F471100

General Info

Members Datasets Scaffolds Average Seq Length
633 198 1266 66

Family's Representative Sequence

Representative Sequence 3300046500|Ga0495596_0087594|Ga0495596_0087594_665_892
Length 75
Sequence MRFRHYKGGLYELVCEAVLEADHTPVIVYRGEDGRTWVRPRDVFFETVEAGGERVPRFAAVSTAVCTLMSGPVLP

Samples

Sample ID Description Type Environment
1 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
22 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
23 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
28 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
29 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
30 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
31 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
32 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
33 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
36 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
41 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
42 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
43 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
44 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
48 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
49 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
50 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
51 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
52 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
53 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
54 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
55 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
56 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
57 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
58 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
59 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
60 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
61 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
62 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
63 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
64 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
68 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
69 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
70 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
71 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
72 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
75 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
76 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
81 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
82 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
85 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
90 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
134 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
159 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
162 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
163 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
164 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 2643221556 Massilia sp. Root1485 Isolate Unclassified
195 2643221684 Massilia sp. Root133 Isolate Unclassified
196 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
197 2857558681 Duganella sp. R-74565 Isolate Unclassified
198 2919476304 Duganella sp. 3397 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.31
Metatranscriptomes 7.9
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 4.58
Rhizosphere 91.63
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495596_0087594 3300046500 Bacteria 1208
2 Ga0006759J45824_1014301 3300003163 Bacteria 1028
3 Ga0006759J45824_1060320 3300003163 Bacteria 540
4 Ga0007417J51691_1036584 3300003544 Bacteria 843
5 Ga0007410J51695_1005934 3300003574 Bacteria 963
6 Ga0007409J51694_1001813 3300003575 Bacteria 2390
7 Ga0007416J51690_1020973 3300003577 Bacteria 674
8 Ga0032354_1011727 3300003693 Bacteria 1038
9 Ga0006780_1021424 3300003735 Bacteria 833
10 Ga0055525_1000029 3300003759 Bacteria 320663
11 Ga0065165_1001814 3300005262 Bacteria 20920
12 Ga0065165_1040896 3300005262 Bacteria 1379
13 Ga0065714_10344285 3300005288 Bacteria 642
14 Ga0070658_11002343 3300005327 Bacteria 726
15 Ga0070660_100015384 3300005339 Bacteria 5522
16 Ga0070659_100045144 3300005366 Bacteria 3451
17 Ga0068855_100674269 3300005563 Bacteria 1108
18 Ga0068857_102304056 3300005577 Bacteria 529
19 Ga0068852_101082457 3300005616 Bacteria 821
20 Ga0157370_10997802 3300013104 Bacteria 758
21 Ga0157372_11444200 3300013307 Bacteria 793
22 Ga0157372_12171367 3300013307 Bacteria 638
23 Ga0209563_100003 3300025230 Bacteria 1932942
24 Ga0209437_101823 3300025233 Bacteria 4564
25 Ga0209646_1000036 3300025246 Bacteria 358864
26 Ga0209677_103237 3300025253 Bacteria 5428
27 Ga0209564_1000060 3300025295 Bacteria 325890
28 Ga0207657_10159417 3300025919 Bacteria 1833
29 Ga0207698_11762019 3300026142 Bacteria 635
30 Ga0316177_1015883 3300030731 Bacteria 2658
31 Ga0316177_1109599 3300030731 Bacteria 1319
32 Ga0314311_1210205 3300030733 Bacteria 978
33 Ga0316178_1072012 3300030735 Bacteria 563
34 Ga0316178_1083625 3300030735 Bacteria 1596
35 Ga0316180_1161065 3300030736 Bacteria 3075
36 Ga0316183_1122591 3300030742 Bacteria 1829
37 Ga0316181_1282878 3300030744 Bacteria 1820
38 Ga0316182_1184138 3300030745 Bacteria 684
39 Ga0316182_1385379 3300030745 Bacteria 582
40 Ga0307408_100858398 3300031548 Bacteria 828
41 Ga0395899_0234237 3300037312 Bacteria 1266
42 Ga0395899_0554011 3300037312 Bacteria 738
43 Ga0395900_0000123 3300037418 Bacteria 133326
44 Ga0395900_0005755 3300037418 Bacteria 12952
45 Ga0395898_0913346 3300037466 Bacteria 816
46 Ga0395898_1283457 3300037466 Bacteria 662
47 Ga0395905_0456610 3300037471 Bacteria 1176
48 Ga0395905_0576218 3300037471 Bacteria 1027
49 Ga0395901_0002179 3300038443 Bacteria 19992
50 Ga0439453_0146788 3300041408 Bacteria 557
51 Ga0439450_005004 3300042008 Bacteria 2302
52 Ga0450897_008994 3300042128 Bacteria 938
53 Ga0466969_0010474 3300044656 Bacteria 4914
54 Ga0466965_0268115 3300044683 Bacteria 919
55 Ga0466966_0219015 3300044684 Bacteria 1149
56 Ga0466966_0336220 3300044684 Bacteria 907
57 Ga0466961_0094055 3300044693 Bacteria 1891
58 Ga0466961_0269061 3300044693 Bacteria 1044
59 Ga0466957_0152240 3300044842 Bacteria 1496
60 Ga0466959_0050342 3300045049 Bacteria 3058
61 Ga0466958_0918450 3300045836 Bacteria 571
62 Ga0495617_000034 3300046452 Bacteria 147232
63 Ga0495617_030512 3300046452 Bacteria 1812
64 Ga0495627_000208 3300046453 Bacteria 63467
65 Ga0495627_007582 3300046453 Bacteria 4145
66 Ga0495627_034898 3300046453 Bacteria 1569
67 Ga0495627_037577 3300046453 Bacteria 1501
68 Ga0495627_156081 3300046453 Bacteria 636
69 Ga0495603_0028054 3300046455 Bacteria 3395
70 Ga0495603_0066151 3300046455 Bacteria 2129
71 Ga0495603_0239033 3300046455 Unclassified 1046
72 Ga0495603_0239319 3300046455 Bacteria 1045
73 Ga0495603_0645224 3300046455 Unclassified 606
74 Ga0495590_0000189 3300046457 Bacteria 35045
75 Ga0495590_0022913 3300046457 Bacteria 2207
76 Ga0495590_0122232 3300046457 Bacteria 933
77 Ga0495591_076194 3300046458 Bacteria 862
78 Ga0495629_0012541 3300046459 Bacteria 6138
79 Ga0495629_0024040 3300046459 Bacteria 4339
80 Ga0495629_0068858 3300046459 Bacteria 2469
81 Ga0495629_0538730 3300046459 Bacteria 784
82 Ga0495638_0000765 3300046460 Bacteria 34151
83 Ga0495638_0091978 3300046460 Bacteria 1826
84 Ga0495638_0175541 3300046460 Bacteria 1226
85 Ga0495638_0618213 3300046460 Bacteria 530
86 Ga0495653_0013586 3300046463 Bacteria 6635
87 Ga0495653_0023881 3300046463 Bacteria 4934
88 Ga0495653_0064408 3300046463 Bacteria 2762
89 Ga0495653_0078579 3300046463 Bacteria 2446
90 Ga0495653_0689185 3300046463 Unclassified 621
91 Ga0495650_0001069 3300046471 Bacteria 30311
92 Ga0495650_0001491 3300046471 Bacteria 22322
93 Ga0495650_0009362 3300046471 Bacteria 5580
94 Ga0495650_0139640 3300046471 Bacteria 877
95 Ga0495580_0009567 3300046472 Bacteria 7614
96 Ga0495580_0047743 3300046472 Bacteria 3034
97 Ga0495580_0180574 3300046472 Bacteria 1457
98 Ga0495582_0001943 3300046473 Bacteria 11611
99 Ga0495582_0030090 3300046473 Bacteria 2979
100 Ga0495582_0191698 3300046473 Bacteria 1166
101 Ga0495605_0000029 3300046474 Bacteria 215329
102 Ga0495605_0000151 3300046474 Bacteria 89442
103 Ga0495605_0008388 3300046474 Bacteria 5843
104 Ga0495605_0028857 3300046474 Bacteria 2860
105 Ga0495605_0085858 3300046474 Bacteria 1464
106 Ga0495605_0202741 3300046474 Bacteria 864
107 Ga0495605_0205298 3300046474 Bacteria 857
108 Ga0495605_0249688 3300046474 Bacteria 759
109 Ga0495605_0264971 3300046474 Bacteria 733
110 Ga0495639_0030974 3300046475 Bacteria 2379
111 Ga0495639_0141200 3300046475 Bacteria 1158
112 Ga0495639_0202612 3300046475 Unclassified 972
113 Ga0495639_0608533 3300046475 Unclassified 562
114 Ga0495664_0641672 3300046477 Bacteria 630
115 Ga0495584_0005394 3300046491 Bacteria 6773
116 Ga0495584_0048471 3300046491 Bacteria 2141
117 Ga0495584_0078447 3300046491 Bacteria 1662
118 Ga0495584_0174242 3300046491 Bacteria 1093
119 Ga0495584_0260254 3300046491 Bacteria 882
120 Ga0495584_0468033 3300046491 Bacteria 641
121 Ga0495585_0002050 3300046492 Bacteria 14848
122 Ga0495585_0007514 3300046492 Bacteria 6667
123 Ga0495585_0026885 3300046492 Bacteria 3285
124 Ga0495585_0043776 3300046492 Bacteria 2502
125 Ga0495585_0052706 3300046492 Bacteria 2252
126 Ga0495585_0096433 3300046492 Bacteria 1586
127 Ga0495585_0109699 3300046492 Bacteria 1468
128 Ga0495585_0111854 3300046492 Bacteria 1451
129 Ga0495585_0120444 3300046492 Bacteria 1388
130 Ga0495585_0135060 3300046492 Bacteria 1295
131 Ga0495585_0347898 3300046492 Bacteria 720
132 Ga0495585_0379431 3300046492 Bacteria 683
133 Ga0495585_0474336 3300046492 Bacteria 596
134 Ga0495594_0022874 3300046499 Bacteria 3346
135 Ga0495594_0089211 3300046499 Bacteria 1726
136 Ga0495594_0107649 3300046499 Bacteria 1570
137 Ga0495594_0198166 3300046499 Bacteria 1144
138 Ga0495594_0355259 3300046499 Unclassified 834
139 Ga0495594_0406459 3300046499 Bacteria 774
140 Ga0495596_0007468 3300046500 Bacteria 4929
141 Ga0495596_0016392 3300046500 Bacteria 3079
142 Ga0495596_0032442 3300046500 Bacteria 2082
143 Ga0495596_0049926 3300046500 Bacteria 1640
144 Ga0495596_0059042 3300046500 Bacteria 1495
145 Ga0495596_0332024 3300046500 Bacteria 591
146 Ga0495596_0333260 3300046500 Unclassified 590
147 Ga0495607_0002923 3300046501 Bacteria 13462
148 Ga0495607_0004090 3300046501 Bacteria 10898
149 Ga0495607_0004963 3300046501 Bacteria 9660
150 Ga0495607_0015886 3300046501 Bacteria 4869
151 Ga0495607_0091837 3300046501 Bacteria 1643
152 Ga0495607_0146573 3300046501 Bacteria 1212
153 Ga0495607_0467575 3300046501 Bacteria 564
154 Ga0495607_0516886 3300046501 Bacteria 528
155 Ga0495583_0001516 3300046506 Bacteria 23065
156 Ga0495583_0003802 3300046506 Bacteria 11208
157 Ga0495583_0004862 3300046506 Bacteria 9389
158 Ga0495583_0005158 3300046506 Bacteria 8994
159 Ga0495583_0013850 3300046506 Bacteria 4472
160 Ga0495583_0019240 3300046506 Bacteria 3569
161 Ga0495583_0025686 3300046506 Bacteria 2937
162 Ga0495583_0048121 3300046506 Bacteria 1958
163 Ga0495583_0081650 3300046506 Bacteria 1403
164 Ga0495583_0136313 3300046506 Bacteria 1024
165 Ga0495583_0235984 3300046506 Unclassified 736
166 Ga0495583_0294410 3300046506 Bacteria 645
167 Ga0495606_0003880 3300046507 Bacteria 15427
168 Ga0495606_0003966 3300046507 Bacteria 15179
169 Ga0495606_0084230 3300046507 Bacteria 1969
170 Ga0495606_0115398 3300046507 Bacteria 1614
171 Ga0495606_0149946 3300046507 Bacteria 1369
172 Ga0495606_0223526 3300046507 Bacteria 1059
173 Ga0495606_0259277 3300046507 Bacteria 960
174 Ga0495606_0445423 3300046507 Bacteria 664
175 Ga0495606_0657436 3300046507 Bacteria 506
176 Ga0495610_0008294 3300046512 Bacteria 6747
177 Ga0495610_0074359 3300046512 Bacteria 1577
178 Ga0495610_0158970 3300046512 Bacteria 957
179 Ga0495610_0184236 3300046512 Bacteria 866
180 Ga0495616_0000551 3300046513 Bacteria 28291
181 Ga0495616_0012476 3300046513 Bacteria 4823
182 Ga0495616_0024262 3300046513 Bacteria 3253
183 Ga0495616_0031623 3300046513 Bacteria 2769
184 Ga0495616_0085920 3300046513 Bacteria 1497
185 Ga0495616_0115944 3300046513 Bacteria 1240
186 Ga0495616_0118102 3300046513 Bacteria 1226
187 Ga0495616_0139864 3300046513 Bacteria 1103
188 Ga0495616_0454200 3300046513 Bacteria 518
189 Ga0495620_0002957 3300046515 Bacteria 9776
190 Ga0495628_0331192 3300046516 Bacteria 1122
191 Ga0495630_0016553 3300046517 Bacteria 5392
192 Ga0495630_1345117 3300046517 Bacteria 538
193 Ga0495631_0003104 3300046518 Bacteria 9155
194 Ga0495631_0006235 3300046518 Bacteria 6177
195 Ga0495631_0008829 3300046518 Bacteria 5061
196 Ga0495631_0015244 3300046518 Bacteria 3688
197 Ga0495631_0017352 3300046518 Bacteria 3407
198 Ga0495631_0056119 3300046518 Bacteria 1715
199 Ga0495631_0056398 3300046518 Bacteria 1710
200 Ga0495631_0080506 3300046518 Bacteria 1405
201 Ga0495631_0106656 3300046518 Bacteria 1204
202 Ga0495631_0113015 3300046518 Bacteria 1167
203 Ga0495631_0125534 3300046518 Bacteria 1103
204 Ga0495631_0409927 3300046518 Bacteria 577
205 Ga0495632_0000774 3300046519 Bacteria 28699
206 Ga0495632_0139984 3300046519 Bacteria 1123
207 Ga0495643_0001479 3300046522 Bacteria 21441
208 Ga0495643_0001689 3300046522 Bacteria 19245
209 Ga0495643_0045842 3300046522 Bacteria 2372
210 Ga0495643_0077674 3300046522 Bacteria 1734
211 Ga0495643_0089561 3300046522 Bacteria 1589
212 Ga0495643_0187552 3300046522 Bacteria 1000
213 Ga0495644_0004899 3300046523 Bacteria 5255
214 Ga0495644_0022106 3300046523 Bacteria 2424
215 Ga0495644_0044783 3300046523 Bacteria 1664
216 Ga0495644_0108926 3300046523 Bacteria 1050
217 Ga0495644_0117351 3300046523 Bacteria 1011
218 Ga0495648_0000806 3300046524 Bacteria 33209
219 Ga0495648_0001432 3300046524 Bacteria 23348
220 Ga0495648_0036112 3300046524 Bacteria 3194
221 Ga0495648_0037509 3300046524 Bacteria 3113
222 Ga0495648_0081182 3300046524 Bacteria 1845
223 Ga0495648_0225561 3300046524 Bacteria 921
224 Ga0495648_0298405 3300046524 Bacteria 756
225 Ga0495648_0445853 3300046524 Unclassified 567
226 Ga0495663_0004119 3300046525 Bacteria 4113
227 Ga0495663_0027584 3300046525 Bacteria 1667
228 Ga0495663_0221266 3300046525 Bacteria 665
229 Ga0495666_0002764 3300046526 Bacteria 8763
230 Ga0495666_0011490 3300046526 Bacteria 4414
231 Ga0495666_0020999 3300046526 Bacteria 3233
232 Ga0495666_0028047 3300046526 Bacteria 2771
233 Ga0495666_0053187 3300046526 Bacteria 1944
234 Ga0495666_0208322 3300046526 Bacteria 897
235 Ga0495642_0001415 3300046528 Bacteria 10754
236 Ga0495642_0001571 3300046528 Bacteria 10024
237 Ga0495642_0002435 3300046528 Bacteria 7576
238 Ga0495642_0003022 3300046528 Bacteria 6696
239 Ga0495642_0003513 3300046528 Bacteria 6172
240 Ga0495642_0028764 3300046528 Bacteria 2215
241 Ga0495642_0086410 3300046528 Bacteria 1325
242 Ga0495642_0092639 3300046528 Bacteria 1280
243 Ga0495642_0182469 3300046528 Bacteria 914
244 Ga0495642_0254702 3300046528 Bacteria 767
245 Ga0495642_0307158 3300046528 Bacteria 695
246 Ga0495642_0421187 3300046528 Bacteria 589
247 Ga0495652_0022220 3300046529 Bacteria 5631
248 Ga0495652_0196542 3300046529 Bacteria 1534
249 Ga0495654_0004109 3300046530 Bacteria 8732
250 Ga0495654_0011555 3300046530 Bacteria 4775
251 Ga0495654_0017825 3300046530 Bacteria 3727
252 Ga0495654_0131569 3300046530 Bacteria 1123
253 Ga0495654_0240212 3300046530 Bacteria 758
254 Ga0495665_0007844 3300046531 Bacteria 5779
255 Ga0495665_0009788 3300046531 Bacteria 5189
256 Ga0495665_0027664 3300046531 Bacteria 3042
257 Ga0495665_0158227 3300046531 Bacteria 1181
258 Ga0495665_0159169 3300046531 Bacteria 1177
259 Ga0495640_0183847 3300046533 Bacteria 1331
260 Ga0495640_0745019 3300046533 Bacteria 586
261 Ga0495586_0001198 3300046535 Bacteria 14567
262 Ga0495586_0007136 3300046535 Bacteria 5953
263 Ga0495586_0033293 3300046535 Bacteria 2765
264 Ga0495586_0043564 3300046535 Bacteria 2417
265 Ga0495586_0417592 3300046535 Bacteria 772
266 Ga0495586_0549173 3300046535 Bacteria 667
267 Ga0495587_0004267 3300046536 Bacteria 9441
268 Ga0495587_0032376 3300046536 Bacteria 3161
269 Ga0495587_0164926 3300046536 Bacteria 1260
270 Ga0495587_0198747 3300046536 Bacteria 1134
271 Ga0495609_0019636 3300046538 Bacteria 3124
272 Ga0495609_0032824 3300046538 Bacteria 2357
273 Ga0495609_0035651 3300046538 Bacteria 2251
274 Ga0495609_0037177 3300046538 Bacteria 2196
275 Ga0495609_0049445 3300046538 Bacteria 1877
276 Ga0495609_0056590 3300046538 Bacteria 1737
277 Ga0495609_0057164 3300046538 Bacteria 1727
278 Ga0495609_0092993 3300046538 Bacteria 1310
279 Ga0495609_0145396 3300046538 Bacteria 1010
280 Ga0495609_0257620 3300046538 Unclassified 717
281 Ga0495609_0309983 3300046538 Bacteria 641
282 Ga0495609_0364356 3300046538 Bacteria 582
283 Ga0495597_0001069 3300046542 Bacteria 20901
284 Ga0495597_0001698 3300046542 Bacteria 15249
285 Ga0495597_0008913 3300046542 Bacteria 5003
286 Ga0495597_0010345 3300046542 Bacteria 4563
287 Ga0495597_0031150 3300046542 Bacteria 2428
288 Ga0495597_0033950 3300046542 Bacteria 2307
289 Ga0495597_0086508 3300046542 Unclassified 1334
290 Ga0495597_0128982 3300046542 Bacteria 1050
291 Ga0495597_0162618 3300046542 Bacteria 910
292 Ga0495597_0398881 3300046542 Unclassified 523
293 Ga0495645_0097091 3300046543 Bacteria 2099
294 Ga0495622_0001583 3300046557 Bacteria 11259
295 Ga0495622_0015453 3300046557 Bacteria 3549
296 Ga0495622_0017983 3300046557 Bacteria 3292
297 Ga0495622_0032400 3300046557 Bacteria 2440
298 Ga0495622_0062290 3300046557 Bacteria 1726
299 Ga0495622_0083298 3300046557 Bacteria 1471
300 Ga0495633_0000606 3300046558 Bacteria 34316
301 Ga0495633_0009123 3300046558 Bacteria 5507
302 Ga0495633_0023816 3300046558 Bacteria 3030
303 Ga0495633_0058375 3300046558 Bacteria 1811
304 Ga0495633_0078262 3300046558 Bacteria 1539
305 Ga0495633_0093216 3300046558 Bacteria 1400
306 Ga0495633_0150326 3300046558 Bacteria 1076
307 Ga0495633_0243377 3300046558 Bacteria 821
308 Ga0495633_0378781 3300046558 Bacteria 640
309 Ga0495633_0466055 3300046558 Bacteria 570
310 Ga0495667_0299658 3300046559 Unclassified 1018
311 Ga0495656_0007094 3300046615 Bacteria 3951
312 Ga0495656_0024611 3300046615 Bacteria 2379
313 Ga0495656_0121801 3300046615 Bacteria 1232
314 Ga0495656_0207840 3300046615 Bacteria 974
315 Ga0495656_0308215 3300046615 Bacteria 813
316 Ga0495656_0589339 3300046615 Bacteria 594
317 Ga0495656_0633698 3300046615 Bacteria 573
318 Ga0495656_0644272 3300046615 Bacteria 568
319 Ga0495668_0001705 3300046616 Bacteria 20303
320 Ga0495668_0003015 3300046616 Bacteria 13135
321 Ga0495668_0016682 3300046616 Bacteria 4269
322 Ga0495668_0062903 3300046616 Bacteria 2044
323 Ga0495668_0126072 3300046616 Bacteria 1401
324 Ga0495668_0126252 3300046616 Bacteria 1400
325 Ga0495668_0137688 3300046616 Bacteria 1336
326 Ga0495668_0181905 3300046616 Bacteria 1151
327 Ga0495668_0189507 3300046616 Bacteria 1126
328 Ga0495668_0275084 3300046616 Bacteria 922
329 Ga0495668_0376640 3300046616 Bacteria 779
330 Ga0495634_0009751 3300046642 Bacteria 7065
331 Ga0495634_0031184 3300046642 Bacteria 3673
332 Ga0495611_0005622 3300046648 Bacteria 5346
333 Ga0495611_0006507 3300046648 Bacteria 4978
334 Ga0495611_0018916 3300046648 Bacteria 2956
335 Ga0495611_0071871 3300046648 Bacteria 1582
336 Ga0495611_0104787 3300046648 Bacteria 1315
337 Ga0495611_0161934 3300046648 Bacteria 1045
338 Ga0495625_0001154 3300046660 Bacteria 34018
339 Ga0495625_0024391 3300046660 Bacteria 4604
340 Ga0495625_0091765 3300046660 Bacteria 2099
341 Ga0495625_0155375 3300046660 Bacteria 1535
342 Ga0495625_0165376 3300046660 Bacteria 1479
343 Ga0495625_0185002 3300046660 Bacteria 1383
344 Ga0495625_0199698 3300046660 Bacteria 1320
345 Ga0495625_0218142 3300046660 Bacteria 1251
346 Ga0495625_0397066 3300046660 Bacteria 862
347 Ga0495625_0509920 3300046660 Bacteria 734
348 Ga0495635_0002935 3300046663 Bacteria 11712
349 Ga0495635_0184410 3300046663 Bacteria 1418
350 Ga0495635_0268061 3300046663 Bacteria 1149
351 Ga0495635_0343269 3300046663 Bacteria 997
352 Ga0495659_0030908 3300046664 Bacteria 1866
353 Ga0495659_0040386 3300046664 Bacteria 1663
354 Ga0495659_0078662 3300046664 Bacteria 1248
355 Ga0495659_0142596 3300046664 Bacteria 957
356 Ga0495661_0002594 3300046665 Bacteria 13854
357 Ga0495661_0004307 3300046665 Bacteria 10314
358 Ga0495661_0013222 3300046665 Bacteria 5551
359 Ga0495661_0021771 3300046665 Bacteria 4174
360 Ga0495661_0048155 3300046665 Bacteria 2591
361 Ga0495661_0059950 3300046665 Bacteria 2262
362 Ga0495661_0124892 3300046665 Bacteria 1417
363 Ga0495661_0141434 3300046665 Bacteria 1308
364 Ga0495661_0145395 3300046665 Bacteria 1285
365 Ga0495661_0154464 3300046665 Bacteria 1237
366 Ga0495661_0213771 3300046665 Bacteria 1002
367 Ga0495661_0265937 3300046665 Bacteria 869
368 Ga0495661_0463684 3300046665 Bacteria 608
369 Ga0495661_0588502 3300046665 Bacteria 524
370 Ga0495588_0000086 3300046674 Bacteria 193241
371 Ga0495588_0004845 3300046674 Bacteria 5963
372 Ga0495588_0005137 3300046674 Bacteria 5814
373 Ga0495588_0006099 3300046674 Bacteria 5410
374 Ga0495588_0007561 3300046674 Bacteria 4951
375 Ga0495588_0012569 3300046674 Bacteria 4006
376 Ga0495588_0019698 3300046674 Bacteria 3308
377 Ga0495588_0046190 3300046674 Bacteria 2233
378 Ga0495588_0046827 3300046674 Bacteria 2218
379 Ga0495588_0051754 3300046674 Bacteria 2115
380 Ga0495588_0076154 3300046674 Bacteria 1748
381 Ga0495588_0167318 3300046674 Bacteria 1162
382 Ga0495588_0429299 3300046674 Bacteria 693
383 Ga0495588_0457142 3300046674 Bacteria 670
384 Ga0495588_0491929 3300046674 Bacteria 643
385 Ga0495599_0756016 3300046678 Bacteria 557
386 Ga0495623_0003404 3300046679 Bacteria 10522
387 Ga0495623_0013944 3300046679 Bacteria 5210
388 Ga0495623_0087378 3300046679 Bacteria 1920
389 Ga0495623_0214887 3300046679 Bacteria 1099
390 Ga0495623_0317508 3300046679 Bacteria 856
391 Ga0495646_0113218 3300046680 Bacteria 1543
392 Ga0495646_0204642 3300046680 Bacteria 1074
393 Ga0495646_0588938 3300046680 Bacteria 566
394 Ga0495669_0000180 3300046684 Bacteria 39607
395 Ga0495669_0008778 3300046684 Bacteria 4256
396 Ga0495669_0049996 3300046684 Bacteria 1873
397 Ga0495669_0139895 3300046684 Bacteria 1142
398 Ga0495613_0009611 3300046689 Bacteria 7184
399 Ga0495613_0185218 3300046689 Bacteria 1473
400 Ga0495613_0610943 3300046689 Bacteria 725
401 Ga0495624_0096763 3300046690 Bacteria 1818
402 Ga0495624_0110549 3300046690 Bacteria 1690
403 Ga0495624_0548574 3300046690 Bacteria 690
404 Ga0495670_0002431 3300046691 Bacteria 9201
405 Ga0495670_0002485 3300046691 Bacteria 9106
406 Ga0495670_0007574 3300046691 Bacteria 5335
407 Ga0495670_0093211 3300046691 Bacteria 1543
408 Ga0495670_0124550 3300046691 Bacteria 1340
409 Ga0495670_0221385 3300046691 Bacteria 1005
410 Ga0495670_0243134 3300046691 Bacteria 958
411 Ga0495670_0337098 3300046691 Bacteria 811
412 Ga0495670_0475925 3300046691 Bacteria 677
413 Ga0495671_0000188 3300046692 Bacteria 54628
414 Ga0495671_0030706 3300046692 Bacteria 2750
415 Ga0495671_0031985 3300046692 Bacteria 2687
416 Ga0495671_0068816 3300046692 Bacteria 1740
417 Ga0495671_0082168 3300046692 Bacteria 1578
418 Ga0495649_0033570 3300046694 Bacteria 2824
419 Ga0495649_0056361 3300046694 Bacteria 2122
420 Ga0495649_0087982 3300046694 Bacteria 1657
421 Ga0495649_0094213 3300046694 Bacteria 1594
422 Ga0495649_0156818 3300046694 Bacteria 1194
423 Ga0495649_0164655 3300046694 Bacteria 1162
424 Ga0495649_0211725 3300046694 Bacteria 1004
425 Ga0495649_0499006 3300046694 Bacteria 605
426 Ga0495589_0000166 3300046794 Bacteria 60018
427 Ga0495589_0004062 3300046794 Bacteria 7842
428 Ga0495589_0033658 3300046794 Bacteria 2572
429 Ga0495589_0052747 3300046794 Bacteria 2008
430 Ga0495589_0084047 3300046794 Bacteria 1547
431 Ga0495589_0105159 3300046794 Bacteria 1364
432 Ga0495589_0327482 3300046794 Bacteria 707
433 Ga0495660_0000067 3300046810 Bacteria 119390
434 Ga0495660_0001360 3300046810 Bacteria 16828
435 Ga0495660_0009431 3300046810 Bacteria 5692
436 Ga0495660_0061528 3300046810 Bacteria 2014
437 Ga0495660_0130817 3300046810 Bacteria 1259
438 Ga0495660_0137451 3300046810 Bacteria 1219
439 Ga0495660_0171689 3300046810 Bacteria 1055
440 Ga0495660_0235284 3300046810 Bacteria 856
441 Ga0495581_0011595 3300047315 Bacteria 5100
442 Ga0495581_0018205 3300047315 Bacteria 4080
443 Ga0495581_0036691 3300047315 Bacteria 2836
444 Ga0495581_0099923 3300047315 Bacteria 1685
445 Ga0495604_0004350 3300047317 Bacteria 11218
446 Ga0495604_0009027 3300047317 Bacteria 7889
447 Ga0495604_0088363 3300047317 Bacteria 2305
448 Ga0495604_0271254 3300047317 Bacteria 1149
449 Ga0495604_0668346 3300047317 Bacteria 661
450 Ga0495636_0027635 3300047318 Bacteria 2311
451 Ga0495636_0029775 3300047318 Bacteria 2229
452 Ga0495636_0040299 3300047318 Bacteria 1936
453 Ga0495636_0065221 3300047318 Bacteria 1547
454 Ga0495636_0248331 3300047318 Bacteria 822
455 Ga0495636_0510050 3300047318 Bacteria 582
456 Ga0495636_0686131 3300047318 Bacteria 505
457 Ga0495674_0001855 3300047319 Bacteria 20817
458 Ga0495674_0098850 3300047319 Bacteria 2485
459 Ga0495672_0005511 3300047320 Bacteria 10023
460 Ga0495672_0010652 3300047320 Bacteria 6532
461 Ga0495672_0042541 3300047320 Bacteria 2739
462 Ga0495676_0000133 3300047321 Bacteria 56165
463 Ga0495676_0037833 3300047321 Bacteria 4013
464 Ga0495676_0448524 3300047321 Unclassified 851
465 Ga0495680_0021225 3300047322 Bacteria 5440
466 Ga0495680_0087195 3300047322 Bacteria 2348
467 Ga0495680_0140179 3300047322 Bacteria 1770
468 Ga0495680_0178710 3300047322 Bacteria 1533
469 Ga0495680_0486983 3300047322 Bacteria 839
470 Ga0495683_0004383 3300047323 Bacteria 8028
471 Ga0495683_0005313 3300047323 Bacteria 7156
472 Ga0495683_0081269 3300047323 Bacteria 1580
473 Ga0495683_0426545 3300047323 Bacteria 547
474 Ga0495687_000126 3300047443 Bacteria 117879
475 Ga0495687_000252 3300047443 Bacteria 72401
476 Ga0495687_001088 3300047443 Bacteria 26668
477 Ga0495687_003194 3300047443 Bacteria 12165
478 Ga0495687_003802 3300047443 Bacteria 10649
479 Ga0495687_069762 3300047443 Bacteria 1413
480 Ga0495687_093220 3300047443 Bacteria 1148
481 Ga0495675_0004585 3300047444 Bacteria 8384
482 Ga0495675_0006208 3300047444 Bacteria 7307
483 Ga0495675_0023020 3300047444 Bacteria 3970
484 Ga0495675_0137530 3300047444 Bacteria 1516
485 Ga0495675_0161343 3300047444 Bacteria 1380
486 Ga0495677_0002372 3300047445 Bacteria 7404
487 Ga0495677_0002398 3300047445 Bacteria 7363
488 Ga0495677_0004336 3300047445 Bacteria 5451
489 Ga0495677_0011483 3300047445 Bacteria 3240
490 Ga0495677_0062748 3300047445 Bacteria 1379
491 Ga0495677_0077786 3300047445 Bacteria 1241
492 Ga0495677_0109941 3300047445 Bacteria 1047
493 Ga0495677_0229294 3300047445 Bacteria 724
494 Ga0495677_0282263 3300047445 Bacteria 651
495 Ga0495677_0334009 3300047445 Bacteria 597
496 Ga0495679_027097 3300047446 Bacteria 1895
497 Ga0495679_038986 3300047446 Bacteria 1484
498 Ga0495679_052283 3300047446 Bacteria 1222
499 Ga0495685_002039 3300047447 Bacteria 6283
500 Ga0495685_016394 3300047447 Unclassified 2531
501 Ga0495685_044651 3300047447 Bacteria 1511
502 Ga0495685_112673 3300047447 Bacteria 895
503 Ga0495685_197510 3300047447 Bacteria 645
504 Ga0495681_0000440 3300047470 Bacteria 31767
505 Ga0495681_0033140 3300047470 Bacteria 2591
506 Ga0495681_0039754 3300047470 Bacteria 2294
507 Ga0495681_0056956 3300047470 Bacteria 1817
508 Ga0495681_0063666 3300047470 Bacteria 1691
509 Ga0495681_0067436 3300047470 Bacteria 1630
510 Ga0495681_0105228 3300047470 Bacteria 1228
511 Ga0495681_0231415 3300047470 Bacteria 737
512 Ga0495681_0235736 3300047470 Bacteria 728
513 Ga0495681_0327849 3300047470 Bacteria 586
514 Ga0495686_0001128 3300047472 Bacteria 31556
515 Ga0495686_0121234 3300047472 Bacteria 1558
516 Ga0495593_0010665 3300047673 Bacteria 5299
517 Ga0495593_0012584 3300047673 Bacteria 4831
518 Ga0495593_0070545 3300047673 Bacteria 1815
519 Ga0495593_0196756 3300047673 Bacteria 1013
520 Ga0495593_0410189 3300047673 Unclassified 678
521 Ga0495602_0029974 3300048088 Bacteria 5169
522 Ga0495602_0196482 3300048088 Bacteria 1542
523 Ga0495602_0419847 3300048088 Bacteria 950
524 Ga0495614_0022484 3300048089 Bacteria 2721
525 Ga0495614_0025028 3300048089 Bacteria 2576
526 Ga0495614_0065116 3300048089 Bacteria 1567
527 Ga0495614_0242815 3300048089 Bacteria 822
528 Ga0495615_0001030 3300048090 Bacteria 3972
529 Ga0495615_0001768 3300048090 Bacteria 3299
530 Ga0495626_0000183 3300048091 Bacteria 76227
531 Ga0495626_0003569 3300048091 Bacteria 9918
532 Ga0495626_0008326 3300048091 Bacteria 5697
533 Ga0495626_0014056 3300048091 Bacteria 4140
534 Ga0495626_0017918 3300048091 Bacteria 3569
535 Ga0495626_0030721 3300048091 Bacteria 2589
536 Ga0495626_0057163 3300048091 Bacteria 1785
537 Ga0495626_0098455 3300048091 Bacteria 1277
538 Ga0495626_0124839 3300048091 Bacteria 1103
539 Ga0495626_0187344 3300048091 Bacteria 855
540 Ga0496100_0157869 3300048903 Bacteria 1623
541 Ga0496100_0497661 3300048903 Bacteria 939
542 Ga0496100_0734372 3300048903 Bacteria 772
543 Ga0496101_0238919 3300048904 Bacteria 1413
544 Ga0496102_0000711 3300048905 Bacteria 32978
545 Ga0496102_0002184 3300048905 Bacteria 16803
546 Ga0496102_0151316 3300048905 Bacteria 2180
547 Ga0496102_0636766 3300048905 Bacteria 989
548 Ga0496103_0006150 3300048906 Bacteria 7174
549 Ga0496103_0060952 3300048906 Bacteria 2345
550 Ga0496104_0829194 3300048907 Bacteria 831
551 Ga0496105_0138682 3300048908 Bacteria 2003
552 Ga0496105_0379473 3300048908 Bacteria 1125
553 Ga0496106_0164780 3300048909 Bacteria 1754
554 Ga0496107_0046127 3300048910 Bacteria 3136
555 Ga0496107_0446850 3300048910 Bacteria 960
556 Ga0496107_0528022 3300048910 Bacteria 875
557 Ga0496109_0127163 3300048912 Bacteria 2376
558 Ga0496109_0575487 3300048912 Bacteria 1062
559 Ga0496109_1191323 3300048912 Bacteria 698
560 Ga0496110_0000212 3300048913 Bacteria 37284
561 Ga0496110_0013974 3300048913 Bacteria 6652
562 Ga0496110_1371287 3300048913 Bacteria 616
563 Ga0496111_0174320 3300048914 Bacteria 1598
564 Ga0496111_0317261 3300048914 Bacteria 1154
565 Ga0496112_0058573 3300048915 Bacteria 3794
566 Ga0496113_0190594 3300048916 Bacteria 1627
567 Ga0496115_0137904 3300048918 Bacteria 2012
568 Ga0496115_0159818 3300048918 Bacteria 1862
569 Ga0496121_0253454 3300048924 Bacteria 1219
570 Ga0496122_0000256 3300048925 Bacteria 120178
571 Ga0496122_0089916 3300048925 Bacteria 2097
572 Ga0496122_0334008 3300048925 Bacteria 799
573 Ga0496123_0008567 3300048926 Bacteria 9371
574 Ga0496123_0009339 3300048926 Bacteria 8846
575 Ga0496124_0089789 3300048927 Bacteria 2508
576 Ga0496124_0186237 3300048927 Bacteria 1593
577 Ga0496124_0374871 3300048927 Bacteria 997
578 Ga0496125_0003296 3300048928 Bacteria 19805
579 Ga0501306_032442 3300049127 Bacteria 782
580 Ga0501308_051911 3300049128 Bacteria 602
581 Ga0501310_018296 3300049130 Bacteria 854
582 Ga0495678_000604 3300049459 Bacteria 33777
583 Ga0495678_219576 3300049459 Bacteria 577
584 Ga0495682_0000979 3300049460 Bacteria 17147
585 Ga0495682_0067230 3300049460 Bacteria 1291
586 Ga0501311_024822 3300049527 Bacteria 837
587 Ga0501316_064804 3300049532 Bacteria 545
588 Ga0501255_078234 3300049684 Bacteria 552
589 Ga0500594_0156055 3300053118 Bacteria 735
590 Ga0500618_006342 3300053125 Bacteria 3484
591 Ga0587084_098755 3300059477 Bacteria 589
592 Ga0587066_012263 3300059490 Bacteria 1275
593 Ga0587070_070028 3300059491 Bacteria 746
594 Ga0587073_0080759 3300059492 Bacteria 807
595 Ga0587077_041572 3300059493 Bacteria 925
596 Ga0587077_175015 3300059493 Bacteria 578
597 Ga0587080_010530 3300059503 Bacteria 1365
598 Ga0587082_006296 3300059504 Bacteria 1580
599 Ga0587083_0049734 3300059505 Bacteria 910
600 Ga0587083_0117753 3300059505 Bacteria 683
601 Ga0587085_084901 3300059506 Bacteria 644
602 Ga0587086_015307 3300059507 Bacteria 989
603 Ga0587088_020667 3300059508 Bacteria 1094
604 Ga0587088_066206 3300059508 Bacteria 743
605 Ga0587091_048428 3300059511 Bacteria 864
606 Ga0587098_036614 3300059604 Bacteria 698
607 Ga0587106_006963 3300059605 Bacteria 1355
608 Ga0587106_056558 3300059605 Bacteria 710
609 Ga0587099_025661 3300059622 Bacteria 692
610 Ga0587101_021764 3300059623 Bacteria 930
611 Ga0587128_107992 3300059630 Bacteria 591
612 Ga0587067_025700 3300059640 Bacteria 1050
613 Ga0587068_000931 3300059641 Bacteria 3037
614 Ga0587068_089964 3300059641 Bacteria 631
615 Ga0587069_100745 3300059642 Bacteria 590
616 Ga0587072_051087 3300059643 Bacteria 828
617 Ga0587075_039786 3300059644 Bacteria 783
618 Ga0587075_063139 3300059644 Bacteria 672
619 Ga0587076_022829 3300059645 Bacteria 1049
620 Ga0587079_048938 3300059647 Bacteria 881
621 Ga0587079_064627 3300059647 Bacteria 802
622 Ga0587079_075188 3300059647 Bacteria 762
623 Ga0587102_014690 3300059649 Bacteria 824
624 Ga0587105_021113 3300059651 Bacteria 572
625 Ga0587107_014770 3300059652 Bacteria 1009
626 Ga0587071_024726 3300060344 Bacteria 1123
627 Ga0587111_0038897 3300060346 Bacteria 1006
628 Ga0466962_0526770 3300061719 Bacteria 599
629 2643800254 2643221556 Bacteria 7251154
630 2644471966 2643221684 Bacteria 7145183
631 2809142421 2808606418 Bacteria 6724496
632 2857564100 2857558681 Bacteria 6617694
633 2919480978 2919476304 Bacteria 5888696
634 Ga0495596_0087594
635 Ga0006759J45824_1014301
636 Ga0006759J45824_1060320
637 Ga0007417J51691_1036584
638 Ga0007410J51695_1005934
639 Ga0007409J51694_1001813
640 Ga0007416J51690_1020973
641 Ga0032354_1011727
642 Ga0006780_1021424
643 Ga0055525_1000029
644 Ga0065165_1001814
645 Ga0065165_1040896
646 Ga0065714_10344285
647 Ga0070658_11002343
648 Ga0070660_100015384
649 Ga0070659_100045144
650 Ga0068855_100674269
651 Ga0068857_102304056
652 Ga0068852_101082457
653 Ga0157370_10997802
654 Ga0157372_11444200
655 Ga0157372_12171367
656 Ga0209563_100003
657 Ga0209437_101823
658 Ga0209646_1000036
659 Ga0209677_103237
660 Ga0209564_1000060
661 Ga0207657_10159417
662 Ga0207698_11762019
663 Ga0316177_1015883
664 Ga0316177_1109599
665 Ga0314311_1210205
666 Ga0316178_1072012
667 Ga0316178_1083625
668 Ga0316180_1161065
669 Ga0316183_1122591
670 Ga0316181_1282878
671 Ga0316182_1184138
672 Ga0316182_1385379
673 Ga0307408_100858398
674 Ga0395899_0234237
675 Ga0395899_0554011
676 Ga0395900_0000123
677 Ga0395900_0005755
678 Ga0395898_0913346
679 Ga0395898_1283457
680 Ga0395905_0456610
681 Ga0395905_0576218
682 Ga0395901_0002179
683 Ga0439453_0146788
684 Ga0439450_005004
685 Ga0450897_008994
686 Ga0466969_0010474
687 Ga0466965_0268115
688 Ga0466966_0219015
689 Ga0466966_0336220
690 Ga0466961_0094055
691 Ga0466961_0269061
692 Ga0466957_0152240
693 Ga0466959_0050342
694 Ga0466958_0918450
695 Ga0495617_000034
696 Ga0495617_030512
697 Ga0495627_000208
698 Ga0495627_007582
699 Ga0495627_034898
700 Ga0495627_037577
701 Ga0495627_156081
702 Ga0495603_0028054
703 Ga0495603_0066151
704 Ga0495603_0239033
705 Ga0495603_0239319
706 Ga0495603_0645224
707 Ga0495590_0000189
708 Ga0495590_0022913
709 Ga0495590_0122232
710 Ga0495591_076194
711 Ga0495629_0012541
712 Ga0495629_0024040
713 Ga0495629_0068858
714 Ga0495629_0538730
715 Ga0495638_0000765
716 Ga0495638_0091978
717 Ga0495638_0175541
718 Ga0495638_0618213
719 Ga0495653_0013586
720 Ga0495653_0023881
721 Ga0495653_0064408
722 Ga0495653_0078579
723 Ga0495653_0689185
724 Ga0495650_0001069
725 Ga0495650_0001491
726 Ga0495650_0009362
727 Ga0495650_0139640
728 Ga0495580_0009567
729 Ga0495580_0047743
730 Ga0495580_0180574
731 Ga0495582_0001943
732 Ga0495582_0030090
733 Ga0495582_0191698
734 Ga0495605_0000029
735 Ga0495605_0000151
736 Ga0495605_0008388
737 Ga0495605_0028857
738 Ga0495605_0085858
739 Ga0495605_0202741
740 Ga0495605_0205298
741 Ga0495605_0249688
742 Ga0495605_0264971
743 Ga0495639_0030974
744 Ga0495639_0141200
745 Ga0495639_0202612
746 Ga0495639_0608533
747 Ga0495664_0641672
748 Ga0495584_0005394
749 Ga0495584_0048471
750 Ga0495584_0078447
751 Ga0495584_0174242
752 Ga0495584_0260254
753 Ga0495584_0468033
754 Ga0495585_0002050
755 Ga0495585_0007514
756 Ga0495585_0026885
757 Ga0495585_0043776
758 Ga0495585_0052706
759 Ga0495585_0096433
760 Ga0495585_0109699
761 Ga0495585_0111854
762 Ga0495585_0120444
763 Ga0495585_0135060
764 Ga0495585_0347898
765 Ga0495585_0379431
766 Ga0495585_0474336
767 Ga0495594_0022874
768 Ga0495594_0089211
769 Ga0495594_0107649
770 Ga0495594_0198166
771 Ga0495594_0355259
772 Ga0495594_0406459
773 Ga0495596_0007468
774 Ga0495596_0016392
775 Ga0495596_0032442
776 Ga0495596_0049926
777 Ga0495596_0059042
778 Ga0495596_0332024
779 Ga0495596_0333260
780 Ga0495607_0002923
781 Ga0495607_0004090
782 Ga0495607_0004963
783 Ga0495607_0015886
784 Ga0495607_0091837
785 Ga0495607_0146573
786 Ga0495607_0467575
787 Ga0495607_0516886
788 Ga0495583_0001516
789 Ga0495583_0003802
790 Ga0495583_0004862
791 Ga0495583_0005158
792 Ga0495583_0013850
793 Ga0495583_0019240
794 Ga0495583_0025686
795 Ga0495583_0048121
796 Ga0495583_0081650
797 Ga0495583_0136313
798 Ga0495583_0235984
799 Ga0495583_0294410
800 Ga0495606_0003880
801 Ga0495606_0003966
802 Ga0495606_0084230
803 Ga0495606_0115398
804 Ga0495606_0149946
805 Ga0495606_0223526
806 Ga0495606_0259277
807 Ga0495606_0445423
808 Ga0495606_0657436
809 Ga0495610_0008294
810 Ga0495610_0074359
811 Ga0495610_0158970
812 Ga0495610_0184236
813 Ga0495616_0000551
814 Ga0495616_0012476
815 Ga0495616_0024262
816 Ga0495616_0031623
817 Ga0495616_0085920
818 Ga0495616_0115944
819 Ga0495616_0118102
820 Ga0495616_0139864
821 Ga0495616_0454200
822 Ga0495620_0002957
823 Ga0495628_0331192
824 Ga0495630_0016553
825 Ga0495630_1345117
826 Ga0495631_0003104
827 Ga0495631_0006235
828 Ga0495631_0008829
829 Ga0495631_0015244
830 Ga0495631_0017352
831 Ga0495631_0056119
832 Ga0495631_0056398
833 Ga0495631_0080506
834 Ga0495631_0106656
835 Ga0495631_0113015
836 Ga0495631_0125534
837 Ga0495631_0409927
838 Ga0495632_0000774
839 Ga0495632_0139984
840 Ga0495643_0001479
841 Ga0495643_0001689
842 Ga0495643_0045842
843 Ga0495643_0077674
844 Ga0495643_0089561
845 Ga0495643_0187552
846 Ga0495644_0004899
847 Ga0495644_0022106
848 Ga0495644_0044783
849 Ga0495644_0108926
850 Ga0495644_0117351
851 Ga0495648_0000806
852 Ga0495648_0001432
853 Ga0495648_0036112
854 Ga0495648_0037509
855 Ga0495648_0081182
856 Ga0495648_0225561
857 Ga0495648_0298405
858 Ga0495648_0445853
859 Ga0495663_0004119
860 Ga0495663_0027584
861 Ga0495663_0221266
862 Ga0495666_0002764
863 Ga0495666_0011490
864 Ga0495666_0020999
865 Ga0495666_0028047
866 Ga0495666_0053187
867 Ga0495666_0208322
868 Ga0495642_0001415
869 Ga0495642_0001571
870 Ga0495642_0002435
871 Ga0495642_0003022
872 Ga0495642_0003513
873 Ga0495642_0028764
874 Ga0495642_0086410
875 Ga0495642_0092639
876 Ga0495642_0182469
877 Ga0495642_0254702
878 Ga0495642_0307158
879 Ga0495642_0421187
880 Ga0495652_0022220
881 Ga0495652_0196542
882 Ga0495654_0004109
883 Ga0495654_0011555
884 Ga0495654_0017825
885 Ga0495654_0131569
886 Ga0495654_0240212
887 Ga0495665_0007844
888 Ga0495665_0009788
889 Ga0495665_0027664
890 Ga0495665_0158227
891 Ga0495665_0159169
892 Ga0495640_0183847
893 Ga0495640_0745019
894 Ga0495586_0001198
895 Ga0495586_0007136
896 Ga0495586_0033293
897 Ga0495586_0043564
898 Ga0495586_0417592
899 Ga0495586_0549173
900 Ga0495587_0004267
901 Ga0495587_0032376
902 Ga0495587_0164926
903 Ga0495587_0198747
904 Ga0495609_0019636
905 Ga0495609_0032824
906 Ga0495609_0035651
907 Ga0495609_0037177
908 Ga0495609_0049445
909 Ga0495609_0056590
910 Ga0495609_0057164
911 Ga0495609_0092993
912 Ga0495609_0145396
913 Ga0495609_0257620
914 Ga0495609_0309983
915 Ga0495609_0364356
916 Ga0495597_0001069
917 Ga0495597_0001698
918 Ga0495597_0008913
919 Ga0495597_0010345
920 Ga0495597_0031150
921 Ga0495597_0033950
922 Ga0495597_0086508
923 Ga0495597_0128982
924 Ga0495597_0162618
925 Ga0495597_0398881
926 Ga0495645_0097091
927 Ga0495622_0001583
928 Ga0495622_0015453
929 Ga0495622_0017983
930 Ga0495622_0032400
931 Ga0495622_0062290
932 Ga0495622_0083298
933 Ga0495633_0000606
934 Ga0495633_0009123
935 Ga0495633_0023816
936 Ga0495633_0058375
937 Ga0495633_0078262
938 Ga0495633_0093216
939 Ga0495633_0150326
940 Ga0495633_0243377
941 Ga0495633_0378781
942 Ga0495633_0466055
943 Ga0495667_0299658
944 Ga0495656_0007094
945 Ga0495656_0024611
946 Ga0495656_0121801
947 Ga0495656_0207840
948 Ga0495656_0308215
949 Ga0495656_0589339
950 Ga0495656_0633698
951 Ga0495656_0644272
952 Ga0495668_0001705
953 Ga0495668_0003015
954 Ga0495668_0016682
955 Ga0495668_0062903
956 Ga0495668_0126072
957 Ga0495668_0126252
958 Ga0495668_0137688
959 Ga0495668_0181905
960 Ga0495668_0189507
961 Ga0495668_0275084
962 Ga0495668_0376640
963 Ga0495634_0009751
964 Ga0495634_0031184
965 Ga0495611_0005622
966 Ga0495611_0006507
967 Ga0495611_0018916
968 Ga0495611_0071871
969 Ga0495611_0104787
970 Ga0495611_0161934
971 Ga0495625_0001154
972 Ga0495625_0024391
973 Ga0495625_0091765
974 Ga0495625_0155375
975 Ga0495625_0165376
976 Ga0495625_0185002
977 Ga0495625_0199698
978 Ga0495625_0218142
979 Ga0495625_0397066
980 Ga0495625_0509920
981 Ga0495635_0002935
982 Ga0495635_0184410
983 Ga0495635_0268061
984 Ga0495635_0343269
985 Ga0495659_0030908
986 Ga0495659_0040386
987 Ga0495659_0078662
988 Ga0495659_0142596
989 Ga0495661_0002594
990 Ga0495661_0004307
991 Ga0495661_0013222
992 Ga0495661_0021771
993 Ga0495661_0048155
994 Ga0495661_0059950
995 Ga0495661_0124892
996 Ga0495661_0141434
997 Ga0495661_0145395
998 Ga0495661_0154464
999 Ga0495661_0213771
1000 Ga0495661_0265937
1001 Ga0495661_0463684
1002 Ga0495661_0588502
1003 Ga0495588_0000086
1004 Ga0495588_0004845
1005 Ga0495588_0005137
1006 Ga0495588_0006099
1007 Ga0495588_0007561
1008 Ga0495588_0012569
1009 Ga0495588_0019698
1010 Ga0495588_0046190
1011 Ga0495588_0046827
1012 Ga0495588_0051754
1013 Ga0495588_0076154
1014 Ga0495588_0167318
1015 Ga0495588_0429299
1016 Ga0495588_0457142
1017 Ga0495588_0491929
1018 Ga0495599_0756016
1019 Ga0495623_0003404
1020 Ga0495623_0013944
1021 Ga0495623_0087378
1022 Ga0495623_0214887
1023 Ga0495623_0317508
1024 Ga0495646_0113218
1025 Ga0495646_0204642
1026 Ga0495646_0588938
1027 Ga0495669_0000180
1028 Ga0495669_0008778
1029 Ga0495669_0049996
1030 Ga0495669_0139895
1031 Ga0495613_0009611
1032 Ga0495613_0185218
1033 Ga0495613_0610943
1034 Ga0495624_0096763
1035 Ga0495624_0110549
1036 Ga0495624_0548574
1037 Ga0495670_0002431
1038 Ga0495670_0002485
1039 Ga0495670_0007574
1040 Ga0495670_0093211
1041 Ga0495670_0124550
1042 Ga0495670_0221385
1043 Ga0495670_0243134
1044 Ga0495670_0337098
1045 Ga0495670_0475925
1046 Ga0495671_0000188
1047 Ga0495671_0030706
1048 Ga0495671_0031985
1049 Ga0495671_0068816
1050 Ga0495671_0082168
1051 Ga0495649_0033570
1052 Ga0495649_0056361
1053 Ga0495649_0087982
1054 Ga0495649_0094213
1055 Ga0495649_0156818
1056 Ga0495649_0164655
1057 Ga0495649_0211725
1058 Ga0495649_0499006
1059 Ga0495589_0000166
1060 Ga0495589_0004062
1061 Ga0495589_0033658
1062 Ga0495589_0052747
1063 Ga0495589_0084047
1064 Ga0495589_0105159
1065 Ga0495589_0327482
1066 Ga0495660_0000067
1067 Ga0495660_0001360
1068 Ga0495660_0009431
1069 Ga0495660_0061528
1070 Ga0495660_0130817
1071 Ga0495660_0137451
1072 Ga0495660_0171689
1073 Ga0495660_0235284
1074 Ga0495581_0011595
1075 Ga0495581_0018205
1076 Ga0495581_0036691
1077 Ga0495581_0099923
1078 Ga0495604_0004350
1079 Ga0495604_0009027
1080 Ga0495604_0088363
1081 Ga0495604_0271254
1082 Ga0495604_0668346
1083 Ga0495636_0027635
1084 Ga0495636_0029775
1085 Ga0495636_0040299
1086 Ga0495636_0065221
1087 Ga0495636_0248331
1088 Ga0495636_0510050
1089 Ga0495636_0686131
1090 Ga0495674_0001855
1091 Ga0495674_0098850
1092 Ga0495672_0005511
1093 Ga0495672_0010652
1094 Ga0495672_0042541
1095 Ga0495676_0000133
1096 Ga0495676_0037833
1097 Ga0495676_0448524
1098 Ga0495680_0021225
1099 Ga0495680_0087195
1100 Ga0495680_0140179
1101 Ga0495680_0178710
1102 Ga0495680_0486983
1103 Ga0495683_0004383
1104 Ga0495683_0005313
1105 Ga0495683_0081269
1106 Ga0495683_0426545
1107 Ga0495687_000126
1108 Ga0495687_000252
1109 Ga0495687_001088
1110 Ga0495687_003194
1111 Ga0495687_003802
1112 Ga0495687_069762
1113 Ga0495687_093220
1114 Ga0495675_0004585
1115 Ga0495675_0006208
1116 Ga0495675_0023020
1117 Ga0495675_0137530
1118 Ga0495675_0161343
1119 Ga0495677_0002372
1120 Ga0495677_0002398
1121 Ga0495677_0004336
1122 Ga0495677_0011483
1123 Ga0495677_0062748
1124 Ga0495677_0077786
1125 Ga0495677_0109941
1126 Ga0495677_0229294
1127 Ga0495677_0282263
1128 Ga0495677_0334009
1129 Ga0495679_027097
1130 Ga0495679_038986
1131 Ga0495679_052283
1132 Ga0495685_002039
1133 Ga0495685_016394
1134 Ga0495685_044651
1135 Ga0495685_112673
1136 Ga0495685_197510
1137 Ga0495681_0000440
1138 Ga0495681_0033140
1139 Ga0495681_0039754
1140 Ga0495681_0056956
1141 Ga0495681_0063666
1142 Ga0495681_0067436
1143 Ga0495681_0105228
1144 Ga0495681_0231415
1145 Ga0495681_0235736
1146 Ga0495681_0327849
1147 Ga0495686_0001128
1148 Ga0495686_0121234
1149 Ga0495593_0010665
1150 Ga0495593_0012584
1151 Ga0495593_0070545
1152 Ga0495593_0196756
1153 Ga0495593_0410189
1154 Ga0495602_0029974
1155 Ga0495602_0196482
1156 Ga0495602_0419847
1157 Ga0495614_0022484
1158 Ga0495614_0025028
1159 Ga0495614_0065116
1160 Ga0495614_0242815
1161 Ga0495615_0001030
1162 Ga0495615_0001768
1163 Ga0495626_0000183
1164 Ga0495626_0003569
1165 Ga0495626_0008326
1166 Ga0495626_0014056
1167 Ga0495626_0017918
1168 Ga0495626_0030721
1169 Ga0495626_0057163
1170 Ga0495626_0098455
1171 Ga0495626_0124839
1172 Ga0495626_0187344
1173 Ga0496100_0157869
1174 Ga0496100_0497661
1175 Ga0496100_0734372
1176 Ga0496101_0238919
1177 Ga0496102_0000711
1178 Ga0496102_0002184
1179 Ga0496102_0151316
1180 Ga0496102_0636766
1181 Ga0496103_0006150
1182 Ga0496103_0060952
1183 Ga0496104_0829194
1184 Ga0496105_0138682
1185 Ga0496105_0379473
1186 Ga0496106_0164780
1187 Ga0496107_0046127
1188 Ga0496107_0446850
1189 Ga0496107_0528022
1190 Ga0496109_0127163
1191 Ga0496109_0575487
1192 Ga0496109_1191323
1193 Ga0496110_0000212
1194 Ga0496110_0013974
1195 Ga0496110_1371287
1196 Ga0496111_0174320
1197 Ga0496111_0317261
1198 Ga0496112_0058573
1199 Ga0496113_0190594
1200 Ga0496115_0137904
1201 Ga0496115_0159818
1202 Ga0496121_0253454
1203 Ga0496122_0000256
1204 Ga0496122_0089916
1205 Ga0496122_0334008
1206 Ga0496123_0008567
1207 Ga0496123_0009339
1208 Ga0496124_0089789
1209 Ga0496124_0186237
1210 Ga0496124_0374871
1211 Ga0496125_0003296
1212 Ga0501306_032442
1213 Ga0501308_051911
1214 Ga0501310_018296
1215 Ga0495678_000604
1216 Ga0495678_219576
1217 Ga0495682_0000979
1218 Ga0495682_0067230
1219 Ga0501311_024822
1220 Ga0501316_064804
1221 Ga0501255_078234
1222 Ga0500594_0156055
1223 Ga0500618_006342
1224 Ga0587084_098755
1225 Ga0587066_012263
1226 Ga0587070_070028
1227 Ga0587073_0080759
1228 Ga0587077_041572
1229 Ga0587077_175015
1230 Ga0587080_010530
1231 Ga0587082_006296
1232 Ga0587083_0049734
1233 Ga0587083_0117753
1234 Ga0587085_084901
1235 Ga0587086_015307
1236 Ga0587088_020667
1237 Ga0587088_066206
1238 Ga0587091_048428
1239 Ga0587098_036614
1240 Ga0587106_006963
1241 Ga0587106_056558
1242 Ga0587099_025661
1243 Ga0587101_021764
1244 Ga0587128_107992
1245 Ga0587067_025700
1246 Ga0587068_000931
1247 Ga0587068_089964
1248 Ga0587069_100745
1249 Ga0587072_051087
1250 Ga0587075_039786
1251 Ga0587075_063139
1252 Ga0587076_022829
1253 Ga0587079_048938
1254 Ga0587079_064627
1255 Ga0587079_075188
1256 Ga0587102_014690
1257 Ga0587105_021113
1258 Ga0587107_014770
1259 Ga0587071_024726
1260 Ga0587111_0038897
1261 Ga0466962_0526770
1262 2643800254
1263 2644471966
1264 2809142421
1265 2857564100
1266 2919480978

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07866

DUF1653

Protein of unknown function (DUF1653)

1

60

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3be3-assembly1.cif.gz_B-2 crystal structure of a protein belonging to pfam duf1653 from bordetella bronchiseptica 0.9013 2 61
3k2t-assembly1.cif.gz_A crystal structure of lmo2511 protein from listeria monocytogenes, northeast structural genomics consortium target lkr84a 0.8353 16 40
5jvh-assembly1.cif.gz_A the crystal structure large ribosomal subunit (50s) of deinococcus radiodurans in complex with evernimicin 0.807 8 38
7ode-assembly1.cif.gz_K e. coli 50s ribosome licl core particle 0.7966 8 38
3lyv-assembly1.cif.gz_B-2 crystal structure of a domain of ribosome-associated factor y from streptococcus pyogenes serotype m6. northeast structural genomics consortium target id dr64a 0.7958 13 40
ID Description Score Start End Superfamily
3be3A00 Mainly Beta;Roll;SH3 type barrels.;DUF1653-like domain 0.8792 2 61 2.30.30.320
af_A4I505_1311_1565_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.847 14 40 2.130.10.10
3k2tA01 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;Sigma 54 modulation/S30EA ribosomal protein, C-terminal domain 0.8353 16 40 3.30.505.50
af_P9WMA9_220_266_3.30.505.50 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;Sigma 54 modulation/S30EA ribosomal protein, C-terminal domain 0.8323 15 39 3.30.505.50
af_I1KB15_223_272_3.30.505.50 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;Sigma 54 modulation/S30EA ribosomal protein, C-terminal domain 0.8288 15 40 3.30.505.50
ID Description Score Start End GO Terms
AF-A0A4Q6GRC8-F1-model_v4 DUF1653 domain-containing protein 0.9992 2 59
AF-A0A4V7TPD6-F1-model_v4 deleted 0.9939 2 62
AF-A0A6M4JK35-F1-model_v4 DUF1653 domain-containing protein 0.9936 2 62
AF-S6FY09-F1-model_v4 deleted 0.9908 2 62
AF-A0A1I1K8U4-F1-model_v4 DUF1653 domain-containing protein 0.9903 1 63

Map