168903 3300026035 Bacteria 1922
224 Ga0207678_10613079 3300026067 Bacteria 955
225 Ga0207708_10121825 3300026075 Bacteria 2032
226 Ga0207641_10023082 3300026088 Bacteria 5126
227 Ga0207676_10392694 3300026095 Bacteria 1294
228 Ga0207674_10220479 3300026116 Bacteria 1845
229 Ga0207675_100004808 3300026118 Bacteria 13008
230 Ga0207683_10110751 3300026121 Bacteria 2458
231 Ga0207698_10012397 3300026142 Bacteria 5576
232 Ga0207428_10029491 3300027907 Bacteria 4547
233 Ga0207428_10069116 3300027907 Bacteria 2777
234 Ga0207428_10092807 3300027907 Bacteria 2342
235 Ga0268266_10002620 3300028379 Bacteria 19042
236 Ga0268266_10050625 3300028379 Bacteria 3564
237 Ga0268266_10056862 3300028379 Bacteria 3364
238 Ga0268266_10410715 3300028379 Bacteria 1281
239 Ga0268264_10120370 3300028381 Bacteria 2313
240 Ga0265319_1000750 3300028563 Bacteria 21154
241 Ga0265334_10000308 3300028573 Bacteria 27268
242 Ga0265334_10004009 3300028573 Bacteria 6613
243 Ga0265318_10001385 3300028577 Bacteria 14400
244 Ga0265318_10005572 3300028577 Bacteria 5903
245 Ga0265318_10026473 3300028577 Bacteria 2283
246 Ga0265318_10029488 3300028577 Bacteria 2139
247 Ga0307515_10020150 3300028794 Bacteria 11922
248 Ga0307515_10122194 3300028794 Bacteria 2939
249 Ga0265338_10000014 3300028800 Bacteria 378751
250 Ga0265338_10029945 3300028800 Bacteria 5381
251 Ga0265338_10152419 3300028800 Bacteria 1794
252 Ga0265324_10020438 3300029957 Bacteria 2379
253 Ga0307512_10017920 3300030522 Bacteria 6481
254 Ga0265762_1004864 3300030760 Bacteria 2405
255 Ga0265330_10001572 3300031235 Bacteria 13096
256 Ga0265330_10036303 3300031235 Bacteria 2197
257 Ga0265332_10002126 3300031238 Bacteria 10235
258 Ga0265332_10067061 3300031238 Bacteria 1530
259 Ga0265328_10001332 3300031239 Bacteria 11393
260 Ga0265328_10001639 3300031239 Bacteria 10280
261 Ga0265320_10001040 3300031240 Bacteria 20589
262 Ga0265320_10005672 3300031240 Bacteria 7970
263 Ga0265320_10029550 3300031240 Bacteria 2835
264 Ga0265320_10048377 3300031240 Bacteria 2075
265 Ga0265325_10000388 3300031241 Bacteria 31115
266 Ga0265329_10002535 3300031242 Bacteria 8246
267 Ga0265329_10003575 3300031242 Bacteria 6728
268 Ga0265329_10010487 3300031242 Bacteria 3397
269 Ga0265340_10011964 3300031247 Bacteria 4591
270 Ga0265340_10055087 3300031247 Bacteria 1916
271 Ga0265340_10057668 3300031247 Bacteria 1865
272 Ga0265339_10000534 3300031249 Bacteria 29685
273 Ga0265331_10000252 3300031250 Bacteria 63468
274 Ga0265331_10008114 3300031250 Bacteria 5997
275 Ga0265331_10013733 3300031250 Bacteria 4342
276 Ga0265331_10067829 3300031250 Bacteria 1673
277 Ga0265331_10116463 3300031250 Bacteria 1223
278 Ga0265327_10000183 3300031251 Bacteria 133191
279 Ga0265316_10001882 3300031344 Bacteria 22039
280 Ga0265316_10006557 3300031344 Bacteria 11100
281 Ga0307513_10026610 3300031456 Bacteria 6664
282 Ga0307513_10552971 3300031456 Bacteria 863
283 Ga0265313_10006426 3300031595 Bacteria 8321
284 Ga0265313_10057557 3300031595 Bacteria 1834
285 Ga0265314_10000043 3300031711 Bacteria 208128
286 Ga0265314_10001942 3300031711 Bacteria 22043
287 Ga0265314_10002243 3300031711 Bacteria 20028
288 Ga0265314_10012226 3300031711 Bacteria 7025
289 Ga0265314_10049398 3300031711 Bacteria 2945
290 Ga0265314_10053536 3300031711 Bacteria 2798
291 Ga0265342_10005121 3300031712 Bacteria 10099
292 Ga0265342_10008932 3300031712 Bacteria 7120
293 Ga0265342_10012276 3300031712 Bacteria 5808
294 Ga0307516_10005053 3300031730 Bacteria 15965
295 Ga0307516_10016154 3300031730 Bacteria 7821
296 Ga0307410_10118357 3300031852 Bacteria 1928
297 Ga0307414_10008633 3300032004 Bacteria 5795
298 Ga0307414_10035873 3300032004 Bacteria 3304
299 Ga0307507_10042544 3300033179 Bacteria 4524
300 Ga0307507_10147089 3300033179 Bacteria 1786
301 Ga0307510_10000018 3300033180 Bacteria 192986
302 Ga0373936_0002624 3300035113 Bacteria 6731
303 Ga0373936_0009499 3300035113 Unclassified 3667
304 Ga0373953_0094684 3300035117 Bacteria 1252
305 Ga0373925_0000780 3300037068 Bacteria 29312
306 Ga0395905_0068027 3300037471 Bacteria 3336
307 Ga0395905_0120819 3300037471 Bacteria 2462
308 Ga0439465_0008357 3300041413 Bacteria 3268
309 Ga0451833_0539360 3300041491 Bacteria 999
310 Ga0450908_002335 3300042184 Bacteria 3715
311 Ga0466967_0054161 3300045976 Bacteria 3529
312 Ga0495617_000007 3300046452 Bacteria 369986
313 Ga0495617_000019 3300046452 Bacteria 247938
314 Ga0495627_002755 3300046453 Bacteria 8168
315 Ga0495592_0002444 3300046454 Bacteria 13101
316 Ga0495603_0048088 3300046455 Bacteria 2540
317 Ga0495591_002495 3300046458 Bacteria 10190
318 Ga0495591_002907 3300046458 Bacteria 9173
319 Ga0495629_0037008 3300046459 Bacteria 3440
320 Ga0495629_0168384 3300046459 Bacteria 1521
321 Ga0495638_0040488 3300046460 Bacteria 2952
322 Ga0495641_0139985 3300046461 Bacteria 1081
323 Ga0495651_0011212 3300046462 Bacteria 6888
324 Ga0495651_0017288 3300046462 Bacteria 5587
325 Ga0495651_0042368 3300046462 Bacteria 3534
326 Ga0495653_0096514 3300046463 Bacteria 2149
327 Ga0495653_0287174 3300046463 Bacteria 1077
328 Ga0495650_0002151 3300046471 Bacteria 16727
329 Ga0495650_0017329 3300046471 Bacteria 3614
330 Ga0495650_0104766 3300046471 Bacteria 1058
331 Ga0495580_0004420 3300046472 Bacteria 11810
332 Ga0495580_0020357 3300046472 Bacteria 4910
333 Ga0495662_0098974 3300046476 Bacteria 1426
334 Ga0495662_0110777 3300046476 Bacteria 1345
335 Ga0495664_0110844 3300046477 Bacteria 1656
336 Ga0495594_0027403 3300046499 Bacteria 3070
337 Ga0495596_0004482 3300046500 Bacteria 6790
338 Ga0495607_0006912 3300046501 Bacteria 7910
339 Ga0495607_0090686 3300046501 Bacteria 1656
340 Ga0495583_0000007 3300046506 Bacteria 434661
341 Ga0495606_0000129 3300046507 Bacteria 127929
342 Ga0495606_0000905 3300046507 Bacteria 44064
343 Ga0495606_0002750 3300046507 Bacteria 19735
344 Ga0495606_0056820 3300046507 Bacteria 2524
345 Ga0495608_0024678 3300046511 Bacteria 4108
346 Ga0495610_0000004 3300046512 Bacteria 1006135
347 Ga0495610_0019796 3300046512 Bacteria 3753
348 Ga0495618_0011633 3300046514 Bacteria 5339
349 Ga0495620_0001004 3300046515 Bacteria 17443
350 Ga0495628_0078895 3300046516 Bacteria 2560
351 Ga0495628_0293532 3300046516 Bacteria 1204
352 Ga0495630_0010642 3300046517 Bacteria 6641
353 Ga0495630_0035317 3300046517 Bacteria 3736
354 Ga0495630_0058223 3300046517 Bacteria 2896
355 Ga0495631_0020910 3300046518 Bacteria 3052
356 Ga0495632_0054441 3300046519 Bacteria 1961
357 Ga0495643_0044006 3300046522 Bacteria 2427
358 Ga0495648_0006062 3300046524 Bacteria 9921
359 Ga0495648_0031022 3300046524 Bacteria 3525
360 Ga0495666_0015692 3300046526 Bacteria 3773
361 Ga0495666_0134458 3300046526 Bacteria 1154
362 Ga0495652_0240150 3300046529 Bacteria 1348
363 Ga0495652_0549058 3300046529 Bacteria 795
364 Ga0495654_0000975 3300046530 Bacteria 21052
365 Ga0495654_0002324 3300046530 Bacteria 12288
366 Ga0495640_0009180 3300046533 Bacteria 7719
367 Ga0495640_0022843 3300046533 Bacteria 4567
368 Ga0495587_0006150 3300046536 Bacteria 7835
369 Ga0495609_0000004 3300046538 Bacteria 697346
370 Ga0495597_0003675 3300046542 Bacteria 8805
371 Ga0495645_0066573 3300046543 Bacteria 2603
372 Ga0495622_0006457 3300046557 Bacteria 5439
373 Ga0495622_0016684 3300046557 Bacteria 3420
374 Ga0495667_0307888 3300046559 Bacteria 1003
375 Ga0495668_0000617 3300046616 Bacteria 43027
376 Ga0495634_0042858 3300046642 Bacteria 3068
377 Ga0495634_0061471 3300046642 Bacteria 2497
378 Ga0495625_0003058 3300046660 Bacteria 17143
379 Ga0495625_0014499 3300046660 Bacteria 6284
380 Ga0495625_0070366 3300046660 Bacteria 2456
381 Ga0495635_0006042 3300046663 Bacteria 8444
382 Ga0495635_0071469 3300046663 Bacteria 2378
383 Ga0495661_0000005 3300046665 Bacteria 433622
384 Ga0495661_0050021 3300046665 Bacteria 2532
385 Ga0495657_0087334 3300046675 Bacteria 2007
386 Ga0495599_0017237 3300046678 Bacteria 4489
387 Ga0495623_0024468 3300046679 Bacteria 3890
388 Ga0495646_0253677 3300046680 Bacteria 941
389 Ga0495613_0018759 3300046689 Bacteria 5156
390 Ga0495613_0062229 3300046689 Bacteria 2732
391 Ga0495624_0001660 3300046690 Bacteria 17062
392 Ga0495624_0082711 3300046690 Bacteria 1986
393 Ga0495670_0019459 3300046691 Bacteria 3345
394 Ga0495671_0000149 3300046692 Bacteria 61282
395 Ga0495671_0007514 3300046692 Bacteria 6206
396 Ga0495649_0000120 3300046694 Bacteria 68590
397 Ga0495649_0018977 3300046694 Bacteria 3863
398 Ga0495589_0013524 3300046794 Bacteria 4210
399 Ga0495589_0150735 3300046794 Bacteria 1110
400 Ga0495600_0016310 3300046809 Bacteria 4712
401 Ga0495600_0020333 3300046809 Bacteria 4246
402 Ga0495600_0179024 3300046809 Bacteria 1366
403 Ga0495660_0002670 3300046810 Bacteria 11292
404 Ga0495660_0004430 3300046810 Bacteria 8494
405 Ga0495581_0165908 3300047315 Bacteria 1291
406 Ga0495604_0003124 3300047317 Bacteria 13238
407 Ga0495604_0021114 3300047317 Bacteria 5195
408 Ga0495604_0047208 3300047317 Bacteria 3355
409 Ga0495674_0068531 3300047319 Bacteria 3070
410 Ga0495672_0085495 3300047320 Bacteria 1747
411 Ga0495676_0064798 3300047321 Bacteria 2839
412 Ga0495680_0007407 3300047322 Bacteria 10065
413 Ga0495680_0125777 3300047322 Bacteria 1888
414 Ga0495683_0008864 3300047323 Bacteria 5367
415 Ga0495687_001114 3300047443 Bacteria 26101
416 Ga0495687_040591 3300047443 Bacteria 2049
417 Ga0495675_0019041 3300047444 Bacteria 4359
418 Ga0495675_0112200 3300047444 Bacteria 1701
419 Ga0495675_0323820 3300047444 Bacteria 911
420 Ga0495679_002387 3300047446 Bacteria 9597
421 Ga0495679_004802 3300047446 Bacteria 6117
422 Ga0495679_023074 3300047446 Bacteria 2117
423 Ga0495673_0000017 3300047469 Bacteria 574970
424 Ga0495673_0033596 3300047469 Bacteria 2379
425 Ga0495684_0074463 3300047471 Bacteria 2580
426 Ga0495686_0000198 3300047472 Bacteria 112699
427 Ga0495686_0000333 3300047472 Bacteria 77831
428 Ga0495686_0000710 3300047472 Bacteria 44890
429 Ga0495686_0001821 3300047472 Bacteria 21486
430 Ga0495686_0018020 3300047472 Bacteria 4747
431 Ga0495686_0074741 3300047472 Bacteria 2079
432 Ga0495686_0080841 3300047472 Bacteria 1985
433 Ga0495686_0092259 3300047472 Bacteria 1837
434 Ga0495686_0195305 3300047472 Bacteria 1164
435 Ga0495593_0012574 3300047673 Bacteria 4833
436 Ga0495593_0048003 3300047673 Bacteria 2270
437 Ga0495602_0087443 3300048088 Bacteria 2597
438 Ga0495602_0194032 3300048088 Bacteria 1554
439 Ga0495602_0531848 3300048088 Bacteria 817
440 Ga0495614_0007913 3300048089 Bacteria 4724
441 Ga0496100_0000408 3300048903 Bacteria 20729
442 Ga0496100_0003995 3300048903 Bacteria 7755
443 Ga0496100_0030135 3300048903 Bacteria 3363
444 Ga0496100_0655582 3300048903 Bacteria 817
445 Ga0496101_0000237 3300048904 Bacteria 41085
446 Ga0496101_0000741 3300048904 Bacteria 19422
447 Ga0496102_0000007 3300048905 Bacteria 417224
448 Ga0496102_0000675 3300048905 Bacteria 34171
449 Ga0496102_0074271 3300048905 Bacteria 3125
450 Ga0496102_0142798 3300048905 Bacteria 2245
451 Ga0496103_0000071 3300048906 Bacteria 119931
452 Ga0496103_0001123 3300048906 Bacteria 18590
453 Ga0496103_0067581 3300048906 Bacteria 2232
454 Ga0496104_0006567 3300048907 Bacteria 10231
455 Ga0496104_0113893 3300048907 Bacteria 2593
456 Ga0496105_0001384 3300048908 Bacteria 17029
457 Ga0496105_0002949 3300048908 Bacteria 12496
458 Ga0496105_0125315 3300048908 Bacteria 2117
459 Ga0496107_0027099 3300048910 Bacteria 4068
460 Ga0496107_0089835 3300048910 Bacteria 2243
461 Ga0496110_0046248 3300048913 Bacteria 3807
462 Ga0496112_0056946 3300048915 Bacteria 3848
463 Ga0496112_0148415 3300048915 Bacteria 2313
464 Ga0496112_0153010 3300048915 Bacteria 2274
465 Ga0496113_0060153 3300048916 Bacteria 2863
466 Ga0496115_0000013 3300048918 Bacteria 213060
467 Ga0496115_0001836 3300048918 Bacteria 15209
468 Ga0496115_0203976 3300048918 Bacteria 1633
469 Ga0496115_0339004 3300048918 Bacteria 1227
470 Ga0496116_0000033 3300048919 Bacteria 418191
471 Ga0496116_0004586 3300048919 Bacteria 13100
472 Ga0496116_0012188 3300048919 Bacteria 7034
473 Ga0496116_0019853 3300048919 Bacteria 5129
474 Ga0496116_0050759 3300048919 Bacteria 2761
475 Ga0496116_0144325 3300048919 Bacteria 1333
476 Ga0496117_0000025 3300048920 Bacteria 418106
477 Ga0496117_0000105 3300048920 Bacteria 188970
478 Ga0496117_0001301 3300048920 Bacteria 36722
479 Ga0496117_0006113 3300048920 Bacteria 12322
480 Ga0496117_0023459 3300048920 Bacteria 4915
481 Ga0496118_0000023 3300048921 Bacteria 418106
482 Ga0496118_0000168 3300048921 Bacteria 118938
483 Ga0496118_0000928 3300048921 Bacteria 45801
484 Ga0496118_0001539 3300048921 Bacteria 34281
485 Ga0496118_0002320 3300048921 Bacteria 25836
486 Ga0496118_0003433 3300048921 Bacteria 19953
487 Ga0496118_0003510 3300048921 Bacteria 19666
488 Ga0496118_0068921 3300048921 Bacteria 2565
489 Ga0496118_0206669 3300048921 Bacteria 1156
490 Ga0496118_0232324 3300048921 Bacteria 1063
491 Ga0496119_0000708 3300048922 Bacteria 44757
492 Ga0496119_0001159 3300048922 Bacteria 33015
493 Ga0496119_0006900 3300048922 Bacteria 10367
494 Ga0496119_0014245 3300048922 Bacteria 6243
495 Ga0496119_0031328 3300048922 Bacteria 3570
496 Ga0496119_0197038 3300048922 Bacteria 1045
497 Ga0496120_0000281 3300048923 Bacteria 85648
498 Ga0496120_0021522 3300048923 Bacteria 4075
499 Ga0496120_0023864 3300048923 Bacteria 3822
500 Ga0496120_0092308 3300048923 Bacteria 1615
501 Ga0496121_0000168 3300048924 Bacteria 144896
502 Ga0496121_0000642 3300048924 Bacteria 65239
503 Ga0496121_0000993 3300048924 Bacteria 50722
504 Ga0496121_0001151 3300048924 Bacteria 46359
505 Ga0496121_0001605 3300048924 Bacteria 37523
506 Ga0496121_0022990 3300048924 Bacteria 6023
507 Ga0496121_0025389 3300048924 Bacteria 5623
508 Ga0496121_0048199 3300048924 Bacteria 3627
509 Ga0496121_0051063 3300048924 Bacteria 3486
510 Ga0496121_0065636 3300048924 Bacteria 2952
511 Ga0496121_0069065 3300048924 Bacteria 2854
512 Ga0496121_0084224 3300048924 Bacteria 2508
513 Ga0496121_0103486 3300048924 Bacteria 2190
514 Ga0496121_0152393 3300048924 Bacteria 1699
515 Ga0496121_0335274 3300048924 Bacteria 1013
516 Ga0496121_0423608 3300048924 Bacteria 865
517 Ga0496122_0000261 3300048925 Bacteria 118793
518 Ga0496122_0014428 3300048925 Bacteria 7642
519 Ga0496122_0034521 3300048925 Bacteria 4138
520 Ga0496122_0067349 3300048925 Bacteria 2580
521 Ga0496123_0000218 3300048926 Bacteria 116615
522 Ga0496123_0286750 3300048926 Bacteria 793
523 Ga0496124_0002073 3300048927 Bacteria 27131
524 Ga0496124_0029645 3300048927 Bacteria 4870
525 Ga0496124_0037817 3300048927 Bacteria 4194
526 Ga0496124_0078295 3300048927 Bacteria 2725
527 Ga0496125_0000312 3300048928 Bacteria 95519
528 Ga0496125_0000766 3300048928 Bacteria 52572
529 Ga0496125_0024470 3300048928 Bacteria 5552
530 Ga0496125_0154936 3300048928 Bacteria 1567
531 Ga0496125_0273019 3300048928 Bacteria 1052
532 Ga0496126_0000189 3300048929 Bacteria 138921
533 Ga0496126_0000559 3300048929 Bacteria 71584
534 Ga0496126_0022212 3300048929 Bacteria 6177
535 Ga0496126_0028662 3300048929 Bacteria 5302
536 Ga0496126_0030259 3300048929 Bacteria 5131
537 Ga0496126_0040617 3300048929 Bacteria 4312
538 Ga0496126_0067880 3300048929 Bacteria 3185
539 Ga0496126_0226165 3300048929 Bacteria 1569
540 Ga0496126_0374912 3300048929 Bacteria 1159
541 Ga0495682_0000428 3300049460 Bacteria 29486
542 Ga0495682_0000711 3300049460 Bacteria 21787
543 Ga0501031_0059763 3300049568 Bacteria 2484
544 Ga0501032_0258839 3300049569 Bacteria 1129
545 Ga0501033_0047542 3300049570 Bacteria 3190
546 Ga0501034_0223576 3300049571 Bacteria 1834
547 Ga0501035_0064778 3300049822 Bacteria 3247
548 Ga0501044_0010325 3300049823 Bacteria 10141
549 nmdc:mga0yw44_1193_c1 3300050492 Bacteria 10158
550 nmdc:mga0k408_155364_c1 3300050493 Bacteria 1363
551 nmdc:mga06z11_108975_c1 3300050494 Bacteria 1531
552 nmdc:mga07m45_52153_c1 3300050496 Bacteria 2308
553 nmdc:mga05p37_171997_c1 3300050507 Bacteria 2642
554 nmdc:mga05p37_613462_c1 3300050507 Bacteria 1226
555 nmdc:mga09592_268154_c1 3300050508 Unclassified 1481
556 nmdc:mga0n895_152362_c1 3300050512 Bacteria 2343
557 nmdc:mga0rr50_52214_c1 3300050513 Bacteria 3037
558 nmdc:mga08x19_57176_c1 3300050514 Bacteria 2519
559 nmdc:mga0a205_10501_c1 3300050515 Bacteria 8509
560 nmdc:mga0a205_88801_c1 3300050515 Bacteria 2988
561 nmdc:mga0sz30_39984_c1 3300050516 Bacteria 1970
562 Ga0495619_0203053 3300053085 Bacteria 1372
563 Ga0500643_001483 3300053087 Bacteria 13455
564 Ga0500643_012565 3300053087 Bacteria 3028
565 Ga0500644_0088354 3300053088 Bacteria 1155
566 Ga0500651_0008177 3300053093 Bacteria 6139
567 Ga0500566_0005153 3300053094 Bacteria 7785
568 Ga0500591_105769 3300053115 Bacteria 1192
569 Ga0500595_001400 3300053119 Bacteria 12943
570 Ga0500597_000296 3300053120 Bacteria 10120
571 Ga0500608_001747 3300053122 Bacteria 7762
572 Ga0500618_005472 3300053125 Bacteria 3852
573 Ga0500655_008745 3300053133 Bacteria 1821
574 Ga0500559_0000006 3300053136 Bacteria 229895
575 Ga0500559_0017817 3300053136 Bacteria 3003
576 Ga0500559_0028952 3300053136 Bacteria 2369
577 Ga0500559_0111707 3300053136 Bacteria 1266
578 Ga0500590_000200 3300053148 Bacteria 18250
579 Ga0500604_0000038 3300053151 Bacteria 50694
580 Ga0500616_0000483 3300053153 Bacteria 51655
581 Ga0500622_0002675 3300053156 Bacteria 12636
582 Ga0500627_0055845 3300053158 Bacteria 1730
583 Ga0500634_0024950 3300053161 Bacteria 3253
584 Ga0500637_0096758 3300053178 Bacteria 1711
585 Ga0500584_041143 3300053726 Bacteria 2119
586 Ga0500645_000710 3300053730 Bacteria 20669

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_268154_c1 nmdc:mga09592_268154_c1_775_1461 224
2 3300003775 Ga0055524_1017004 Ga0055524_10170042 227
3 3300047443 Ga0495687_040591 Ga0495687_040591_249_1061 231
4 3300045976 Ga0466967_0054161 Ga0466967_0054161_1318_2082 232
5 3300025304 Ga0209257_1000741 Ga0209257_10007418 234
6 3300003323 rootH1_10031460 rootH1_1003146010 235
7 3300003771 Ga0055526_1002309 Ga0055526_100230911 235
8 3300003775 Ga0055524_1000769 Ga0055524_100076925 235
9 3300003790 Ga0055528_1000083 Ga0055528_100008343 235
10 3300003792 Ga0055540_1002498 Ga0055540_10024989 235
11 3300025273 Ga0209673_1000086 Ga0209673_1000086172 235
12 3300025292 Ga0209676_1010078 Ga0209676_10100783 235
13 3300025294 Ga0209025_1002308 Ga0209025_100230812 235
14 3300025295 Ga0209564_1001360 Ga0209564_100136025 235
15 3300025297 Ga0209758_1027946 Ga0209758_10279464 235
16 3300025299 Ga0209256_1004607 Ga0209256_10046076 235
17 3300025928 Ga0207700_10142110 Ga0207700_101421102 235
18 3300048920 Ga0496117_0000105 Ga0496117_0000105_52450_53205 235
19 3300048921 Ga0496118_0000168 Ga0496118_0000168_46145_46900 235
20 3300048924 Ga0496121_0022990 Ga0496121_0022990_1656_2384 235
21 3300048924 Ga0496121_0051063 Ga0496121_0051063_1524_2279 235
22 3300048929 Ga0496126_0000559 Ga0496126_0000559_31093_31821 235
23 iso_pu_bacteria 2517093000 2517097578 235
24 iso_pu_bacteria 2599185156 2599336369 236
25 3300005468 Ga0070707_100517689 Ga0070707_1005176892 237
26 3300046517 Ga0495630_0010642 Ga0495630_0010642_1247_1990 237
27 3300005436 Ga0070713_100017990 Ga0070713_1000179904 238
28 iso_pu_bacteria 2513237146 2513924673 238
29 iso_pu_bacteria 2599185170 2599416228 238
30 iso_pu_bacteria 2738543031 2739349450 238
31 iso_pu_bacteria 2838035591 2838036349 238
32 3300025924 Ga0207694_10227841 Ga0207694_102278411 239
33 3300048927 Ga0496124_0078295 Ga0496124_0078295_624_1358 239
34 iso_pu_bacteria 2643221687 2644485654 239
35 3300053125 Ga0500618_005472 Ga0500618_005472_2026_2802 240
36 iso_pu_bacteria 2510065019 2510135774 240
37 iso_pu_bacteria 2511231015 2511318212 240
38 iso_pu_bacteria 2512875024 2512962627 240
39 iso_pu_bacteria 2513237164 2514039895 240
40 iso_pu_bacteria 2517093000 2517099899 240
41 iso_pu_bacteria 2517287029 2517409031 240
42 iso_pu_bacteria 2582581304 2585255322 240
43 iso_pu_bacteria 2582581308 2585283283 240
44 iso_pu_bacteria 2585427527 2585534692 240
45 iso_pu_bacteria 2588253510 2588293128 240
46 iso_pu_bacteria 2615840626 2616312385 240
47 iso_pu_bacteria 2643221552 2643778426 240
48 iso_pu_bacteria 2643221592 2643971058 240
49 iso_pu_bacteria 2643221625 2644144221 240
50 iso_pu_bacteria 2643221648 2644275243 240
51 iso_pu_bacteria 2718218334 2721027466 240
52 iso_pu_bacteria 2734482264 2735836398 240
53 iso_pu_bacteria 2818991461 2819683518 240
54 iso_pu_bacteria 2841957949 2841960806 240
55 iso_pu_bacteria 2842780639 2842782873 240
56 iso_pu_bacteria 2844002411 2844004590 240
57 iso_pu_bacteria 2874590934 2874593066 240
58 iso_pu_bacteria 2876771140 2876772431 240
59 iso_pu_bacteria 2876818435 2876820821 240
60 iso_pu_bacteria 2879074833 2879077018 240
61 iso_pu_bacteria 2884811622 2884814481 240
62 iso_pu_bacteria 2894652903 2894656960 240
63 iso_pu_bacteria 2896154374 2896159006 240
64 iso_pu_bacteria 2900634093 2900640431 240
65 iso_pu_bacteria 642555113 642616930 240
66 iso_pu_bacteria 8024486573 8024490509 240
67 iso_pu_bacteria 8056155041 8056157532 240
68 iso_pu_bacteria 2738541297 2738825268 241
69 iso_pu_bacteria 2738541357 2739149065 241
70 iso_pu_bacteria 2738543003 2739190984 241
71 iso_pu_bacteria 2738543026 2739317461 241
72 iso_pu_bacteria 2738543029 2739335702 241
73 iso_pu_bacteria 2884836552 2884839196 242
74 3300003792 Ga0055540_1005083 Ga0055540_10050835 243
75 3300005445 Ga0070708_100130358 Ga0070708_1001303582 243
76 3300005468 Ga0070707_100518728 Ga0070707_1005187281 243
77 3300005471 Ga0070698_100068467 Ga0070698_1000684677 243
78 3300005471 Ga0070698_100755514 Ga0070698_1007555141 243
79 3300006028 Ga0070717_10019228 Ga0070717_100192286 243
80 3300006028 Ga0070717_10138658 Ga0070717_101386582 243
81 3300006852 Ga0075433_10225004 Ga0075433_102250042 243
82 3300006914 Ga0075436_100306759 Ga0075436_1003067592 243
83 3300007076 Ga0075435_100097969 Ga0075435_1000979691 243
84 3300025303 Ga0209051_1000417 Ga0209051_100041736 243
85 3300025915 Ga0207693_10282266 Ga0207693_102822662 243
86 3300050507 nmdc:mga05p37_171997_c1 nmdc:mga05p37_171997_c1_124_888 243
87 3300050507 nmdc:mga05p37_613462_c1 nmdc:mga05p37_613462_c1_15_779 243
88 3300050512 nmdc:mga0n895_152362_c1 nmdc:mga0n895_152362_c1_169_933 243
89 3300050513 nmdc:mga0rr50_52214_c1 nmdc:mga0rr50_52214_c1_1657_2421 243
90 3300050514 nmdc:mga08x19_57176_c1 nmdc:mga08x19_57176_c1_48_809 243
91 3300050515 nmdc:mga0a205_10501_c1 nmdc:mga0a205_10501_c1_6171_6935 243
92 3300050515 nmdc:mga0a205_88801_c1 nmdc:mga0a205_88801_c1_827_1591 243
93 iso_pu_bacteria 2818991450 2819618913 243
94 3300001989 JGI24739J22299_10005957 JGI24739J22299_100059574 244
95 3300001990 JGI24737J22298_10006139 JGI24737J22298_100061394 244
96 3300002705 JGI25156J39149_1000392 JGI25156J39149_100039217 244
97 3300002737 JGI25162J39368_1004766 JGI25162J39368_10047666 244
98 3300002739 JGI25158J39367_1000058 JGI25158J39367_10000582 244
99 3300002987 JGI25159J45721_1005559 JGI25159J45721_10055592 244
100 3300003214 JGI25165J46597_1003207 JGI25165J46597_10032076 244
101 3300003354 JGI25160J50197_1000091 JGI25160J50197_100009125 244
102 3300003374 JGI25161J50226_1000027 JGI25161J50226_100002735 244
103 3300003771 Ga0055526_1002486 Ga0055526_100248613 244
104 3300003771 Ga0055526_1003148 Ga0055526_10031486 244
105 3300003775 Ga0055524_1004005 Ga0055524_100400510 244
106 3300003775 Ga0055524_1034279 Ga0055524_10342792 244
107 3300003790 Ga0055528_1002171 Ga0055528_10021717 244
108 3300003790 Ga0055528_1014332 Ga0055528_10143321 244
109 3300003792 Ga0055540_1013326 Ga0055540_10133262 244
110 3300004625 Ga0055543_1000100 Ga0055543_100010054 244
111 3300005262 Ga0065165_1000317 Ga0065165_10003174 244
112 3300005262 Ga0065165_1004450 Ga0065165_10044505 244
113 3300005262 Ga0065165_1025517 Ga0065165_10255173 244
114 3300005327 Ga0070658_10002980 Ga0070658_100029803 244
115 3300005331 Ga0070670_100419583 Ga0070670_1004195832 244
116 3300005335 Ga0070666_10125226 Ga0070666_101252262 244
117 3300005336 Ga0070680_100068527 Ga0070680_1000685272 244
118 3300005337 Ga0070682_100000010 Ga0070682_100000010200 244
119 3300005338 Ga0068868_100394240 Ga0068868_1003942401 244
120 3300005353 Ga0070669_100148401 Ga0070669_1001484012 244
121 3300005355 Ga0070671_100007684 Ga0070671_1000076847 244
122 3300005367 Ga0070667_100394680 Ga0070667_1003946802 244
123 3300005367 Ga0070667_100400971 Ga0070667_1004009712 244
124 3300005436 Ga0070713_100017981 Ga0070713_1000179816 244
125 3300005438 Ga0070701_10170882 Ga0070701_101708822 244
126 3300005445 Ga0070708_100135918 Ga0070708_1001359182 244
127 3300005445 Ga0070708_100427362 Ga0070708_1004273622 244
128 3300005455 Ga0070663_100003650 Ga0070663_1000036507 244
129 3300005458 Ga0070681_10087697 Ga0070681_100876972 244
130 3300005458 Ga0070681_10373025 Ga0070681_103730252 244
131 3300005459 Ga0068867_100035589 Ga0068867_1000355894 244
132 3300005518 Ga0070699_100308445 Ga0070699_1003084452 244
133 3300005530 Ga0070679_100450587 Ga0070679_1004505872 244
134 3300005530 Ga0070679_100826242 Ga0070679_1008262421 244
135 3300005539 Ga0068853_100699781 Ga0068853_1006997811 244
136 3300005543 Ga0070672_100009209 Ga0070672_1000092092 244
137 3300005548 Ga0070665_100010240 Ga0070665_10001024013 244
138 3300005548 Ga0070665_100302145 Ga0070665_1003021452 244
139 3300005548 Ga0070665_100486080 Ga0070665_1004860802 244
140 3300005548 Ga0070665_100526652 Ga0070665_1005266522 244
141 3300005563 Ga0068855_100000858 Ga0068855_10000085815 244
142 3300005563 Ga0068855_100014303 Ga0068855_10001430310 244
143 3300005563 Ga0068855_100054969 Ga0068855_1000549693 244
144 3300005563 Ga0068855_100056965 Ga0068855_1000569654 244
145 3300005563 Ga0068855_100085286 Ga0068855_1000852863 244
146 3300005563 Ga0068855_100260532 Ga0068855_1002605322 244
147 3300005577 Ga0068857_100180941 Ga0068857_1001809412 244
148 3300005578 Ga0068854_100048810 Ga0068854_1000488102 244
149 3300005578 Ga0068854_100330083 Ga0068854_1003300832 244
150 3300005616 Ga0068852_100019851 Ga0068852_1000198514 244
151 3300005616 Ga0068852_100041265 Ga0068852_1000412655 244
152 3300005617 Ga0068859_100590936 Ga0068859_1005909361 244
153 3300005618 Ga0068864_100021820 Ga0068864_1000218205 244
154 3300005618 Ga0068864_100358525 Ga0068864_1003585252 244
155 3300005719 Ga0068861_100339899 Ga0068861_1003398991 244
156 3300005841 Ga0068863_100310566 Ga0068863_1003105661 244
157 3300005842 Ga0068858_100001585 Ga0068858_1000015855 244
158 3300005842 Ga0068858_100124358 Ga0068858_1001243583 244
159 3300005842 Ga0068858_100492684 Ga0068858_1004926842 244
160 3300005844 Ga0068862_100108584 Ga0068862_1001085842 244
161 3300005983 Ga0081540_1133843 Ga0081540_11338432 244
162 3300006028 Ga0070717_10041240 Ga0070717_100412402 244
163 3300006038 Ga0075365_10029676 Ga0075365_100296763 244
164 3300006058 Ga0075432_10010404 Ga0075432_100104043 244
165 3300006163 Ga0070715_10078906 Ga0070715_100789062 244
166 3300006178 Ga0075367_10035872 Ga0075367_100358721 244
167 3300006186 Ga0075369_10061890 Ga0075369_100618903 244
168 3300006237 Ga0097621_100071998 Ga0097621_1000719984 244
169 3300006353 Ga0075370_10003461 Ga0075370_100034615 244
170 3300006353 Ga0075370_10032594 Ga0075370_100325945 244
171 3300006353 Ga0075370_10166295 Ga0075370_101662951 244
172 3300006931 Ga0097620_100590924 Ga0097620_1005909241 244
173 3300009036 Ga0105244_10000426 Ga0105244_1000042643 244
174 3300009036 Ga0105244_10014169 Ga0105244_100141695 244
175 3300009036 Ga0105244_10033227 Ga0105244_100332272 244
176 3300009093 Ga0105240_10000582 Ga0105240_1000058218 244
177 3300009093 Ga0105240_10041155 Ga0105240_100411557 244
178 3300009093 Ga0105240_10441772 Ga0105240_104417722 244
179 3300009093 Ga0105240_10570525 Ga0105240_105705252 244
180 3300009098 Ga0105245_10008078 Ga0105245_100080788 244
181 3300009098 Ga0105245_10129607 Ga0105245_101296072 244
182 3300009177 Ga0105248_10002723 Ga0105248_1000272313 244
183 3300009545 Ga0105237_10005522 Ga0105237_100055225 244
184 3300009551 Ga0105238_10002323 Ga0105238_1000232315 244
185 3300009551 Ga0105238_10086552 Ga0105238_100865522 244
186 3300009551 Ga0105238_10205361 Ga0105238_102053612 244
187 3300009551 Ga0105238_10249431 Ga0105238_102494312 244
188 3300009551 Ga0105238_10296461 Ga0105238_102964611 244
189 3300009553 Ga0105249_10484491 Ga0105249_104844912 244
190 3300010375 Ga0105239_10026955 Ga0105239_1002695510 244
191 3300010375 Ga0105239_10030881 Ga0105239_100308816 244
192 3300011119 Ga0105246_10117204 Ga0105246_101172041 244
193 3300013100 Ga0157373_10021479 Ga0157373_100214795 244
194 3300013104 Ga0157370_10020961 Ga0157370_100209615 244
195 3300013104 Ga0157370_10115547 Ga0157370_101155473 244
196 3300013105 Ga0157369_10019628 Ga0157369_100196282 244
197 3300013105 Ga0157369_10045264 Ga0157369_100452645 244
198 3300013105 Ga0157369_10071570 Ga0157369_100715702 244
199 3300013105 Ga0157369_10091841 Ga0157369_100918413 244
200 3300013296 Ga0157374_10000016 Ga0157374_10000016264 244
201 3300013296 Ga0157374_10188829 Ga0157374_101888292 244
202 3300013306 Ga0163162_10057372 Ga0163162_100573724 244
203 3300013306 Ga0163162_10070705 Ga0163162_100707053 244
204 3300013306 Ga0163162_10090010 Ga0163162_100900104 244
205 3300013307 Ga0157372_10545442 Ga0157372_105454421 244
206 3300013308 Ga0157375_10001246 Ga0157375_1000124614 244
207 3300013308 Ga0157375_10083679 Ga0157375_100836794 244
208 3300014497 Ga0182008_10024539 Ga0182008_100245391 244
209 3300014745 Ga0157377_10000004 Ga0157377_10000004221 244
210 3300014968 Ga0157379_10219251 Ga0157379_102192512 244
211 3300014968 Ga0157379_10292753 Ga0157379_102927532 244
212 3300014968 Ga0157379_10402398 Ga0157379_104023981 244
213 3300014969 Ga0157376_10917771 Ga0157376_109177711 244
214 3300015262 Ga0182007_10011773 Ga0182007_100117733 244
215 3300015265 Ga0182005_1008225 Ga0182005_10082252 244
216 3300017792 Ga0163161_10012991 Ga0163161_100129912 244
217 3300017792 Ga0163161_10023633 Ga0163161_100236336 244
218 3300017792 Ga0163161_10596121 Ga0163161_105961211 244
219 3300022732 Ga0224569_100965 Ga0224569_1009653 244
220 3300024227 Ga0228598_1014728 Ga0228598_10147282 244
221 3300025208 Ga0209436_100009 Ga0209436_10000969 244
222 3300025233 Ga0209437_100456 Ga0209437_10045622 244
223 3300025253 Ga0209677_100189 Ga0209677_10018920 244
224 3300025256 Ga0209759_1000130 Ga0209759_100013020 244
225 3300025258 Ga0209129_1003434 Ga0209129_10034347 244
226 3300025261 Ga0209233_1000139 Ga0209233_1000139113 244
227 3300025261 Ga0209233_1008017 Ga0209233_10080172 244
228 3300025273 Ga0209673_1001554 Ga0209673_100155420 244
229 3300025273 Ga0209673_1005597 Ga0209673_10055974 244
230 3300025273 Ga0209673_1010152 Ga0209673_10101523 244
231 3300025284 Ga0209130_1000031 Ga0209130_1000031272 244
232 3300025284 Ga0209130_1006753 Ga0209130_10067533 244
233 3300025295 Ga0209564_1001436 Ga0209564_10014364 244
234 3300025295 Ga0209564_1002099 Ga0209564_100209914 244
235 3300025297 Ga0209758_1008287 Ga0209758_10082872 244
236 3300025297 Ga0209758_1008982 Ga0209758_10089827 244
237 3300025299 Ga0209256_1003202 Ga0209256_10032028 244
238 3300025299 Ga0209256_1004406 Ga0209256_10044063 244
239 3300025302 Ga0207426_1000004 Ga0207426_100000491 244
240 3300025302 Ga0207426_1000042 Ga0207426_1000042137 244
241 3300025315 Ga0207697_10071986 Ga0207697_100719862 244
242 3300025728 Ga0207655_1000444 Ga0207655_100044435 244
243 3300025728 Ga0207655_1009083 Ga0207655_10090833 244
244 3300025728 Ga0207655_1018055 Ga0207655_10180552 244
245 3300025901 Ga0207688_10039677 Ga0207688_100396773 244
246 3300025904 Ga0207647_10011208 Ga0207647_100112082 244
247 3300025907 Ga0207645_10034883 Ga0207645_100348833 244
248 3300025908 Ga0207643_10133876 Ga0207643_101338762 244
249 3300025909 Ga0207705_10000488 Ga0207705_1000048812 244
250 3300025912 Ga0207707_10002194 Ga0207707_1000219411 244
251 3300025912 Ga0207707_10504593 Ga0207707_105045931 244
252 3300025913 Ga0207695_10000172 Ga0207695_1000017273 244
253 3300025913 Ga0207695_10000192 Ga0207695_1000019210 244
254 3300025913 Ga0207695_10000369 Ga0207695_1000036963 244
255 3300025913 Ga0207695_10000895 Ga0207695_1000089545 244
256 3300025913 Ga0207695_10008699 Ga0207695_100086995 244
257 3300025913 Ga0207695_10065855 Ga0207695_100658553 244
258 3300025913 Ga0207695_10099297 Ga0207695_100992973 244
259 3300025913 Ga0207695_10371381 Ga0207695_103713812 244
260 3300025914 Ga0207671_10004029 Ga0207671_100040295 244
261 3300025914 Ga0207671_10365055 Ga0207671_103650552 244
262 3300025917 Ga0207660_10032918 Ga0207660_100329183 244
263 3300025918 Ga0207662_10009004 Ga0207662_100090049 244
264 3300025921 Ga0207652_10052752 Ga0207652_100527522 244
265 3300025924 Ga0207694_10000001 Ga0207694_10000001203 244
266 3300025924 Ga0207694_10000015 Ga0207694_10000015240 244
267 3300025924 Ga0207694_10001176 Ga0207694_1000117621 244
268 3300025924 Ga0207694_10053508 Ga0207694_100535082 244
269 3300025924 Ga0207694_10059827 Ga0207694_100598272 244
270 3300025924 Ga0207694_10155930 Ga0207694_101559302 244
271 3300025927 Ga0207687_10115422 Ga0207687_101154222 244
272 3300025931 Ga0207644_10044935 Ga0207644_100449352 244
273 3300025940 Ga0207691_10007845 Ga0207691_100078452 244
274 3300025941 Ga0207711_10064416 Ga0207711_100644164 244
275 3300025942 Ga0207689_10003619 Ga0207689_1000361913 244
276 3300025949 Ga0207667_10000226 Ga0207667_1000022664 244
277 3300025949 Ga0207667_10000688 Ga0207667_100006885 244
278 3300025949 Ga0207667_10003918 Ga0207667_1000391810 244
279 3300025949 Ga0207667_10132389 Ga0207667_101323892 244
280 3300025949 Ga0207667_10327534 Ga0207667_103275342 244
281 3300025949 Ga0207667_10375802 Ga0207667_103758022 244
282 3300025961 Ga0207712_10175889 Ga0207712_101758892 244
283 3300025961 Ga0207712_10276519 Ga0207712_102765191 244
284 3300025981 Ga0207640_10002705 Ga0207640_100027055 244
285 3300025981 Ga0207640_10014260 Ga0207640_100142602 244
286 3300026035 Ga0207703_10000710 Ga0207703_100007108 244
287 3300026035 Ga0207703_10168903 Ga0207703_101689031 244
288 3300026067 Ga0207678_10613079 Ga0207678_106130792 244
289 3300026075 Ga0207708_10121825 Ga0207708_101218253 244
290 3300026088 Ga0207641_10023082 Ga0207641_100230823 244
291 3300026095 Ga0207676_10392694 Ga0207676_103926941 244
292 3300026116 Ga0207674_10220479 Ga0207674_102204792 244
293 3300026118 Ga0207675_100004808 Ga0207675_10000480811 244
294 3300026121 Ga0207683_10110751 Ga0207683_101107512 244
295 3300026142 Ga0207698_10012397 Ga0207698_100123977 244
296 3300027907 Ga0207428_10029491 Ga0207428_100294912 244
297 3300027907 Ga0207428_10069116 Ga0207428_100691161 244
298 3300027907 Ga0207428_10092807 Ga0207428_100928071 244
299 3300028379 Ga0268266_10002620 Ga0268266_100026202 244
300 3300028379 Ga0268266_10050625 Ga0268266_100506254 244
301 3300028379 Ga0268266_10056862 Ga0268266_100568623 244
302 3300028379 Ga0268266_10410715 Ga0268266_104107152 244
303 3300028381 Ga0268264_10120370 Ga0268264_101203702 244
304 3300028563 Ga0265319_1000750 Ga0265319_100075022 244
305 3300028573 Ga0265334_10000308 Ga0265334_1000030816 244
306 3300028573 Ga0265334_10004009 Ga0265334_100040094 244
307 3300028577 Ga0265318_10001385 Ga0265318_100013857 244
308 3300028577 Ga0265318_10005572 Ga0265318_100055722 244
309 3300028577 Ga0265318_10026473 Ga0265318_100264732 244
310 3300028577 Ga0265318_10029488 Ga0265318_100294884 244
311 3300028794 Ga0307515_10020150 Ga0307515_100201504 244
312 3300028794 Ga0307515_10122194 Ga0307515_101221942 244
313 3300028800 Ga0265338_10000014 Ga0265338_10000014209 244
314 3300028800 Ga0265338_10029945 Ga0265338_100299454 244
315 3300028800 Ga0265338_10152419 Ga0265338_101524192 244
316 3300029957 Ga0265324_10020438 Ga0265324_100204383 244
317 3300030522 Ga0307512_10017920 Ga0307512_100179209 244
318 3300030760 Ga0265762_1004864 Ga0265762_10048642 244
319 3300031235 Ga0265330_10001572 Ga0265330_1000157212 244
320 3300031235 Ga0265330_10036303 Ga0265330_100363031 244
321 3300031238 Ga0265332_10002126 Ga0265332_100021267 244
322 3300031238 Ga0265332_10067061 Ga0265332_100670612 244
323 3300031239 Ga0265328_10001332 Ga0265328_100013327 244
324 3300031239 Ga0265328_10001639 Ga0265328_100016397 244
325 3300031240 Ga0265320_10001040 Ga0265320_100010402 244
326 3300031240 Ga0265320_10005672 Ga0265320_100056729 244
327 3300031240 Ga0265320_10029550 Ga0265320_100295502 244
328 3300031240 Ga0265320_10048377 Ga0265320_100483772 244
329 3300031241 Ga0265325_10000388 Ga0265325_1000038816 244
330 3300031242 Ga0265329_10002535 Ga0265329_1000253510 244
331 3300031242 Ga0265329_10003575 Ga0265329_100035758 244
332 3300031242 Ga0265329_10010487 Ga0265329_100104872 244
333 3300031247 Ga0265340_10011964 Ga0265340_100119642 244
334 3300031247 Ga0265340_10055087 Ga0265340_100550872 244
335 3300031247 Ga0265340_10057668 Ga0265340_100576682 244
336 3300031249 Ga0265339_10000534 Ga0265339_100005345 244
337 3300031250 Ga0265331_10000252 Ga0265331_1000025240 244
338 3300031250 Ga0265331_10008114 Ga0265331_100081147 244
339 3300031250 Ga0265331_10013733 Ga0265331_100137335 244
340 3300031250 Ga0265331_10067829 Ga0265331_100678292 244
341 3300031250 Ga0265331_10116463 Ga0265331_101164632 244
342 3300031251 Ga0265327_10000183 Ga0265327_1000018376 244
343 3300031344 Ga0265316_10001882 Ga0265316_100018827 244
344 3300031344 Ga0265316_10006557 Ga0265316_100065579 244
345 3300031456 Ga0307513_10026610 Ga0307513_100266107 244
346 3300031456 Ga0307513_10552971 Ga0307513_105529711 244
347 3300031595 Ga0265313_10006426 Ga0265313_1000642611 244
348 3300031595 Ga0265313_10057557 Ga0265313_100575572 244
349 3300031711 Ga0265314_10000043 Ga0265314_1000004317 244
350 3300031711 Ga0265314_10001942 Ga0265314_1000194215 244
351 3300031711 Ga0265314_10002243 Ga0265314_100022434 244
352 3300031711 Ga0265314_10012226 Ga0265314_100122265 244
353 3300031711 Ga0265314_10049398 Ga0265314_100493982 244
354 3300031711 Ga0265314_10053536 Ga0265314_100535363 244
355 3300031712 Ga0265342_10005121 Ga0265342_100051217 244
356 3300031712 Ga0265342_10008932 Ga0265342_100089325 244
357 3300031712 Ga0265342_10012276 Ga0265342_100122763 244
358 3300031730 Ga0307516_10005053 Ga0307516_1000505314 244
359 3300031730 Ga0307516_10016154 Ga0307516_100161542 244
360 3300031852 Ga0307410_10118357 Ga0307410_101183572 244
361 3300032004 Ga0307414_10008633 Ga0307414_100086332 244
362 3300032004 Ga0307414_10035873 Ga0307414_100358734 244
363 3300033179 Ga0307507_10042544 Ga0307507_100425444 244
364 3300033179 Ga0307507_10147089 Ga0307507_101470892 244
365 3300033180 Ga0307510_10000018 Ga0307510_1000001845 244
366 3300035113 Ga0373936_0002624 Ga0373936_0002624_5243_5986 244
367 3300035113 Ga0373936_0009499 Ga0373936_0009499_2072_2821 244
368 3300035117 Ga0373953_0094684 Ga0373953_0094684_442_1176 244
369 3300037068 Ga0373925_0000780 Ga0373925_0000780_24422_25156 244
370 3300037471 Ga0395905_0068027 Ga0395905_0068027_1670_2413 244
371 3300037471 Ga0395905_0120819 Ga0395905_0120819_238_972 244
372 3300041413 Ga0439465_0008357 Ga0439465_0008357_2106_2849 244
373 3300041491 Ga0451833_0539360 Ga0451833_0539360_104_844 244
374 3300042184 Ga0450908_002335 Ga0450908_002335_415_1158 244
375 3300046452 Ga0495617_000007 Ga0495617_000007_94937_95692 244
376 3300046452 Ga0495617_000019 Ga0495617_000019_26150_26893 244
377 3300046453 Ga0495627_002755 Ga0495627_002755_7276_8025 244
378 3300046454 Ga0495592_0002444 Ga0495592_0002444_4625_5368 244
379 3300046455 Ga0495603_0048088 Ga0495603_0048088_113_856 244
380 3300046458 Ga0495591_002495 Ga0495591_002495_2881_3630 244
381 3300046458 Ga0495591_002907 Ga0495591_002907_2676_3419 244
382 3300046459 Ga0495629_0037008 Ga0495629_0037008_852_1595 244
383 3300046459 Ga0495629_0168384 Ga0495629_0168384_447_1190 244
384 3300046460 Ga0495638_0040488 Ga0495638_0040488_1818_2561 244
385 3300046461 Ga0495641_0139985 Ga0495641_0139985_121_864 244
386 3300046462 Ga0495651_0011212 Ga0495651_0011212_3408_4157 244
387 3300046462 Ga0495651_0017288 Ga0495651_0017288_3184_3927 244
388 3300046462 Ga0495651_0042368 Ga0495651_0042368_753_1496 244
389 3300046463 Ga0495653_0096514 Ga0495653_0096514_419_1162 244
390 3300046463 Ga0495653_0287174 Ga0495653_0287174_312_1055 244
391 3300046471 Ga0495650_0002151 Ga0495650_0002151_13294_14049 244
392 3300046471 Ga0495650_0017329 Ga0495650_0017329_2004_2753 244
393 3300046471 Ga0495650_0104766 Ga0495650_0104766_229_963 244
394 3300046472 Ga0495580_0004420 Ga0495580_0004420_9549_10292 244
395 3300046472 Ga0495580_0020357 Ga0495580_0020357_920_1663 244
396 3300046476 Ga0495662_0098974 Ga0495662_0098974_83_826 244
397 3300046476 Ga0495662_0110777 Ga0495662_0110777_469_1212 244
398 3300046477 Ga0495664_0110844 Ga0495664_0110844_726_1469 244
399 3300046499 Ga0495594_0027403 Ga0495594_0027403_398_1147 244
400 3300046500 Ga0495596_0004482 Ga0495596_0004482_2402_3145 244
401 3300046501 Ga0495607_0006912 Ga0495607_0006912_2115_2858 244
402 3300046501 Ga0495607_0090686 Ga0495607_0090686_816_1559 244
403 3300046506 Ga0495583_0000007 Ga0495583_0000007_426478_427227 244
404 3300046507 Ga0495606_0000129 Ga0495606_0000129_53772_54527 244
405 3300046507 Ga0495606_0000905 Ga0495606_0000905_26483_27226 244
406 3300046507 Ga0495606_0002750 Ga0495606_0002750_2051_2800 244
407 3300046507 Ga0495606_0056820 Ga0495606_0056820_906_1649 244
408 3300046511 Ga0495608_0024678 Ga0495608_0024678_2222_2965 244
409 3300046512 Ga0495610_0000004 Ga0495610_0000004_523799_524554 244
410 3300046512 Ga0495610_0019796 Ga0495610_0019796_1235_1984 244
411 3300046514 Ga0495618_0011633 Ga0495618_0011633_4476_5219 244
412 3300046515 Ga0495620_0001004 Ga0495620_0001004_14001_14744 244
413 3300046516 Ga0495628_0078895 Ga0495628_0078895_359_1102 244
414 3300046516 Ga0495628_0293532 Ga0495628_0293532_23_766 244
415 3300046517 Ga0495630_0035317 Ga0495630_0035317_1972_2715 244
416 3300046517 Ga0495630_0058223 Ga0495630_0058223_580_1323 244
417 3300046518 Ga0495631_0020910 Ga0495631_0020910_1367_2116 244
418 3300046519 Ga0495632_0054441 Ga0495632_0054441_522_1265 244
419 3300046522 Ga0495643_0044006 Ga0495643_0044006_965_1699 244
420 3300046524 Ga0495648_0006062 Ga0495648_0006062_2202_2957 244
421 3300046524 Ga0495648_0031022 Ga0495648_0031022_2344_3087 244
422 3300046526 Ga0495666_0015692 Ga0495666_0015692_200_943 244
423 3300046526 Ga0495666_0134458 Ga0495666_0134458_80_823 244
424 3300046529 Ga0495652_0240150 Ga0495652_0240150_567_1310 244
425 3300046529 Ga0495652_0549058 Ga0495652_0549058_31_774 244
426 3300046530 Ga0495654_0000975 Ga0495654_0000975_7343_8092 244
427 3300046530 Ga0495654_0002324 Ga0495654_0002324_7425_8180 244
428 3300046533 Ga0495640_0009180 Ga0495640_0009180_1952_2695 244
429 3300046533 Ga0495640_0022843 Ga0495640_0022843_3609_4358 244
430 3300046536 Ga0495587_0006150 Ga0495587_0006150_265_1008 244
431 3300046538 Ga0495609_0000004 Ga0495609_0000004_475602_476351 244
432 3300046542 Ga0495597_0003675 Ga0495597_0003675_628_1377 244
433 3300046543 Ga0495645_0066573 Ga0495645_0066573_782_1525 244
434 3300046557 Ga0495622_0006457 Ga0495622_0006457_4261_5004 244
435 3300046557 Ga0495622_0016684 Ga0495622_0016684_1605_2354 244
436 3300046559 Ga0495667_0307888 Ga0495667_0307888_186_929 244
437 3300046616 Ga0495668_0000617 Ga0495668_0000617_6878_7633 244
438 3300046642 Ga0495634_0042858 Ga0495634_0042858_1634_2377 244
439 3300046642 Ga0495634_0061471 Ga0495634_0061471_1492_2241 244
440 3300046660 Ga0495625_0003058 Ga0495625_0003058_11124_11858 244
441 3300046660 Ga0495625_0014499 Ga0495625_0014499_797_1531 244
442 3300046660 Ga0495625_0070366 Ga0495625_0070366_729_1472 244
443 3300046663 Ga0495635_0006042 Ga0495635_0006042_3751_4500 244
444 3300046663 Ga0495635_0071469 Ga0495635_0071469_724_1467 244
445 3300046665 Ga0495661_0000005 Ga0495661_0000005_232165_232914 244
446 3300046665 Ga0495661_0050021 Ga0495661_0050021_626_1369 244
447 3300046675 Ga0495657_0087334 Ga0495657_0087334_98_841 244
448 3300046678 Ga0495599_0017237 Ga0495599_0017237_895_1638 244
449 3300046679 Ga0495623_0024468 Ga0495623_0024468_779_1522 244
450 3300046680 Ga0495646_0253677 Ga0495646_0253677_23_766 244
451 3300046689 Ga0495613_0018759 Ga0495613_0018759_2600_3343 244
452 3300046689 Ga0495613_0062229 Ga0495613_0062229_966_1715 244
453 3300046690 Ga0495624_0001660 Ga0495624_0001660_14801_15544 244
454 3300046690 Ga0495624_0082711 Ga0495624_0082711_900_1649 244
455 3300046691 Ga0495670_0019459 Ga0495670_0019459_2174_2923 244
456 3300046692 Ga0495671_0000149 Ga0495671_0000149_4257_5012 244
457 3300046692 Ga0495671_0007514 Ga0495671_0007514_725_1474 244
458 3300046694 Ga0495649_0000120 Ga0495649_0000120_16837_17580 244
459 3300046694 Ga0495649_0018977 Ga0495649_0018977_1935_2678 244
460 3300046794 Ga0495589_0013524 Ga0495589_0013524_1798_2547 244
461 3300046794 Ga0495589_0150735 Ga0495589_0150735_165_914 244
462 3300046809 Ga0495600_0016310 Ga0495600_0016310_1163_1906 244
463 3300046809 Ga0495600_0020333 Ga0495600_0020333_2921_3670 244
464 3300046809 Ga0495600_0179024 Ga0495600_0179024_572_1315 244
465 3300046810 Ga0495660_0002670 Ga0495660_0002670_7251_8000 244
466 3300046810 Ga0495660_0004430 Ga0495660_0004430_1263_2018 244
467 3300047315 Ga0495581_0165908 Ga0495581_0165908_438_1181 244
468 3300047317 Ga0495604_0003124 Ga0495604_0003124_2706_3449 244
469 3300047317 Ga0495604_0021114 Ga0495604_0021114_2487_3236 244
470 3300047317 Ga0495604_0047208 Ga0495604_0047208_117_860 244
471 3300047319 Ga0495674_0068531 Ga0495674_0068531_692_1435 244
472 3300047320 Ga0495672_0085495 Ga0495672_0085495_899_1642 244
473 3300047321 Ga0495676_0064798 Ga0495676_0064798_247_996 244
474 3300047322 Ga0495680_0007407 Ga0495680_0007407_7385_8128 244
475 3300047322 Ga0495680_0125777 Ga0495680_0125777_383_1126 244
476 3300047323 Ga0495683_0008864 Ga0495683_0008864_2834_3577 244
477 3300047443 Ga0495687_001114 Ga0495687_001114_19480_20223 244
478 3300047444 Ga0495675_0019041 Ga0495675_0019041_566_1309 244
479 3300047444 Ga0495675_0112200 Ga0495675_0112200_32_775 244
480 3300047444 Ga0495675_0323820 Ga0495675_0323820_40_774 244
481 3300047446 Ga0495679_002387 Ga0495679_002387_3231_3974 244
482 3300047446 Ga0495679_004802 Ga0495679_004802_1553_2308 244
483 3300047446 Ga0495679_023074 Ga0495679_023074_789_1544 244
484 3300047469 Ga0495673_0000017 Ga0495673_0000017_193766_194521 244
485 3300047469 Ga0495673_0033596 Ga0495673_0033596_750_1493 244
486 3300047471 Ga0495684_0074463 Ga0495684_0074463_166_909 244
487 3300047472 Ga0495686_0000198 Ga0495686_0000198_33600_34343 244
488 3300047472 Ga0495686_0000333 Ga0495686_0000333_73012_73767 244
489 3300047472 Ga0495686_0000710 Ga0495686_0000710_13007_13741 244
490 3300047472 Ga0495686_0001821 Ga0495686_0001821_18901_19644 244
491 3300047472 Ga0495686_0018020 Ga0495686_0018020_1992_2735 244
492 3300047472 Ga0495686_0074741 Ga0495686_0074741_18_752 244
493 3300047472 Ga0495686_0080841 Ga0495686_0080841_44_799 244
494 3300047472 Ga0495686_0092259 Ga0495686_0092259_213_968 244
495 3300047472 Ga0495686_0195305 Ga0495686_0195305_16_759 244
496 3300047673 Ga0495593_0012574 Ga0495593_0012574_2950_3693 244
497 3300047673 Ga0495593_0048003 Ga0495593_0048003_1053_1802 244
498 3300048088 Ga0495602_0087443 Ga0495602_0087443_935_1678 244
499 3300048088 Ga0495602_0194032 Ga0495602_0194032_132_875 244
500 3300048088 Ga0495602_0531848 Ga0495602_0531848_18_767 244
501 3300048089 Ga0495614_0007913 Ga0495614_0007913_2817_3560 244
502 3300048903 Ga0496100_0000408 Ga0496100_0000408_19017_19760 244
503 3300048903 Ga0496100_0003995 Ga0496100_0003995_1819_2571 244
504 3300048903 Ga0496100_0030135 Ga0496100_0030135_1584_2318 244
505 3300048903 Ga0496100_0655582 Ga0496100_0655582_35_769 244
506 3300048904 Ga0496101_0000237 Ga0496101_0000237_10348_11100 244
507 3300048904 Ga0496101_0000741 Ga0496101_0000741_17464_18207 244
508 3300048905 Ga0496102_0000007 Ga0496102_0000007_117766_118518 244
509 3300048905 Ga0496102_0000675 Ga0496102_0000675_15961_16704 244
510 3300048905 Ga0496102_0074271 Ga0496102_0074271_1072_1815 244
511 3300048905 Ga0496102_0142798 Ga0496102_0142798_557_1300 244
512 3300048906 Ga0496103_0000071 Ga0496103_0000071_1408_2160 244
513 3300048906 Ga0496103_0001123 Ga0496103_0001123_16021_16764 244
514 3300048906 Ga0496103_0067581 Ga0496103_0067581_118_861 244
515 3300048907 Ga0496104_0006567 Ga0496104_0006567_689_1432 244
516 3300048907 Ga0496104_0113893 Ga0496104_0113893_566_1315 244
517 3300048908 Ga0496105_0001384 Ga0496105_0001384_3980_4729 244
518 3300048908 Ga0496105_0002949 Ga0496105_0002949_1374_2117 244
519 3300048908 Ga0496105_0125315 Ga0496105_0125315_1322_2056 244
520 3300048910 Ga0496107_0027099 Ga0496107_0027099_2411_3163 244
521 3300048910 Ga0496107_0089835 Ga0496107_0089835_254_988 244
522 3300048913 Ga0496110_0046248 Ga0496110_0046248_913_1656 244
523 3300048915 Ga0496112_0056946 Ga0496112_0056946_1097_1840 244
524 3300048915 Ga0496112_0148415 Ga0496112_0148415_1252_1995 244
525 3300048915 Ga0496112_0153010 Ga0496112_0153010_1168_1902 244
526 3300048916 Ga0496113_0060153 Ga0496113_0060153_833_1582 244
527 3300048918 Ga0496115_0000013 Ga0496115_0000013_195763_196506 244
528 3300048918 Ga0496115_0001836 Ga0496115_0001836_6852_7586 244
529 3300048918 Ga0496115_0203976 Ga0496115_0203976_237_986 244
530 3300048918 Ga0496115_0339004 Ga0496115_0339004_102_845 244
531 3300048919 Ga0496116_0000033 Ga0496116_0000033_299653_300405 244
532 3300048919 Ga0496116_0004586 Ga0496116_0004586_9873_10607 244
533 3300048919 Ga0496116_0012188 Ga0496116_0012188_2199_2942 244
534 3300048919 Ga0496116_0019853 Ga0496116_0019853_3282_4025 244
535 3300048919 Ga0496116_0050759 Ga0496116_0050759_470_1249 244
536 3300048919 Ga0496116_0144325 Ga0496116_0144325_279_1031 244
537 3300048920 Ga0496117_0000025 Ga0496117_0000025_299583_300335 244
538 3300048920 Ga0496117_0001301 Ga0496117_0001301_18521_19264 244
539 3300048920 Ga0496117_0006113 Ga0496117_0006113_5542_6285 244
540 3300048920 Ga0496117_0023459 Ga0496117_0023459_2536_3279 244
541 3300048921 Ga0496118_0000023 Ga0496118_0000023_117772_118524 244
542 3300048921 Ga0496118_0000928 Ga0496118_0000928_16999_17742 244
543 3300048921 Ga0496118_0001539 Ga0496118_0001539_15946_16689 244
544 3300048921 Ga0496118_0002320 Ga0496118_0002320_14733_15467 244
545 3300048921 Ga0496118_0003433 Ga0496118_0003433_16405_17148 244
546 3300048921 Ga0496118_0003510 Ga0496118_0003510_15358_16092 244
547 3300048921 Ga0496118_0068921 Ga0496118_0068921_1637_2380 244
548 3300048921 Ga0496118_0206669 Ga0496118_0206669_157_891 244
549 3300048921 Ga0496118_0232324 Ga0496118_0232324_175_918 244
550 3300048922 Ga0496119_0000708 Ga0496119_0000708_31727_32461 244
551 3300048922 Ga0496119_0001159 Ga0496119_0001159_21893_22645 244
552 3300048922 Ga0496119_0006900 Ga0496119_0006900_6523_7266 244
553 3300048922 Ga0496119_0014245 Ga0496119_0014245_5095_5838 244
554 3300048922 Ga0496119_0031328 Ga0496119_0031328_830_1573 244
555 3300048922 Ga0496119_0197038 Ga0496119_0197038_85_828 244
556 3300048923 Ga0496120_0000281 Ga0496120_0000281_64095_64847 244
557 3300048923 Ga0496120_0021522 Ga0496120_0021522_1798_2547 244
558 3300048923 Ga0496120_0023864 Ga0496120_0023864_1417_2160 244
559 3300048923 Ga0496120_0092308 Ga0496120_0092308_327_1070 244
560 3300048924 Ga0496121_0000168 Ga0496121_0000168_25279_26028 244
561 3300048924 Ga0496121_0000642 Ga0496121_0000642_28443_29195 244
562 3300048924 Ga0496121_0000993 Ga0496121_0000993_45785_46528 244
563 3300048924 Ga0496121_0001151 Ga0496121_0001151_36373_37122 244
564 3300048924 Ga0496121_0001605 Ga0496121_0001605_18502_19245 244
565 3300048924 Ga0496121_0025389 Ga0496121_0025389_773_1516 244
566 3300048924 Ga0496121_0048199 Ga0496121_0048199_1549_2283 244
567 3300048924 Ga0496121_0065636 Ga0496121_0065636_371_1114 244
568 3300048924 Ga0496121_0069065 Ga0496121_0069065_2069_2812 244
569 3300048924 Ga0496121_0084224 Ga0496121_0084224_145_888 244
570 3300048924 Ga0496121_0103486 Ga0496121_0103486_615_1364 244
571 3300048924 Ga0496121_0152393 Ga0496121_0152393_237_971 244
572 3300048924 Ga0496121_0335274 Ga0496121_0335274_167_901 244
573 3300048924 Ga0496121_0423608 Ga0496121_0423608_109_852 244
574 3300048925 Ga0496122_0000261 Ga0496122_0000261_12255_12989 244
575 3300048925 Ga0496122_0014428 Ga0496122_0014428_685_1434 244
576 3300048925 Ga0496122_0034521 Ga0496122_0034521_53_787 244
577 3300048925 Ga0496122_0067349 Ga0496122_0067349_1705_2448 244
578 3300048926 Ga0496123_0000218 Ga0496123_0000218_9816_10550 244
579 3300048926 Ga0496123_0286750 Ga0496123_0286750_21_764 244
580 3300048927 Ga0496124_0002073 Ga0496124_0002073_26055_26810 244
581 3300048927 Ga0496124_0029645 Ga0496124_0029645_2971_3714 244
582 3300048927 Ga0496124_0037817 Ga0496124_0037817_3394_4137 244
583 3300048928 Ga0496125_0000312 Ga0496125_0000312_91475_92218 244
584 3300048928 Ga0496125_0000766 Ga0496125_0000766_1883_2617 244
585 3300048928 Ga0496125_0024470 Ga0496125_0024470_1029_1772 244
586 3300048928 Ga0496125_0154936 Ga0496125_0154936_292_1026 244
587 3300048928 Ga0496125_0273019 Ga0496125_0273019_61_804 244
588 3300048929 Ga0496126_0000189 Ga0496126_0000189_12860_13612 244
589 3300048929 Ga0496126_0022212 Ga0496126_0022212_3320_4069 244
590 3300048929 Ga0496126_0028662 Ga0496126_0028662_1032_1775 244
591 3300048929 Ga0496126_0030259 Ga0496126_0030259_3328_4209 244
592 3300048929 Ga0496126_0040617 Ga0496126_0040617_3398_4141 244
593 3300048929 Ga0496126_0067880 Ga0496126_0067880_872_1606 244
594 3300048929 Ga0496126_0226165 Ga0496126_0226165_193_936 244
595 3300048929 Ga0496126_0374912 Ga0496126_0374912_333_1082 244
596 3300049460 Ga0495682_0000428 Ga0495682_0000428_9111_9854 244
597 3300049460 Ga0495682_0000711 Ga0495682_0000711_16085_16834 244
598 3300049568 Ga0501031_0059763 Ga0501031_0059763_105_854 244
599 3300049569 Ga0501032_0258839 Ga0501032_0258839_322_1071 244
600 3300049570 Ga0501033_0047542 Ga0501033_0047542_1576_2310 244
601 3300049571 Ga0501034_0223576 Ga0501034_0223576_1085_1819 244
602 3300049822 Ga0501035_0064778 Ga0501035_0064778_83_817 244
603 3300049823 Ga0501044_0010325 Ga0501044_0010325_7819_8553 244
604 3300050492 nmdc:mga0yw44_1193_c1 nmdc:mga0yw44_1193_c1_1472_2215 244
605 3300050493 nmdc:mga0k408_155364_c1 nmdc:mga0k408_155364_c1_361_1095 244
606 3300050494 nmdc:mga06z11_108975_c1 nmdc:mga06z11_108975_c1_521_1264 244
607 3300050496 nmdc:mga07m45_52153_c1 nmdc:mga07m45_52153_c1_254_988 244
608 3300050516 nmdc:mga0sz30_39984_c1 nmdc:mga0sz30_39984_c1_528_1280 244
609 3300053085 Ga0495619_0203053 Ga0495619_0203053_61_954 244
610 3300053087 Ga0500643_001483 Ga0500643_001483_11255_11998 244
611 3300053087 Ga0500643_012565 Ga0500643_012565_574_1308 244
612 3300053088 Ga0500644_0088354 Ga0500644_0088354_403_1137 244
613 3300053093 Ga0500651_0008177 Ga0500651_0008177_5387_6121 244
614 3300053094 Ga0500566_0005153 Ga0500566_0005153_3263_3997 244
615 3300053115 Ga0500591_105769 Ga0500591_105769_381_1124 244
616 3300053119 Ga0500595_001400 Ga0500595_001400_5751_6485 244
617 3300053120 Ga0500597_000296 Ga0500597_000296_7193_7927 244
618 3300053122 Ga0500608_001747 Ga0500608_001747_6639_7382 244
619 3300053133 Ga0500655_008745 Ga0500655_008745_138_881 244
620 3300053136 Ga0500559_0000006 Ga0500559_0000006_196040_196774 244
621 3300053136 Ga0500559_0017817 Ga0500559_0017817_667_1401 244
622 3300053136 Ga0500559_0028952 Ga0500559_0028952_565_1314 244
623 3300053136 Ga0500559_0111707 Ga0500559_0111707_191_925 244
624 3300053148 Ga0500590_000200 Ga0500590_000200_437_1330 244
625 3300053151 Ga0500604_0000038 Ga0500604_0000038_29803_30546 244
626 3300053153 Ga0500616_0000483 Ga0500616_0000483_41312_42046 244
627 3300053156 Ga0500622_0002675 Ga0500622_0002675_10407_11150 244
628 3300053158 Ga0500627_0055845 Ga0500627_0055845_295_1038 244
629 3300053161 Ga0500634_0024950 Ga0500634_0024950_265_999 244
630 3300053178 Ga0500637_0096758 Ga0500637_0096758_379_1128 244
631 3300053726 Ga0500584_041143 Ga0500584_041143_703_1437 244
632 3300053730 Ga0500645_000710 Ga0500645_000710_1686_2432 244
633 iso_pu_bacteria 2884852848 2884855487 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

51

240

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

57

291

0.93

PF08659

KR

KR domain

52

228

0.9

PF23441

44

293

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9866 1 244
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9865 1 244
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9861 1 244
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.984 1 244
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9826 1 244
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9722 1 244 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9641 2 244 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9637 2 84 3.40.50.720
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9591 1 244 3.40.50.720
af_I6YCF0_1_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9582 1 237 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2R7KXK9-F1-model_v4 deleted 0.9924 1 168
AF-A0A559M2Z8-F1-model_v4 Putative oxidoreductase 0.9906 2 151 GO:0016491
AF-A0A2V6STH1-F1-model_v4 Oxidoreductase 0.9893 1 181 GO:0016491
AF-A0A436AKS0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9891 1 134 GO:0016491
AF-A0A4R7QM76-F1-model_v4 deleted 0.9867 1 186

Feature Viewer

pLDDT pTM Quality
94.68 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map