F471071

General Info

Members Datasets Scaffolds Average Seq Length
633 347 1266 709

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10045854|Ga0105240_100458542
Length 844
Sequence VALEQRQVPVVGLPRDIEDVAEDRNRADARVDERVEHHPRQDDLRNARGDAVPQDQDGDDRRRHVADAGEEAEDRIEAERDVRPRDAEGGIEQPRQPAQMREPLPGVRSIHPPTTSSDLEIAKSVVRKAAVPNRSMRVWPGSPYPLGATWDGVGVNFALFSEHATRVELCLFDSPTAESESVTIPLTEQTDMVWHGYLPDVRPGQLYGYRVHGPYDPNRGHRFNPNKIVMDPYARVVGRTVQWDESLFGFRSGQGDDSFDERDSAAHAPLAAVVDAAFTWGEDRPLRTPWHETLIYELHVKGYTALHPGIPEHLRGTYLGLASEPAIEHLTSLGVTAVELMPVHHHTDEWHLVKRGLSNYWGYNTLSYFAPDVRYAVSPSPLEAVREFKMMVRALHAAGLEVILDVVYNHTAEGNHTGPTIALRGIDNATYYRLAPQAPRYYEDFTGCGNTLNMRSPRVLQLIMDSLRYWVTEMHVDGFRFDLASALARELHAVDKLGAFFDIIHQDPILSQVKLIAEPWDLGEGGYQVGNFPTKWTEWNGKYRDAVRRFWRGDRRAVSELATRLAGSSDLYEQSGRRPYASVNFITAHDGFTLADLVSYEQKHNEANGEANADGENYNLSANNGVEGETDDRRVLELRARQRRNFIATLLCSIGVPMLSGGDELCRTQRGNNNAYCQDNPISWIDWTATPERQELLDFTRQVIRVWKEQPVLRRRKFFQGRRIRGAEVQDIAWLDPTDVRALGVRLNGDAIQEVDERGRPIKGDTLLLLLNADEKPVSFALPAAAPIERWDTLFDTADPWQGPRRLRGGDRYDLQGRAMAALKLNSRRDDFRRAGDWGPQGVV

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
262 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
263 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
319 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
320 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
321 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
322 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
323 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
324 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
325 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
326 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
327 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
328 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
329 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
330 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
331 2842694124 Methylopila sp. R-72369 Isolate Unclassified
332 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
333 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
334 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
335 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
336 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
337 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
338 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
339 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
340 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
341 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
342 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
343 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
344 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
345 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
346 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
347 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 0
Isolates 4.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 0.95
Rhizoplane 4.11
Rhizosphere 82.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10045854 3300009093 Bacteria 5543
2 JGI24740J21852_10007061 3300001979 Bacteria 4603
3 JGI24739J22299_10009509 3300001989 Bacteria 3622
4 JGI24739J22299_10012594 3300001989 Bacteria 3101
5 JGI24735J21928_10000575 3300002067 Bacteria 12900
6 JGI24735J21928_10001585 3300002067 Bacteria 8069
7 JGI25156J39149_1000351 3300002705 Bacteria 29907
8 JGI25156J39149_1001096 3300002705 Bacteria 12362
9 JGI25156J39149_1003535 3300002705 Bacteria 5078
10 rootL2_10014200 3300003322 Bacteria 9396
11 Ga0055533_1000088 3300003756 Bacteria 122346
12 Ga0055532_1000036 3300003758 Bacteria 208233
13 Ga0055527_1000022 3300003760 Bacteria 208676
14 Ga0055535_1000026 3300003761 Bacteria 208676
15 Ga0055542_1000042 3300003762 Bacteria 208676
16 Ga0055529_1000048 3300003763 Bacteria 208676
17 Ga0055536_1003984 3300003781 Bacteria 7721
18 Ga0055531_10000071 3300003794 Bacteria 110534
19 Ga0065165_1000023 3300005262 Bacteria 251942
20 Ga0065714_10009719 3300005288 Bacteria 2482
21 Ga0065712_10002379 3300005290 Bacteria 13761
22 Ga0065715_10003175 3300005293 Bacteria 7501
23 Ga0065707_10085233 3300005295 Bacteria 6334
24 Ga0065707_10087426 3300005295 Bacteria 5029
25 Ga0070658_10003967 3300005327 Bacteria 12128
26 Ga0070683_100001607 3300005329 Bacteria 17479
27 Ga0070683_100007026 3300005329 Bacteria 9475
28 Ga0070683_100013174 3300005329 Bacteria 7201
29 Ga0070683_100096910 3300005329 Bacteria 2774
30 Ga0070670_100017568 3300005331 Bacteria 6138
31 Ga0068869_100013325 3300005334 Bacteria 5466
32 Ga0068869_100056164 3300005334 Bacteria 2871
33 Ga0070680_100006715 3300005336 Bacteria 8766
34 Ga0068868_100003626 3300005338 Bacteria 10776
35 Ga0070660_100003031 3300005339 Bacteria 11566
36 Ga0070689_100001055 3300005340 Bacteria 17310
37 Ga0070689_100012371 3300005340 Bacteria 6146
38 Ga0070689_100017421 3300005340 Bacteria 5276
39 Ga0070689_100042684 3300005340 Bacteria 3482
40 Ga0070661_100003145 3300005344 Bacteria 11354
41 Ga0070669_100000166 3300005353 Bacteria 58014
42 Ga0070669_100046774 3300005353 Bacteria 3155
43 Ga0070669_100055862 3300005353 Bacteria 2893
44 Ga0070675_100005867 3300005354 Bacteria 9406
45 Ga0070675_100023315 3300005354 Bacteria 4948
46 Ga0070675_100044461 3300005354 Bacteria 3632
47 Ga0070675_100067031 3300005354 Bacteria 2969
48 Ga0070671_100043847 3300005355 Bacteria 3717
49 Ga0070674_100000065 3300005356 Bacteria 47649
50 Ga0070674_100002870 3300005356 Bacteria 9526
51 Ga0070674_100009463 3300005356 Bacteria 5834
52 Ga0070673_100005104 3300005364 Bacteria 8377
53 Ga0070688_100002911 3300005365 Bacteria 8732
54 Ga0070688_100010370 3300005365 Bacteria 5136
55 Ga0070659_100041645 3300005366 Bacteria 3591
56 Ga0070667_100053937 3300005367 Bacteria 3394
57 Ga0070709_10002271 3300005434 Bacteria 10421
58 Ga0070714_100071410 3300005435 Bacteria 3001
59 Ga0070713_100003393 3300005436 Bacteria 10521
60 Ga0070713_100014789 3300005436 Bacteria 5808
61 Ga0070710_10006611 3300005437 Bacteria 5574
62 Ga0070701_10017717 3300005438 Bacteria 3334
63 Ga0070694_100001517 3300005444 Bacteria 13614
64 Ga0070708_100039443 3300005445 Bacteria 4132
65 Ga0070663_100063978 3300005455 Bacteria 2658
66 Ga0070662_100014784 3300005457 Bacteria 5218
67 Ga0070662_100018298 3300005457 Bacteria 4738
68 Ga0070681_10004796 3300005458 Bacteria 12961
69 Ga0070681_10061384 3300005458 Bacteria 3734
70 Ga0068867_100026955 3300005459 Bacteria 4129
71 Ga0070685_10019337 3300005466 Bacteria 3673
72 Ga0070707_100014951 3300005468 Bacteria 7283
73 Ga0070698_100021658 3300005471 Bacteria 6729
74 Ga0070699_100025255 3300005518 Bacteria 5123
75 Ga0070699_100031367 3300005518 Bacteria 4587
76 Ga0070679_100001544 3300005530 Bacteria 20554
77 Ga0070679_100014078 3300005530 Bacteria 7671
78 Ga0070684_100000291 3300005535 Bacteria 34899
79 Ga0070684_100021119 3300005535 Bacteria 5411
80 Ga0070672_100048685 3300005543 Bacteria 3295
81 Ga0070686_100016199 3300005544 Bacteria 4333
82 Ga0070695_100010964 3300005545 Bacteria 5417
83 Ga0070696_100006862 3300005546 Bacteria 7597
84 Ga0070696_100008876 3300005546 Bacteria 6725
85 Ga0070665_100002554 3300005548 Bacteria 19979
86 Ga0068855_100037841 3300005563 Bacteria 5734
87 Ga0068855_100037989 3300005563 Bacteria 5723
88 Ga0068855_100105069 3300005563 Bacteria 3247
89 Ga0070664_100000654 3300005564 Bacteria 26479
90 Ga0070664_100000724 3300005564 Bacteria 25341
91 Ga0068857_100008868 3300005577 Bacteria 8712
92 Ga0068857_100054145 3300005577 Bacteria 3560
93 Ga0068854_100024283 3300005578 Bacteria 4148
94 Ga0068856_100066167 3300005614 Bacteria 3571
95 Ga0068852_100065383 3300005616 Bacteria 3173
96 Ga0068859_100016292 3300005617 Bacteria 7467
97 Ga0068859_100072140 3300005617 Bacteria 3489
98 Ga0068859_100107628 3300005617 Bacteria 2848
99 Ga0068861_100037274 3300005719 Bacteria 3614
100 Ga0068870_10012555 3300005840 Bacteria 3962
101 Ga0068870_10019074 3300005840 Bacteria 3322
102 Ga0068858_100034592 3300005842 Bacteria 4687
103 Ga0068858_100057540 3300005842 Bacteria 3593
104 Ga0068858_100105972 3300005842 Bacteria 2624
105 Ga0081455_10004807 3300005937 Bacteria 15005
106 Ga0081455_10029691 3300005937 Bacteria 4981
107 Ga0081539_10001873 3300005985 Bacteria 33007
108 Ga0070717_10014130 3300006028 Bacteria 6137
109 Ga0070717_10028010 3300006028 Bacteria 4507
110 Ga0075365_10012774 3300006038 Bacteria 5001
111 Ga0075365_10027600 3300006038 Bacteria 3613
112 Ga0075368_10002030 3300006042 Bacteria 6545
113 Ga0075364_10004167 3300006051 Bacteria 8294
114 Ga0075364_10006849 3300006051 Bacteria 6726
115 Ga0075364_10020934 3300006051 Bacteria 4118
116 Ga0075432_10000817 3300006058 Bacteria 9749
117 Ga0070716_100000411 3300006173 Bacteria 17627
118 Ga0075362_10000571 3300006177 Bacteria 10765
119 Ga0075367_10010843 3300006178 Bacteria 4803
120 Ga0075366_10001445 3300006195 Bacteria 11826
121 Ga0075366_10004631 3300006195 Bacteria 7392
122 Ga0075370_10012692 3300006353 Bacteria 4460
123 Ga0068871_100040368 3300006358 Bacteria 3738
124 Ga0075428_100000705 3300006844 Bacteria 34552
125 Ga0075428_100001126 3300006844 Bacteria 28567
126 Ga0075428_100012096 3300006844 Bacteria 9603
127 Ga0075428_100012964 3300006844 Bacteria 9270
128 Ga0075428_100024818 3300006844 Bacteria 6632
129 Ga0075428_100119588 3300006844 Bacteria 2868
130 Ga0075430_100000735 3300006846 Bacteria 25106
131 Ga0075430_100001877 3300006846 Bacteria 17200
132 Ga0075430_100032678 3300006846 Bacteria 4416
133 Ga0075431_100005886 3300006847 Bacteria 12133
134 Ga0075431_100009026 3300006847 Bacteria 9997
135 Ga0075431_100032386 3300006847 Bacteria 5386
136 Ga0075431_100037758 3300006847 Bacteria 4973
137 Ga0075431_100055992 3300006847 Bacteria 4068
138 Ga0075434_100016754 3300006871 Bacteria 7050
139 Ga0075434_100035126 3300006871 Bacteria 4954
140 Ga0075434_100084583 3300006871 Bacteria 3171
141 Ga0075434_100089990 3300006871 Bacteria 3070
142 Ga0075434_100090256 3300006871 Bacteria 3066
143 Ga0075429_100064178 3300006880 Bacteria 3199
144 Ga0097620_100016292 3300006931 Bacteria 7467
145 Ga0097620_100072140 3300006931 Bacteria 3489
146 Ga0097620_100107627 3300006931 Bacteria 2848
147 Ga0075435_100006767 3300007076 Bacteria 8133
148 Ga0075435_100050902 3300007076 Bacteria 3334
149 Ga0105251_10000167 3300009011 Bacteria 67775
150 Ga0105251_10000887 3300009011 Bacteria 26810
151 Ga0105240_10002060 3300009093 Bacteria 32968
152 Ga0105240_10005084 3300009093 Bacteria 19712
153 Ga0105240_10011983 3300009093 Bacteria 12016
154 Ga0111539_10000103 3300009094 Bacteria 91165
155 Ga0111539_10000764 3300009094 Bacteria 41874
156 Ga0111539_10000870 3300009094 Bacteria 39436
157 Ga0111539_10001146 3300009094 Bacteria 34999
158 Ga0111539_10001659 3300009094 Bacteria 29730
159 Ga0111539_10006896 3300009094 Bacteria 14594
160 Ga0111539_10015435 3300009094 Bacteria 9501
161 Ga0111539_10028460 3300009094 Bacteria 6816
162 Ga0111539_10029158 3300009094 Bacteria 6727
163 Ga0111539_10065547 3300009094 Bacteria 4291
164 Ga0111539_10114134 3300009094 Bacteria 3168
165 Ga0105245_10017695 3300009098 Bacteria 6222
166 Ga0105245_10032654 3300009098 Bacteria 4608
167 Ga0114129_10000687 3300009147 Bacteria 42788
168 Ga0114129_10004351 3300009147 Bacteria 20001
169 Ga0114129_10013375 3300009147 Bacteria 11694
170 Ga0114129_10018285 3300009147 Bacteria 9983
171 Ga0114129_10023230 3300009147 Bacteria 8796
172 Ga0114129_10201425 3300009147 Bacteria 2696
173 Ga0105243_10011530 3300009148 Bacteria 6687
174 Ga0105242_10020402 3300009176 Bacteria 5196
175 Ga0105248_10037753 3300009177 Bacteria 5405
176 Ga0105248_10042426 3300009177 Bacteria 5102
177 Ga0105248_10047186 3300009177 Bacteria 4830
178 Ga0105237_10005482 3300009545 Bacteria 14301
179 Ga0105238_10079035 3300009551 Bacteria 3279
180 Ga0105249_10005650 3300009553 Bacteria 10823
181 Ga0105249_10053089 3300009553 Bacteria 3704
182 Ga0105249_10062214 3300009553 Bacteria 3427
183 Ga0105249_10118479 3300009553 Bacteria 2513
184 Ga0157373_10021772 3300013100 Bacteria 4652
185 Ga0157370_10027194 3300013104 Bacteria 5640
186 Ga0157370_10047105 3300013104 Bacteria 4133
187 Ga0157370_10060691 3300013104 Bacteria 3589
188 Ga0157374_10081452 3300013296 Bacteria 3072
189 Ga0157378_10029906 3300013297 Bacteria 4810
190 Ga0157372_10070082 3300013307 Bacteria 3944
191 Ga0157372_10086664 3300013307 Bacteria 3553
192 Ga0157375_10047703 3300013308 Bacteria 4185
193 Ga0163163_10020450 3300014325 Bacteria 6233
194 Ga0163163_10089590 3300014325 Bacteria 3089
195 Ga0157377_10029992 3300014745 Bacteria 2942
196 Ga0213876_10004748 3300021384 Bacteria 7556
197 Ga0209674_100011 3300025226 Bacteria 997175
198 Ga0209674_100048 3300025226 Bacteria 353032
199 Ga0209672_100002 3300025228 Bacteria 1733325
200 Ga0209147_100003 3300025229 Bacteria 1733325
201 Ga0209563_102234 3300025230 Bacteria 4486
202 Ga0207427_100601 3300025231 Bacteria 17982
203 Ga0209258_100005 3300025242 Bacteria 1087938
204 Ga0209148_1000006 3300025254 Bacteria 1733325
205 Ga0209759_1000002 3300025256 Bacteria 1027596
206 Ga0209759_1000009 3300025256 Bacteria 446623
207 Ga0209759_1000032 3300025256 Bacteria 278697
208 Ga0209233_1000033 3300025261 Bacteria 596094
209 Ga0209455_1000003 3300025272 Bacteria 1471893
210 Ga0209676_1000229 3300025292 Bacteria 122052
211 Ga0207426_1002122 3300025302 Bacteria 13596
212 Ga0209257_1000001 3300025304 Bacteria 2274655
213 Ga0207697_10000770 3300025315 Bacteria 18165
214 Ga0207656_10002347 3300025321 Bacteria 6355
215 Ga0207713_1000353 3300025735 Bacteria 50352
216 Ga0207713_1001583 3300025735 Bacteria 17832
217 Ga0207692_10033046 3300025898 Bacteria 2492
218 Ga0207688_10020325 3300025901 Bacteria 3625
219 Ga0207647_10022374 3300025904 Bacteria 4199
220 Ga0207699_10000268 3300025906 Bacteria 28615
221 Ga0207645_10001784 3300025907 Bacteria 17410
222 Ga0207645_10005817 3300025907 Bacteria 8894
223 Ga0207645_10029219 3300025907 Bacteria 3554
224 Ga0207643_10002065 3300025908 Bacteria 11076
225 Ga0207643_10014072 3300025908 Bacteria 4342
226 Ga0207705_10018886 3300025909 Bacteria 4929
227 Ga0207654_10048405 3300025911 Bacteria 2433
228 Ga0207707_10034881 3300025912 Bacteria 4401
229 Ga0207695_10000870 3300025913 Bacteria 54964
230 Ga0207695_10006155 3300025913 Bacteria 15644
231 Ga0207695_10009850 3300025913 Bacteria 11744
232 Ga0207695_10011729 3300025913 Bacteria 10585
233 Ga0207695_10073338 3300025913 Bacteria 3488
234 Ga0207671_10004016 3300025914 Bacteria 14301
235 Ga0207671_10023594 3300025914 Bacteria 4638
236 Ga0207693_10005674 3300025915 Bacteria 10375
237 Ga0207662_10002830 3300025918 Bacteria 8768
238 Ga0207662_10009660 3300025918 Bacteria 5317
239 Ga0207657_10001960 3300025919 Bacteria 22213
240 Ga0207652_10050019 3300025921 Bacteria 3580
241 Ga0207681_10002499 3300025923 Bacteria 11678
242 Ga0207681_10056547 3300025923 Bacteria 2677
243 Ga0207659_10014360 3300025926 Bacteria 5105
244 Ga0207659_10021230 3300025926 Bacteria 4306
245 Ga0207700_10007389 3300025928 Bacteria 6713
246 Ga0207706_10004140 3300025933 Bacteria 13673
247 Ga0207706_10007465 3300025933 Bacteria 10110
248 Ga0207686_10033550 3300025934 Bacteria 3066
249 Ga0207670_10002026 3300025936 Bacteria 10641
250 Ga0207669_10000281 3300025937 Bacteria 23359
251 Ga0207669_10014166 3300025937 Bacteria 3989
252 Ga0207691_10007512 3300025940 Bacteria 10493
253 Ga0207691_10008115 3300025940 Bacteria 10079
254 Ga0207691_10016180 3300025940 Bacteria 7084
255 Ga0207691_10026607 3300025940 Bacteria 5428
256 Ga0207711_10082905 3300025941 Bacteria 2804
257 Ga0207689_10027622 3300025942 Bacteria 4748
258 Ga0207689_10041609 3300025942 Bacteria 3802
259 Ga0207661_10007517 3300025944 Bacteria 7748
260 Ga0207661_10040031 3300025944 Bacteria 3682
261 Ga0207661_10051937 3300025944 Bacteria 3273
262 Ga0207679_10002948 3300025945 Bacteria 10543
263 Ga0207679_10010851 3300025945 Bacteria 5873
264 Ga0207667_10002140 3300025949 Bacteria 24768
265 Ga0207667_10016320 3300025949 Bacteria 8393
266 Ga0207667_10021750 3300025949 Bacteria 7104
267 Ga0207667_10038916 3300025949 Bacteria 5071
268 Ga0207651_10007805 3300025960 Bacteria 5724
269 Ga0207651_10034675 3300025960 Bacteria 3271
270 Ga0207712_10003364 3300025961 Bacteria 10119
271 Ga0207712_10039797 3300025961 Bacteria 3222
272 Ga0207658_10021997 3300025986 Bacteria 4435
273 Ga0207677_10004349 3300026023 Bacteria 7590
274 Ga0207677_10041986 3300026023 Bacteria 3029
275 Ga0207703_10034787 3300026035 Bacteria 4000
276 Ga0207703_10093151 3300026035 Bacteria 2537
277 Ga0207703_10098159 3300026035 Bacteria 2477
278 Ga0207678_10087338 3300026067 Bacteria 2665
279 Ga0207648_10007601 3300026089 Bacteria 10629
280 Ga0207674_10014978 3300026116 Bacteria 8541
281 Ga0207674_10021984 3300026116 Bacteria 6860
282 Ga0207674_10024848 3300026116 Bacteria 6395
283 Ga0207674_10093159 3300026116 Bacteria 3002
284 Ga0207675_100026685 3300026118 Bacteria 5376
285 Ga0207675_100041170 3300026118 Bacteria 4314
286 Ga0207683_10043090 3300026121 Bacteria 3942
287 Ga0207683_10114970 3300026121 Bacteria 2412
288 Ga0207698_10002695 3300026142 Bacteria 10574
289 Ga0207428_10000385 3300027907 Bacteria 55418
290 Ga0207428_10000459 3300027907 Bacteria 49181
291 Ga0207428_10000725 3300027907 Bacteria 38077
292 Ga0207428_10003272 3300027907 Bacteria 15766
293 Ga0207428_10004394 3300027907 Bacteria 13431
294 Ga0207428_10009579 3300027907 Bacteria 8675
295 Ga0268266_10005244 3300028379 Bacteria 12172
296 Ga0268266_10026920 3300028379 Bacteria 4892
297 Ga0268265_10032251 3300028380 Bacteria 3794
298 Ga0265338_10000877 3300028800 Bacteria 50749
299 Ga0265329_10000876 3300031242 Bacteria 15198
300 Ga0265327_10004616 3300031251 Bacteria 12106
301 Ga0307408_100002185 3300031548 Bacteria 13985
302 Ga0307408_100002466 3300031548 Bacteria 12973
303 Ga0307408_100004282 3300031548 Bacteria 9689
304 Ga0307408_100006302 3300031548 Bacteria 7875
305 Ga0265313_10003056 3300031595 Bacteria 13889
306 Ga0265314_10000241 3300031711 Bacteria 80581
307 Ga0307405_10005086 3300031731 Bacteria 6298
308 Ga0307405_10013708 3300031731 Bacteria 4331
309 Ga0307413_10003946 3300031824 Bacteria 6359
310 Ga0307410_10043235 3300031852 Bacteria 2984
311 Ga0307407_10007835 3300031903 Bacteria 4862
312 Ga0307412_10000015 3300031911 Bacteria 333589
313 Ga0307409_100023321 3300031995 Bacteria 4285
314 Ga0307409_100048996 3300031995 Bacteria 3218
315 Ga0307416_100003429 3300032002 Bacteria 9307
316 Ga0307416_100024237 3300032002 Bacteria 4423
317 Ga0307411_10048174 3300032005 Bacteria 2761
318 Ga0373954_0019475 3300035118 Bacteria 3062
319 Ga0373955_0002958 3300035172 Bacteria 7443
320 Ga0373955_0004991 3300035172 Bacteria 5927
321 Ga0373931_0028836 3300035691 Bacteria 2846
322 Ga0373933_0000545 3300035724 Bacteria 23433
323 Ga0373933_0028133 3300035724 Bacteria 3241
324 Ga0373937_0000074 3300036401 Bacteria 91289
325 Ga0373937_0000651 3300036401 Bacteria 30483
326 Ga0316582_0013805 3300036647 Bacteria 4560
327 Ga0395900_0153549 3300037418 Bacteria 2352
328 Ga0395898_0018079 3300037466 Bacteria 7192
329 Ga0395905_0078048 3300037471 Bacteria 3103
330 Ga0395901_0001018 3300038443 Bacteria 30337
331 Ga0436365_0764152 3300039437 Bacteria 80595
332 Ga0436360_1239610 3300039438 Bacteria 2955
333 Ga0439431_0005161 3300041997 Bacteria 2880
334 Ga0439434_0003100 3300042435 Bacteria 4879
335 Ga0439464_0003507 3300042439 Bacteria 3963
336 Ga0451577_0000807 3300042876 Bacteria 47174
337 Ga0451577_0027440 3300042876 Bacteria 5155
338 Ga0466961_0026555 3300044693 Bacteria 3722
339 Ga0466963_0007937 3300044694 Bacteria 6354
340 Ga0453684_0000027 3300044712 Bacteria 778857
341 Ga0453684_0001215 3300044712 Bacteria 79022
342 Ga0453684_0001854 3300044712 Bacteria 55179
343 Ga0453684_0005495 3300044712 Bacteria 25049
344 Ga0453684_0027353 3300044712 Bacteria 8183
345 Ga0453684_0053389 3300044712 Bacteria 5275
346 Ga0453684_0063688 3300044712 Bacteria 4714
347 Ga0466957_0008870 3300044842 Bacteria 5728
348 Ga0466960_0019274 3300044901 Bacteria 3003
349 Ga0451576_0005053 3300045051 Bacteria 16728
350 Ga0451576_0042057 3300045051 Bacteria 4825
351 Ga0451576_0064370 3300045051 Bacteria 3819
352 Ga0466958_0013177 3300045836 Bacteria 4702
353 Ga0466958_0029296 3300045836 Bacteria 3267
354 Ga0466967_0000165 3300045976 Bacteria 26919
355 Ga0466967_0042989 3300045976 Bacteria 3910
356 Ga0466967_0052716 3300045976 Bacteria 3572
357 Ga0466967_0061252 3300045976 Bacteria 3338
358 Ga0495592_0035014 3300046454 Bacteria 3784
359 Ga0495603_0022280 3300046455 Bacteria 3837
360 Ga0495590_0002890 3300046457 Bacteria 7070
361 Ga0495590_0007022 3300046457 Bacteria 4365
362 Ga0495591_010371 3300046458 Bacteria 3618
363 Ga0495629_0000036 3300046459 Bacteria 117795
364 Ga0495629_0004680 3300046459 Bacteria 10251
365 Ga0495629_0009957 3300046459 Bacteria 6939
366 Ga0495651_0001464 3300046462 Bacteria 18261
367 Ga0495651_0001509 3300046462 Bacteria 18002
368 Ga0495653_0012918 3300046463 Bacteria 6814
369 Ga0495653_0023209 3300046463 Bacteria 5016
370 Ga0495650_0000761 3300046471 Bacteria 39886
371 Ga0495650_0001654 3300046471 Bacteria 20605
372 Ga0495650_0004098 3300046471 Bacteria 10176
373 Ga0495580_0000387 3300046472 Bacteria 36179
374 Ga0495580_0003117 3300046472 Bacteria 14204
375 Ga0495580_0005434 3300046472 Bacteria 10529
376 Ga0495580_0017199 3300046472 Bacteria 5413
377 Ga0495580_0073464 3300046472 Bacteria 2387
378 Ga0495582_0020009 3300046473 Bacteria 3660
379 Ga0495662_0025318 3300046476 Bacteria 2865
380 Ga0495596_0007527 3300046500 Bacteria 4908
381 Ga0495606_0018821 3300046507 Bacteria 5166
382 Ga0495608_0007625 3300046511 Bacteria 7629
383 Ga0495608_0012405 3300046511 Bacteria 5916
384 Ga0495608_0029513 3300046511 Bacteria 3719
385 Ga0495610_0000917 3300046512 Bacteria 27377
386 Ga0495618_0003038 3300046514 Bacteria 10602
387 Ga0495628_0022241 3300046516 Bacteria 5210
388 Ga0495628_0031245 3300046516 Bacteria 4307
389 Ga0495630_0002492 3300046517 Bacteria 12763
390 Ga0495630_0010137 3300046517 Bacteria 6792
391 Ga0495630_0012426 3300046517 Bacteria 6182
392 Ga0495648_0022938 3300046524 Bacteria 4284
393 Ga0495648_0047935 3300046524 Bacteria 2634
394 Ga0495666_0002182 3300046526 Bacteria 9743
395 Ga0495666_0005101 3300046526 Bacteria 6637
396 Ga0495666_0010306 3300046526 Bacteria 4659
397 Ga0495652_0023446 3300046529 Bacteria 5469
398 Ga0495640_0006857 3300046533 Bacteria 8972
399 Ga0495645_0001079 3300046543 Bacteria 18495
400 Ga0495645_0003579 3300046543 Bacteria 10526
401 Ga0495645_0015690 3300046543 Bacteria 5390
402 Ga0495667_0019165 3300046559 Bacteria 4617
403 Ga0495657_0032616 3300046675 Bacteria 3633
404 Ga0495599_0008394 3300046678 Bacteria 6279
405 Ga0495599_0019055 3300046678 Bacteria 4278
406 Ga0495599_0021237 3300046678 Bacteria 4049
407 Ga0495623_0011658 3300046679 Bacteria 5694
408 Ga0495623_0059562 3300046679 Bacteria 2397
409 Ga0495646_0004962 3300046680 Bacteria 8401
410 Ga0495646_0016352 3300046680 Bacteria 4707
411 Ga0495646_0037085 3300046680 Bacteria 3017
412 Ga0495613_0007098 3300046689 Bacteria 8338
413 Ga0495613_0041339 3300046689 Bacteria 3414
414 Ga0495624_0000291 3300046690 Bacteria 39781
415 Ga0495624_0000322 3300046690 Bacteria 38225
416 Ga0495581_0006751 3300047315 Bacteria 6654
417 Ga0495581_0006853 3300047315 Bacteria 6607
418 Ga0495581_0014547 3300047315 Bacteria 4562
419 Ga0495604_0024531 3300047317 Bacteria 4811
420 Ga0495674_0016872 3300047319 Bacteria 6811
421 Ga0495674_0080072 3300047319 Bacteria 2803
422 Ga0495676_0058880 3300047321 Bacteria 3020
423 Ga0495683_0001777 3300047323 Bacteria 13597
424 Ga0495683_0001996 3300047323 Bacteria 12698
425 Ga0495683_0006738 3300047323 Bacteria 6256
426 Ga0495687_000022 3300047443 Bacteria 327353
427 Ga0495687_004818 3300047443 Bacteria 8892
428 Ga0495675_0000317 3300047444 Bacteria 34404
429 Ga0495675_0012816 3300047444 Bacteria 5282
430 Ga0495675_0018359 3300047444 Bacteria 4441
431 Ga0495675_0030178 3300047444 Bacteria 3459
432 Ga0495679_000013 3300047446 Bacteria 313222
433 Ga0495679_000789 3300047446 Bacteria 20127
434 Ga0495679_002339 3300047446 Bacteria 9722
435 Ga0495685_009431 3300047447 Bacteria 3259
436 Ga0495684_0054495 3300047471 Bacteria 3050
437 Ga0495686_0000106 3300047472 Bacteria 175852
438 Ga0495686_0035044 3300047472 Bacteria 3228
439 Ga0495593_0003440 3300047673 Bacteria 9479
440 Ga0495602_0000069 3300048088 Bacteria 101160
441 Ga0495602_0007302 3300048088 Bacteria 11570
442 Ga0495602_0069546 3300048088 Bacteria 3017
443 Ga0495602_0115743 3300048088 Bacteria 2168
444 Ga0495614_0004944 3300048089 Bacteria 6012
445 Ga0496100_0000627 3300048903 Bacteria 16753
446 Ga0496100_0014763 3300048903 Bacteria 4543
447 Ga0496100_0066362 3300048903 Bacteria 2393
448 Ga0496101_0060560 3300048904 Bacteria 2747
449 Ga0496102_0000258 3300048905 Bacteria 68544
450 Ga0496102_0022313 3300048905 Bacteria 5609
451 Ga0496102_0037492 3300048905 Bacteria 4373
452 Ga0496103_0000326 3300048906 Bacteria 43556
453 Ga0496104_0000157 3300048907 Bacteria 61755
454 Ga0496104_0034001 3300048907 Bacteria 4752
455 Ga0496106_0000920 3300048909 Bacteria 21410
456 Ga0496108_0003567 3300048911 Bacteria 12468
457 Ga0496108_0021031 3300048911 Bacteria 5363
458 Ga0496108_0092799 3300048911 Bacteria 2567
459 Ga0496109_0015264 3300048912 Bacteria 6688
460 Ga0496109_0035516 3300048912 Bacteria 4497
461 Ga0496109_0103063 3300048912 Bacteria 2648
462 Ga0496110_0001487 3300048913 Bacteria 16980
463 Ga0496110_0005573 3300048913 Bacteria 9885
464 Ga0496111_0035793 3300048914 Bacteria 3549
465 Ga0496112_0000148 3300048915 Bacteria 44089
466 Ga0496112_0000485 3300048915 Bacteria 26676
467 Ga0496113_0001843 3300048916 Bacteria 12061
468 Ga0496113_0020780 3300048916 Bacteria 4623
469 Ga0496115_0030610 3300048918 Bacteria 4235
470 Ga0496116_0035668 3300048919 Bacteria 3490
471 Ga0496117_0011014 3300048920 Bacteria 8143
472 Ga0496118_0000387 3300048921 Bacteria 74400
473 Ga0496118_0003277 3300048921 Bacteria 20608
474 Ga0496118_0043031 3300048921 Bacteria 3555
475 Ga0496121_0000326 3300048924 Bacteria 99968
476 Ga0496121_0002516 3300048924 Bacteria 27812
477 Ga0496122_0001672 3300048925 Bacteria 34402
478 Ga0496123_0006826 3300048926 Bacteria 10953
479 Ga0496126_0000239 3300048929 Bacteria 118024
480 Ga0496126_0002879 3300048929 Bacteria 22451
481 Ga0496126_0021488 3300048929 Bacteria 6303
482 Ga0501031_0011563 3300049568 Bacteria 5756
483 Ga0501031_0019166 3300049568 Bacteria 4455
484 Ga0501032_0053052 3300049569 Bacteria 2731
485 Ga0501033_0002964 3300049570 Bacteria 14178
486 Ga0501033_0007306 3300049570 Bacteria 8617
487 Ga0501033_0028794 3300049570 Bacteria 4174
488 Ga0501034_0014607 3300049571 Bacteria 8085
489 Ga0501034_0080315 3300049571 Bacteria 3264
490 Ga0501036_0070080 3300049572 Bacteria 2965
491 Ga0501036_0071831 3300049572 Bacteria 2926
492 Ga0501037_0003395 3300049573 Bacteria 11578
493 Ga0501037_0008067 3300049573 Bacteria 7714
494 Ga0501037_0012915 3300049573 Bacteria 6154
495 Ga0501037_0078681 3300049573 Bacteria 2393
496 Ga0501038_0002763 3300049574 Bacteria 16344
497 Ga0501038_0015862 3300049574 Bacteria 6846
498 Ga0501038_0020849 3300049574 Bacteria 5891
499 Ga0501038_0057986 3300049574 Bacteria 3321
500 Ga0501039_0003641 3300049575 Bacteria 11550
501 Ga0501039_0013537 3300049575 Bacteria 6237
502 Ga0501039_0102095 3300049575 Bacteria 2238
503 Ga0501041_0032931 3300049577 Bacteria 3133
504 Ga0501042_0080359 3300049578 Bacteria 2336
505 Ga0501043_0005684 3300049579 Bacteria 10045
506 Ga0501043_0019718 3300049579 Bacteria 5296
507 Ga0501046_0005382 3300049580 Bacteria 11441
508 Ga0501046_0012421 3300049580 Bacteria 7250
509 Ga0501046_0019229 3300049580 Bacteria 5665
510 Ga0501046_0050076 3300049580 Bacteria 3301
511 Ga0501047_0009391 3300049581 Bacteria 9237
512 Ga0501047_0015050 3300049581 Bacteria 7361
513 Ga0501047_0107699 3300049581 Bacteria 2668
514 Ga0501048_0001639 3300049582 Bacteria 17052
515 Ga0501048_0053131 3300049582 Bacteria 2882
516 Ga0501048_0057533 3300049582 Bacteria 2757
517 Ga0501067_0000059 3300049583 Bacteria 64025
518 Ga0501067_0004004 3300049583 Bacteria 8133
519 Ga0501067_0016312 3300049583 Bacteria 4105
520 Ga0501067_0043465 3300049583 Bacteria 2495
521 Ga0501067_0047235 3300049583 Bacteria 2388
522 Ga0501068_0000174 3300049584 Bacteria 30046
523 Ga0501068_0011985 3300049584 Bacteria 4903
524 Ga0501069_0000520 3300049585 Bacteria 17598
525 Ga0501070_0001841 3300049586 Bacteria 18702
526 Ga0501070_0007008 3300049586 Bacteria 9589
527 Ga0501070_0034915 3300049586 Bacteria 4202
528 Ga0501071_0016432 3300049587 Bacteria 5089
529 Ga0501071_0025039 3300049587 Bacteria 4178
530 Ga0501072_0006215 3300049588 Bacteria 9095
531 Ga0501072_0066750 3300049588 Bacteria 2838
532 Ga0501073_0000121 3300049589 Bacteria 50301
533 Ga0501073_0000127 3300049589 Bacteria 49817
534 Ga0501073_0001974 3300049589 Bacteria 15293
535 Ga0501073_0020001 3300049589 Bacteria 4827
536 Ga0501075_0015222 3300049591 Bacteria 5517
537 Ga0501076_0025280 3300049592 Bacteria 4595
538 Ga0501076_0036602 3300049592 Bacteria 3846
539 Ga0501079_0001598 3300049741 Bacteria 16116
540 Ga0501079_0014009 3300049741 Bacteria 6116
541 Ga0501079_0018080 3300049741 Bacteria 5384
542 Ga0501079_0020252 3300049741 Bacteria 5084
543 Ga0501079_0046423 3300049741 Bacteria 3351
544 Ga0501080_0010343 3300049742 Bacteria 8534
545 Ga0501080_0015845 3300049742 Bacteria 6954
546 Ga0501080_0097783 3300049742 Bacteria 2725
547 Ga0501083_0003534 3300049744 Bacteria 10954
548 Ga0501083_0041775 3300049744 Bacteria 3110
549 Ga0501241_000126 3300049758 Bacteria 16600
550 Ga0501035_0013684 3300049822 Bacteria 7485
551 Ga0501035_0053848 3300049822 Bacteria 3597
552 Ga0501044_0031359 3300049823 Bacteria 5594
553 Ga0501044_0031499 3300049823 Bacteria 5582
554 Ga0501044_0135137 3300049823 Bacteria 2457
555 Ga0501045_0006121 3300049824 Bacteria 8336
556 Ga0501045_0019821 3300049824 Bacteria 4800
557 Ga0501045_0038188 3300049824 Bacteria 3492
558 Ga0501045_0049442 3300049824 Bacteria 3066
559 Ga0501045_0055261 3300049824 Bacteria 2903
560 Ga0501045_0083337 3300049824 Bacteria 2359
561 nmdc:mga00v17_19974_c1 3300050491 Bacteria 3832
562 nmdc:mga0yw44_10631_c1 3300050492 Bacteria 4711
563 nmdc:mga0yw44_17680_c1 3300050492 Bacteria 3886
564 nmdc:mga0k408_14838_c1 3300050493 Bacteria 4300
565 nmdc:mga0k408_2507_c1 3300050493 Bacteria 9769
566 nmdc:mga0k408_5641_c2 3300050493 Bacteria 4927
567 nmdc:mga06z11_2916_c1 3300050494 Bacteria 6580
568 nmdc:mga05p37_15676_c1 3300050507 Bacteria 9111
569 nmdc:mga05p37_157089_c1 3300050507 Bacteria 2779
570 nmdc:mga05p37_2459_c1 3300050507 Bacteria 21542
571 nmdc:mga05p37_29_c1 3300050507 Bacteria 114400
572 nmdc:mga05p37_569_c1 3300050507 Bacteria 16354
573 nmdc:mga09592_21277_c2 3300050508 Bacteria 2967
574 nmdc:mga0qj67_18281_c1 3300050509 Bacteria 5342
575 nmdc:mga0qj67_26627_c1 3300050509 Bacteria 4477
576 nmdc:mga0qj67_30894_c1 3300050509 Bacteria 4171
577 nmdc:mga0qj67_963_c1 3300050509 Bacteria 19822
578 nmdc:mga06r32_47134_c1 3300050510 Bacteria 4115
579 nmdc:mga08y16_1018_c1 3300050511 Bacteria 27484
580 nmdc:mga08y16_104046_c1 3300050511 Bacteria 2956
581 nmdc:mga08y16_28066_c1 3300050511 Bacteria 5934
582 nmdc:mga08y16_3612_c1 3300050511 Bacteria 16067
583 nmdc:mga08y16_86531_c1 3300050511 Bacteria 3266
584 nmdc:mga08y16_91416_c1 3300050511 Bacteria 3172
585 nmdc:mga0n895_1140_c1 3300050512 Bacteria 19437
586 nmdc:mga0n895_80625_c1 3300050512 Bacteria 3243
587 nmdc:mga0rr50_3416_c1 3300050513 Bacteria 9133
588 nmdc:mga0a205_6998_c2 3300050515 Bacteria 5070
589 nmdc:mga0a205_87807_c1 3300050515 Bacteria 3004
590 Ga0495601_0006077 3300053077 Bacteria 7044
591 Ga0495601_0025244 3300053077 Bacteria 3663
592 Ga0500568_0002246 3300053139 Bacteria 11553
593 Ga0500622_0001516 3300053156 Bacteria 18440
594 Ga0500622_0003416 3300053156 Bacteria 10657
595 Ga0501084_0016731 3300054114 Bacteria 6090
596 Ga0501084_0048770 3300054114 Bacteria 3544
597 Ga0501084_0054952 3300054114 Bacteria 3331
598 Ga0590071_000091 3300059421 Bacteria 24990
599 Ga0590075_000045 3300059424 Bacteria 32673
600 Ga0590077_000918 3300059426 Bacteria 7505
601 Ga0501082_0024435 3300060353 Bacteria 5210
602 Ga0501082_0044115 3300060353 Bacteria 3846
603 Ga0530510_0002055 3300061734 Bacteria 13814
604 Ga0530510_0055196 3300061734 Bacteria 2870
605 2509128380 2508501125 Bacteria 7208311
606 2513958955 2513237151 Bacteria 6309801
607 2526061546 2524614857 Bacteria 4146328
608 2527076234 2526164713 Bacteria 6780608
609 2563057627 2562617112 Bacteria 10918404
610 2713473675 2711768613 Bacteria 11048459
611 2738822889 2738541296 Bacteria 7285013
612 2738835096 2738541298 Bacteria 7286732
613 2738876575 2738541306 Bacteria 7284992
614 2739188519 2738543002 Bacteria 7284546
615 2739223171 2738543008 Bacteria 7282815
616 2740062705 2739367875 Bacteria 4157290
617 2842695071 2842694124 Bacteria 4063419
618 2856288561 2856287931 Bacteria 7223934
619 2857367011 2857357740 Bacteria 9937880
620 2900640892 2900634093 Bacteria 10263517
621 2904486148 2904483920 Bacteria 7545285
622 2919527487 2919527303 Bacteria 7718827
623 2921649630 2921643360 Bacteria 11448031
624 2928112100 2928108538 Bacteria 7360024
625 2928139356 2928135762 Bacteria 7259641
626 2928508622 2928503688 Bacteria 7268108
627 2929242087 2929239360 Bacteria 7745570
628 2945939122 2945934425 Bacteria 7444609
629 2990709125 2990703756 Bacteria 7715990
630 642421356 641736151 Bacteria 7477263
631 642616375 642555113 Bacteria 8214658
632 8055269784 8055266321 Bacteria 7999742
633 8055305898 8055301274 Bacteria 8587385
634 Ga0105240_10045854
635 JGI24740J21852_10007061
636 JGI24739J22299_10009509
637 JGI24739J22299_10012594
638 JGI24735J21928_10000575
639 JGI24735J21928_10001585
640 JGI25156J39149_1000351
641 JGI25156J39149_1001096
642 JGI25156J39149_1003535
643 rootL2_10014200
644 Ga0055533_1000088
645 Ga0055532_1000036
646 Ga0055527_1000022
647 Ga0055535_1000026
648 Ga0055542_1000042
649 Ga0055529_1000048
650 Ga0055536_1003984
651 Ga0055531_10000071
652 Ga0065165_1000023
653 Ga0065714_10009719
654 Ga0065712_10002379
655 Ga0065715_10003175
656 Ga0065707_10085233
657 Ga0065707_10087426
658 Ga0070658_10003967
659 Ga0070683_100001607
660 Ga0070683_100007026
661 Ga0070683_100013174
662 Ga0070683_100096910
663 Ga0070670_100017568
664 Ga0068869_100013325
665 Ga0068869_100056164
666 Ga0070680_100006715
667 Ga0068868_100003626
668 Ga0070660_100003031
669 Ga0070689_100001055
670 Ga0070689_100012371
671 Ga0070689_100017421
672 Ga0070689_100042684
673 Ga0070661_100003145
674 Ga0070669_100000166
675 Ga0070669_100046774
676 Ga0070669_100055862
677 Ga0070675_100005867
678 Ga0070675_100023315
679 Ga0070675_100044461
680 Ga0070675_100067031
681 Ga0070671_100043847
682 Ga0070674_100000065
683 Ga0070674_100002870
684 Ga0070674_100009463
685 Ga0070673_100005104
686 Ga0070688_100002911
687 Ga0070688_100010370
688 Ga0070659_100041645
689 Ga0070667_100053937
690 Ga0070709_10002271
691 Ga0070714_100071410
692 Ga0070713_100003393
693 Ga0070713_100014789
694 Ga0070710_10006611
695 Ga0070701_10017717
696 Ga0070694_100001517
697 Ga0070708_100039443
698 Ga0070663_100063978
699 Ga0070662_100014784
700 Ga0070662_100018298
701 Ga0070681_10004796
702 Ga0070681_10061384
703 Ga0068867_100026955
704 Ga0070685_10019337
705 Ga0070707_100014951
706 Ga0070698_100021658
707 Ga0070699_100025255
708 Ga0070699_100031367
709 Ga0070679_100001544
710 Ga0070679_100014078
711 Ga0070684_100000291
712 Ga0070684_100021119
713 Ga0070672_100048685
714 Ga0070686_100016199
715 Ga0070695_100010964
716 Ga0070696_100006862
717 Ga0070696_100008876
718 Ga0070665_100002554
719 Ga0068855_100037841
720 Ga0068855_100037989
721 Ga0068855_100105069
722 Ga0070664_100000654
723 Ga0070664_100000724
724 Ga0068857_100008868
725 Ga0068857_100054145
726 Ga0068854_100024283
727 Ga0068856_100066167
728 Ga0068852_100065383
729 Ga0068859_100016292
730 Ga0068859_100072140
731 Ga0068859_100107628
732 Ga0068861_100037274
733 Ga0068870_10012555
734 Ga0068870_10019074
735 Ga0068858_100034592
736 Ga0068858_100057540
737 Ga0068858_100105972
738 Ga0081455_10004807
739 Ga0081455_10029691
740 Ga0081539_10001873
741 Ga0070717_10014130
742 Ga0070717_10028010
743 Ga0075365_10012774
744 Ga0075365_10027600
745 Ga0075368_10002030
746 Ga0075364_10004167
747 Ga0075364_10006849
748 Ga0075364_10020934
749 Ga0075432_10000817
750 Ga0070716_100000411
751 Ga0075362_10000571
752 Ga0075367_10010843
753 Ga0075366_10001445
754 Ga0075366_10004631
755 Ga0075370_10012692
756 Ga0068871_100040368
757 Ga0075428_100000705
758 Ga0075428_100001126
759 Ga0075428_100012096
760 Ga0075428_100012964
761 Ga0075428_100024818
762 Ga0075428_100119588
763 Ga0075430_100000735
764 Ga0075430_100001877
765 Ga0075430_100032678
766 Ga0075431_100005886
767 Ga0075431_100009026
768 Ga0075431_100032386
769 Ga0075431_100037758
770 Ga0075431_100055992
771 Ga0075434_100016754
772 Ga0075434_100035126
773 Ga0075434_100084583
774 Ga0075434_100089990
775 Ga0075434_100090256
776 Ga0075429_100064178
777 Ga0097620_100016292
778 Ga0097620_100072140
779 Ga0097620_100107627
780 Ga0075435_100006767
781 Ga0075435_100050902
782 Ga0105251_10000167
783 Ga0105251_10000887
784 Ga0105240_10002060
785 Ga0105240_10005084
786 Ga0105240_10011983
787 Ga0111539_10000103
788 Ga0111539_10000764
789 Ga0111539_10000870
790 Ga0111539_10001146
791 Ga0111539_10001659
792 Ga0111539_10006896
793 Ga0111539_10015435
794 Ga0111539_10028460
795 Ga0111539_10029158
796 Ga0111539_10065547
797 Ga0111539_10114134
798 Ga0105245_10017695
799 Ga0105245_10032654
800 Ga0114129_10000687
801 Ga0114129_10004351
802 Ga0114129_10013375
803 Ga0114129_10018285
804 Ga0114129_10023230
805 Ga0114129_10201425
806 Ga0105243_10011530
807 Ga0105242_10020402
808 Ga0105248_10037753
809 Ga0105248_10042426
810 Ga0105248_10047186
811 Ga0105237_10005482
812 Ga0105238_10079035
813 Ga0105249_10005650
814 Ga0105249_10053089
815 Ga0105249_10062214
816 Ga0105249_10118479
817 Ga0157373_10021772
818 Ga0157370_10027194
819 Ga0157370_10047105
820 Ga0157370_10060691
821 Ga0157374_10081452
822 Ga0157378_10029906
823 Ga0157372_10070082
824 Ga0157372_10086664
825 Ga0157375_10047703
826 Ga0163163_10020450
827 Ga0163163_10089590
828 Ga0157377_10029992
829 Ga0213876_10004748
830 Ga0209674_100011
831 Ga0209674_100048
832 Ga0209672_100002
833 Ga0209147_100003
834 Ga0209563_102234
835 Ga0207427_100601
836 Ga0209258_100005
837 Ga0209148_1000006
838 Ga0209759_1000002
839 Ga0209759_1000009
840 Ga0209759_1000032
841 Ga0209233_1000033
842 Ga0209455_1000003
843 Ga0209676_1000229
844 Ga0207426_1002122
845 Ga0209257_1000001
846 Ga0207697_10000770
847 Ga0207656_10002347
848 Ga0207713_1000353
849 Ga0207713_1001583
850 Ga0207692_10033046
851 Ga0207688_10020325
852 Ga0207647_10022374
853 Ga0207699_10000268
854 Ga0207645_10001784
855 Ga0207645_10005817
856 Ga0207645_10029219
857 Ga0207643_10002065
858 Ga0207643_10014072
859 Ga0207705_10018886
860 Ga0207654_10048405
861 Ga0207707_10034881
862 Ga0207695_10000870
863 Ga0207695_10006155
864 Ga0207695_10009850
865 Ga0207695_10011729
866 Ga0207695_10073338
867 Ga0207671_10004016
868 Ga0207671_10023594
869 Ga0207693_10005674
870 Ga0207662_10002830
871 Ga0207662_10009660
872 Ga0207657_10001960
873 Ga0207652_10050019
874 Ga0207681_10002499
875 Ga0207681_10056547
876 Ga0207659_10014360
877 Ga0207659_10021230
878 Ga0207700_10007389
879 Ga0207706_10004140
880 Ga0207706_10007465
881 Ga0207686_10033550
882 Ga0207670_10002026
883 Ga0207669_10000281
884 Ga0207669_10014166
885 Ga0207691_10007512
886 Ga0207691_10008115
887 Ga0207691_10016180
888 Ga0207691_10026607
889 Ga0207711_10082905
890 Ga0207689_10027622
891 Ga0207689_10041609
892 Ga0207661_10007517
893 Ga0207661_10040031
894 Ga0207661_10051937
895 Ga0207679_10002948
896 Ga0207679_10010851
897 Ga0207667_10002140
898 Ga0207667_10016320
899 Ga0207667_10021750
900 Ga0207667_10038916
901 Ga0207651_10007805
902 Ga0207651_10034675
903 Ga0207712_10003364
904 Ga0207712_10039797
905 Ga0207658_10021997
906 Ga0207677_10004349
907 Ga0207677_10041986
908 Ga0207703_10034787
909 Ga0207703_10093151
910 Ga0207703_10098159
911 Ga0207678_10087338
912 Ga0207648_10007601
913 Ga0207674_10014978
914 Ga0207674_10021984
915 Ga0207674_10024848
916 Ga0207674_10093159
917 Ga0207675_100026685
918 Ga0207675_100041170
919 Ga0207683_10043090
920 Ga0207683_10114970
921 Ga0207698_10002695
922 Ga0207428_10000385
923 Ga0207428_10000459
924 Ga0207428_10000725
925 Ga0207428_10003272
926 Ga0207428_10004394
927 Ga0207428_10009579
928 Ga0268266_10005244
929 Ga0268266_10026920
930 Ga0268265_10032251
931 Ga0265338_10000877
932 Ga0265329_10000876
933 Ga0265327_10004616
934 Ga0307408_100002185
935 Ga0307408_100002466
936 Ga0307408_100004282
937 Ga0307408_100006302
938 Ga0265313_10003056
939 Ga0265314_10000241
940 Ga0307405_10005086
941 Ga0307405_10013708
942 Ga0307413_10003946
943 Ga0307410_10043235
944 Ga0307407_10007835
945 Ga0307412_10000015
946 Ga0307409_100023321
947 Ga0307409_100048996
948 Ga0307416_100003429
949 Ga0307416_100024237
950 Ga0307411_10048174
951 Ga0373954_0019475
952 Ga0373955_0002958
953 Ga0373955_0004991
954 Ga0373931_0028836
955 Ga0373933_0000545
956 Ga0373933_0028133
957 Ga0373937_0000074
958 Ga0373937_0000651
959 Ga0316582_0013805
960 Ga0395900_0153549
961 Ga0395898_0018079
962 Ga0395905_0078048
963 Ga0395901_0001018
964 Ga0436365_0764152
965 Ga0436360_1239610
966 Ga0439431_0005161
967 Ga0439434_0003100
968 Ga0439464_0003507
969 Ga0451577_0000807
970 Ga0451577_0027440
971 Ga0466961_0026555
972 Ga0466963_0007937
973 Ga0453684_0000027
974 Ga0453684_0001215
975 Ga0453684_0001854
976 Ga0453684_0005495
977 Ga0453684_0027353
978 Ga0453684_0053389
979 Ga0453684_0063688
980 Ga0466957_0008870
981 Ga0466960_0019274
982 Ga0451576_0005053
983 Ga0451576_0042057
984 Ga0451576_0064370
985 Ga0466958_0013177
986 Ga0466958_0029296
987 Ga0466967_0000165
988 Ga0466967_0042989
989 Ga0466967_0052716
990 Ga0466967_0061252
991 Ga0495592_0035014
992 Ga0495603_0022280
993 Ga0495590_0002890
994 Ga0495590_0007022
995 Ga0495591_010371
996 Ga0495629_0000036
997 Ga0495629_0004680
998 Ga0495629_0009957
999 Ga0495651_0001464
1000 Ga0495651_0001509
1001 Ga0495653_0012918
1002 Ga0495653_0023209
1003 Ga0495650_0000761
1004 Ga0495650_0001654
1005 Ga0495650_0004098
1006 Ga0495580_0000387
1007 Ga0495580_0003117
1008 Ga0495580_0005434
1009 Ga0495580_0017199
1010 Ga0495580_0073464
1011 Ga0495582_0020009
1012 Ga0495662_0025318
1013 Ga0495596_0007527
1014 Ga0495606_0018821
1015 Ga0495608_0007625
1016 Ga0495608_0012405
1017 Ga0495608_0029513
1018 Ga0495610_0000917
1019 Ga0495618_0003038
1020 Ga0495628_0022241
1021 Ga0495628_0031245
1022 Ga0495630_0002492
1023 Ga0495630_0010137
1024 Ga0495630_0012426
1025 Ga0495648_0022938
1026 Ga0495648_0047935
1027 Ga0495666_0002182
1028 Ga0495666_0005101
1029 Ga0495666_0010306
1030 Ga0495652_0023446
1031 Ga0495640_0006857
1032 Ga0495645_0001079
1033 Ga0495645_0003579
1034 Ga0495645_0015690
1035 Ga0495667_0019165
1036 Ga0495657_0032616
1037 Ga0495599_0008394
1038 Ga0495599_0019055
1039 Ga0495599_0021237
1040 Ga0495623_0011658
1041 Ga0495623_0059562
1042 Ga0495646_0004962
1043 Ga0495646_0016352
1044 Ga0495646_0037085
1045 Ga0495613_0007098
1046 Ga0495613_0041339
1047 Ga0495624_0000291
1048 Ga0495624_0000322
1049 Ga0495581_0006751
1050 Ga0495581_0006853
1051 Ga0495581_0014547
1052 Ga0495604_0024531
1053 Ga0495674_0016872
1054 Ga0495674_0080072
1055 Ga0495676_0058880
1056 Ga0495683_0001777
1057 Ga0495683_0001996
1058 Ga0495683_0006738
1059 Ga0495687_000022
1060 Ga0495687_004818
1061 Ga0495675_0000317
1062 Ga0495675_0012816
1063 Ga0495675_0018359
1064 Ga0495675_0030178
1065 Ga0495679_000013
1066 Ga0495679_000789
1067 Ga0495679_002339
1068 Ga0495685_009431
1069 Ga0495684_0054495
1070 Ga0495686_0000106
1071 Ga0495686_0035044
1072 Ga0495593_0003440
1073 Ga0495602_0000069
1074 Ga0495602_0007302
1075 Ga0495602_0069546
1076 Ga0495602_0115743
1077 Ga0495614_0004944
1078 Ga0496100_0000627
1079 Ga0496100_0014763
1080 Ga0496100_0066362
1081 Ga0496101_0060560
1082 Ga0496102_0000258
1083 Ga0496102_0022313
1084 Ga0496102_0037492
1085 Ga0496103_0000326
1086 Ga0496104_0000157
1087 Ga0496104_0034001
1088 Ga0496106_0000920
1089 Ga0496108_0003567
1090 Ga0496108_0021031
1091 Ga0496108_0092799
1092 Ga0496109_0015264
1093 Ga0496109_0035516
1094 Ga0496109_0103063
1095 Ga0496110_0001487
1096 Ga0496110_0005573
1097 Ga0496111_0035793
1098 Ga0496112_0000148
1099 Ga0496112_0000485
1100 Ga0496113_0001843
1101 Ga0496113_0020780
1102 Ga0496115_0030610
1103 Ga0496116_0035668
1104 Ga0496117_0011014
1105 Ga0496118_0000387
1106 Ga0496118_0003277
1107 Ga0496118_0043031
1108 Ga0496121_0000326
1109 Ga0496121_0002516
1110 Ga0496122_0001672
1111 Ga0496123_0006826
1112 Ga0496126_0000239
1113 Ga0496126_0002879
1114 Ga0496126_0021488
1115 Ga0501031_0011563
1116 Ga0501031_0019166
1117 Ga0501032_0053052
1118 Ga0501033_0002964
1119 Ga0501033_0007306
1120 Ga0501033_0028794
1121 Ga0501034_0014607
1122 Ga0501034_0080315
1123 Ga0501036_0070080
1124 Ga0501036_0071831
1125 Ga0501037_0003395
1126 Ga0501037_0008067
1127 Ga0501037_0012915
1128 Ga0501037_0078681
1129 Ga0501038_0002763
1130 Ga0501038_0015862
1131 Ga0501038_0020849
1132 Ga0501038_0057986
1133 Ga0501039_0003641
1134 Ga0501039_0013537
1135 Ga0501039_0102095
1136 Ga0501041_0032931
1137 Ga0501042_0080359
1138 Ga0501043_0005684
1139 Ga0501043_0019718
1140 Ga0501046_0005382
1141 Ga0501046_0012421
1142 Ga0501046_0019229
1143 Ga0501046_0050076
1144 Ga0501047_0009391
1145 Ga0501047_0015050
1146 Ga0501047_0107699
1147 Ga0501048_0001639
1148 Ga0501048_0053131
1149 Ga0501048_0057533
1150 Ga0501067_0000059
1151 Ga0501067_0004004
1152 Ga0501067_0016312
1153 Ga0501067_0043465
1154 Ga0501067_0047235
1155 Ga0501068_0000174
1156 Ga0501068_0011985
1157 Ga0501069_0000520
1158 Ga0501070_0001841
1159 Ga0501070_0007008
1160 Ga0501070_0034915
1161 Ga0501071_0016432
1162 Ga0501071_0025039
1163 Ga0501072_0006215
1164 Ga0501072_0066750
1165 Ga0501073_0000121
1166 Ga0501073_0000127
1167 Ga0501073_0001974
1168 Ga0501073_0020001
1169 Ga0501075_0015222
1170 Ga0501076_0025280
1171 Ga0501076_0036602
1172 Ga0501079_0001598
1173 Ga0501079_0014009
1174 Ga0501079_0018080
1175 Ga0501079_0020252
1176 Ga0501079_0046423
1177 Ga0501080_0010343
1178 Ga0501080_0015845
1179 Ga0501080_0097783
1180 Ga0501083_0003534
1181 Ga0501083_0041775
1182 Ga0501241_000126
1183 Ga0501035_0013684
1184 Ga0501035_0053848
1185 Ga0501044_0031359
1186 Ga0501044_0031499
1187 Ga0501044_0135137
1188 Ga0501045_0006121
1189 Ga0501045_0019821
1190 Ga0501045_0038188
1191 Ga0501045_0049442
1192 Ga0501045_0055261
1193 Ga0501045_0083337
1194 nmdc:mga00v17_19974_c1
1195 nmdc:mga0yw44_10631_c1
1196 nmdc:mga0yw44_17680_c1
1197 nmdc:mga0k408_14838_c1
1198 nmdc:mga0k408_2507_c1
1199 nmdc:mga0k408_5641_c2
1200 nmdc:mga06z11_2916_c1
1201 nmdc:mga05p37_15676_c1
1202 nmdc:mga05p37_157089_c1
1203 nmdc:mga05p37_2459_c1
1204 nmdc:mga05p37_29_c1
1205 nmdc:mga05p37_569_c1
1206 nmdc:mga09592_21277_c2
1207 nmdc:mga0qj67_18281_c1
1208 nmdc:mga0qj67_26627_c1
1209 nmdc:mga0qj67_30894_c1
1210 nmdc:mga0qj67_963_c1
1211 nmdc:mga06r32_47134_c1
1212 nmdc:mga08y16_1018_c1
1213 nmdc:mga08y16_104046_c1
1214 nmdc:mga08y16_28066_c1
1215 nmdc:mga08y16_3612_c1
1216 nmdc:mga08y16_86531_c1
1217 nmdc:mga08y16_91416_c1
1218 nmdc:mga0n895_1140_c1
1219 nmdc:mga0n895_80625_c1
1220 nmdc:mga0rr50_3416_c1
1221 nmdc:mga0a205_6998_c2
1222 nmdc:mga0a205_87807_c1
1223 Ga0495601_0006077
1224 Ga0495601_0025244
1225 Ga0500568_0002246
1226 Ga0500622_0001516
1227 Ga0500622_0003416
1228 Ga0501084_0016731
1229 Ga0501084_0048770
1230 Ga0501084_0054952
1231 Ga0590071_000091
1232 Ga0590075_000045
1233 Ga0590077_000918
1234 Ga0501082_0024435
1235 Ga0501082_0044115
1236 Ga0530510_0002055
1237 Ga0530510_0055196
1238 2509128380
1239 2513958955
1240 2526061546
1241 2527076234
1242 2563057627
1243 2713473675
1244 2738822889
1245 2738835096
1246 2738876575
1247 2739188519
1248 2739223171
1249 2740062705
1250 2842695071
1251 2856288561
1252 2857367011
1253 2900640892
1254 2904486148
1255 2919527487
1256 2921649630
1257 2928112100
1258 2928139356
1259 2928508622
1260 2929242087
1261 2945939122
1262 2990709125
1263 642421356
1264 642616375
1265 8055269784
1266 8055305898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02922

CBM_48

Carbohydrate-binding module 48 (Isoamylase N-terminal domain)

145

234

0.91

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

317

671

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u3b-assembly1.cif.gz_C structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.956 10 684
7eav-assembly1.cif.gz_A the x-ray crystallographic structure of glycogen debranching enzyme from sulfolobus solfataricus stb09 0.956 8 684
7u3b-assembly4.cif.gz_G structure of s. venezuelae glgx bound to c-di-gmp and acarbose (ph 8.5) 0.9555 10 684
7u3a-assembly1.cif.gz_A structure of the streptomyces venezuelae glgx-c-di-gmp complex 0.9552 10 684
7u3a-assembly2.cif.gz_D structure of the streptomyces venezuelae glgx-c-di-gmp complex 0.9543 10 684
ID Description Score Start End Superfamily
2vuyA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9794 157 566 3.20.20.80
2vuyA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.965 8 146 2.60.40.10
af_P9WQ25_15_155_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9604 9 146 2.60.40.10
2wskA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9536 159 569 3.20.20.80
2wskA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9404 14 146 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A520IZC3-F1-model_v4 Glycogen debranching enzyme GlgX 0.9978 14 141 GO:0004553
GO:0005975
AF-A0A353QZH1-F1-model_v4 Glycogen debranching enzyme GlgX 0.9958 8 101 GO:0004553
GO:0005975
AF-A0A060C1M0-F1-model_v4 CBM_48 0.9941 10 97 GO:0004553
GO:0005975
AF-A0A2V6A6K3-F1-model_v4 Glycogen debranching enzyme 0.992 257 362 GO:0005975
AF-A0A2J4VLT6-F1-model_v4 deleted 0.9911 10 151

Map