F471027

General Info

Members Datasets Scaffolds Average Seq Length
632 285 1264 280

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0013787|Ga0496126_0013787_5948_6952
Length 334
Sequence MLEKRLLCHVAQGNTAPFVTLRRRKDRPPADDDPLAPASTRQVADHQAKGAEMTMNGLRTLVAGRGLVESPRWHGDRLYFSDWSAGEVIAVDPDGRSEVIAGVTSLPLCTAWLPDGRLIIVSSQEGLLLRLEPDGSLVTHANLGRPGWNDIVADGRGNIYVNGAGFNPLAGEAFRPGGVFHVPPDGAPRQVADDIAFPNGMAVTPDNATLIVADSYRHHLVAFDIAADGSLSGRRVWADLGDAAPDGICVDAENAVWYAEVPGKRCVRVAEGGAELQVVPLDRGGFACVLGGQDHTTLYITAAEWRGMTDAEMVAPGSGQVLAVDVNVPGAGWP

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
130 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
134 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
196 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
197 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
284 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
285 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.16
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 4.91
Rhizosphere 92.41
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0013787 3300048929 Bacteria 8196
2 JGI24739J22299_10018707 3300001989 Bacteria 2487
3 JGI24737J22298_10024631 3300001990 Bacteria 1905
4 JGI24738J21930_10008833 3300002075 Bacteria 2284
5 JGI25406J46586_10076147 3300003203 Bacteria 1039
6 rootL2_10137437 3300003322 Bacteria 2224
7 JGI25404J52841_10007612 3300003659 Bacteria 2294
8 Ga0070680_100596940 3300005336 Bacteria 948
9 Ga0070682_100090851 3300005337 Bacteria 1998
10 Ga0070660_100231613 3300005339 Bacteria 1503
11 Ga0070689_100512627 3300005340 Bacteria 1029
12 Ga0070661_100053958 3300005344 Bacteria 2943
13 Ga0070674_100087761 3300005356 Bacteria 2237
14 Ga0070667_100261250 3300005367 Bacteria 1550
15 Ga0070709_10020100 3300005434 Bacteria 3870
16 Ga0070709_10033632 3300005434 Bacteria 3102
17 Ga0070709_10067358 3300005434 Bacteria 2299
18 Ga0070709_10178241 3300005434 Bacteria 1490
19 Ga0070709_10188431 3300005434 Bacteria 1453
20 Ga0070709_10282665 3300005434 Bacteria 1206
21 Ga0070714_100060989 3300005435 Bacteria 3238
22 Ga0070714_100088317 3300005435 Bacteria 2712
23 Ga0070714_100117490 3300005435 Bacteria 2362
24 Ga0070714_100144816 3300005435 Bacteria 2136
25 Ga0070714_100163835 3300005435 Bacteria 2013
26 Ga0070714_100246495 3300005435 Bacteria 1651
27 Ga0070713_100040354 3300005436 Bacteria 3794
28 Ga0070713_100058556 3300005436 Bacteria 3213
29 Ga0070713_100080824 3300005436 Bacteria 2772
30 Ga0070713_100089407 3300005436 Bacteria 2645
31 Ga0070713_100185831 3300005436 Bacteria 1870
32 Ga0070710_10005396 3300005437 Bacteria 6070
33 Ga0070710_10101394 3300005437 Bacteria 1715
34 Ga0070710_10106722 3300005437 Bacteria 1676
35 Ga0070710_10109329 3300005437 Bacteria 1658
36 Ga0070710_10144556 3300005437 Bacteria 1461
37 Ga0070711_100012344 3300005439 Bacteria 5332
38 Ga0070711_100047455 3300005439 Bacteria 2932
39 Ga0070711_100098312 3300005439 Bacteria 2124
40 Ga0070711_100218376 3300005439 Bacteria 1480
41 Ga0070700_100016315 3300005441 Bacteria 4230
42 Ga0070708_100071696 3300005445 Bacteria 3119
43 Ga0070708_100690599 3300005445 Bacteria 961
44 Ga0070662_100012372 3300005457 Bacteria 5658
45 Ga0070662_100519514 3300005457 Bacteria 995
46 Ga0070681_10145848 3300005458 Bacteria 2296
47 Ga0068867_100497967 3300005459 Unclassified 1047
48 Ga0070706_100014433 3300005467 Bacteria 7300
49 Ga0070706_100152449 3300005467 Bacteria 2157
50 Ga0070706_100175270 3300005467 Bacteria 2002
51 Ga0070706_100355445 3300005467 Bacteria 1366
52 Ga0070707_100041071 3300005468 Bacteria 4426
53 Ga0070707_100065647 3300005468 Bacteria 3486
54 Ga0070707_100104425 3300005468 Bacteria 2747
55 Ga0070698_100048534 3300005471 Bacteria 4338
56 Ga0070698_100151851 3300005471 Bacteria 2264
57 Ga0070699_100003177 3300005518 Bacteria 14535
58 Ga0070679_100134255 3300005530 Bacteria 2456
59 Ga0070684_100052434 3300005535 Bacteria 3548
60 Ga0070697_100001236 3300005536 Bacteria 19328
61 Ga0070697_100027203 3300005536 Bacteria 4574
62 Ga0068853_100122364 3300005539 Bacteria 2322
63 Ga0070695_100113985 3300005545 Bacteria 1839
64 Ga0070693_100184140 3300005547 Bacteria 1346
65 Ga0068855_100061014 3300005563 Bacteria 4406
66 Ga0068857_100046067 3300005577 Bacteria 3869
67 Ga0068856_100003242 3300005614 Bacteria 16561
68 Ga0068856_100057332 3300005614 Bacteria 3845
69 Ga0068856_100161019 3300005614 Bacteria 2254
70 Ga0070702_100115407 3300005615 Bacteria 1672
71 Ga0068852_100380369 3300005616 Unclassified 1385
72 Ga0068861_100286424 3300005719 Unclassified 1421
73 Ga0068861_100597088 3300005719 Bacteria 1013
74 Ga0068863_100171767 3300005841 Bacteria 2079
75 Ga0068863_100329176 3300005841 Bacteria 1485
76 Ga0068858_100143369 3300005842 Unclassified 2243
77 Ga0068860_100135683 3300005843 Bacteria 2363
78 Ga0068862_100258660 3300005844 Bacteria 1588
79 Ga0081455_10272792 3300005937 Bacteria 1226
80 Ga0081540_1002341 3300005983 Bacteria 15509
81 Ga0081539_10000289 3300005985 Bacteria 113859
82 Ga0081539_10000573 3300005985 Bacteria 76094
83 Ga0081539_10001928 3300005985 Bacteria 31979
84 Ga0081539_10036540 3300005985 Bacteria 2939
85 Ga0070717_10001073 3300006028 Bacteria 18372
86 Ga0070717_10046654 3300006028 Bacteria 3546
87 Ga0070717_10079051 3300006028 Bacteria 2757
88 Ga0070717_10106234 3300006028 Bacteria 2390
89 Ga0070717_10122030 3300006028 Bacteria 2233
90 Ga0070717_10297443 3300006028 Bacteria 1434
91 Ga0070717_10346432 3300006028 Bacteria 1327
92 Ga0070717_10565891 3300006028 Bacteria 1030
93 Ga0075368_10000590 3300006042 Bacteria 10956
94 Ga0075432_10000317 3300006058 Bacteria 13591
95 Ga0075432_10004080 3300006058 Bacteria 4985
96 Ga0070715_10014149 3300006163 Bacteria 2947
97 Ga0070715_10017507 3300006163 Bacteria 2713
98 Ga0070715_10036409 3300006163 Bacteria 2029
99 Ga0070715_10093262 3300006163 Bacteria 1390
100 Ga0070715_10101157 3300006163 Bacteria 1344
101 Ga0070716_100015607 3300006173 Bacteria 3906
102 Ga0070716_100016760 3300006173 Bacteria 3788
103 Ga0070716_100023513 3300006173 Bacteria 3269
104 Ga0070712_100156105 3300006175 Bacteria 1757
105 Ga0070712_100218462 3300006175 Bacteria 1507
106 Ga0070712_100252298 3300006175 Bacteria 1410
107 Ga0075367_10006083 3300006178 Bacteria 6065
108 Ga0075427_10002455 3300006194 Bacteria 2486
109 Ga0097621_100386745 3300006237 Bacteria 1250
110 Ga0068871_100044568 3300006358 Bacteria 3568
111 Ga0068871_100265321 3300006358 Bacteria 1499
112 Ga0075428_100011893 3300006844 Bacteria 9678
113 Ga0075428_100184721 3300006844 Bacteria 2256
114 Ga0075428_100565734 3300006844 Bacteria 1215
115 Ga0075430_100069435 3300006846 Bacteria 2956
116 Ga0075430_100085531 3300006846 Bacteria 2640
117 Ga0075431_100035390 3300006847 Bacteria 5142
118 Ga0075433_10001153 3300006852 Bacteria 19198
119 Ga0075433_10004431 3300006852 Bacteria 10932
120 Ga0075433_10029117 3300006852 Bacteria 4702
121 Ga0075433_10276042 3300006852 Bacteria 1489
122 Ga0075433_10482684 3300006852 Bacteria 1092
123 Ga0075434_100000949 3300006871 Bacteria 23343
124 Ga0075434_100036405 3300006871 Bacteria 4868
125 Ga0075429_100021839 3300006880 Bacteria 5549
126 Ga0075429_100030139 3300006880 Bacteria 4713
127 Ga0068865_100013753 3300006881 Bacteria 5126
128 Ga0075436_100030770 3300006914 Bacteria 3694
129 Ga0075436_100086686 3300006914 Bacteria 2175
130 Ga0075435_100000988 3300007076 Bacteria 18021
131 Ga0105251_10034154 3300009011 Bacteria 2519
132 Ga0105250_10079626 3300009092 Bacteria 1327
133 Ga0105240_10147873 3300009093 Bacteria 2801
134 Ga0105240_10551129 3300009093 Bacteria 1276
135 Ga0111539_10002959 3300009094 Bacteria 22536
136 Ga0111539_10010319 3300009094 Bacteria 11760
137 Ga0111539_10011807 3300009094 Bacteria 10949
138 Ga0111539_10035517 3300009094 Bacteria 6034
139 Ga0105245_10014991 3300009098 Bacteria 6753
140 Ga0105245_10100888 3300009098 Bacteria 2671
141 Ga0105245_10123238 3300009098 Bacteria 2424
142 Ga0105245_10309415 3300009098 Bacteria 1553
143 Ga0105247_10134314 3300009101 Bacteria 1615
144 Ga0114129_10013764 3300009147 Bacteria 11529
145 Ga0114129_10027629 3300009147 Bacteria 8035
146 Ga0114129_10078177 3300009147 Bacteria 4602
147 Ga0114129_10194547 3300009147 Bacteria 2751
148 Ga0105243_10003549 3300009148 Bacteria 12606
149 Ga0105243_10724726 3300009148 Bacteria 972
150 Ga0105242_10057411 3300009176 Bacteria 3188
151 Ga0105248_10199338 3300009177 Bacteria 2255
152 Ga0105238_10566320 3300009551 Bacteria 1141
153 Ga0105249_10013796 3300009553 Bacteria 7139
154 Ga0099796_10119324 3300010159 Bacteria 1012
155 Ga0105239_10095318 3300010375 Bacteria 3287
156 Ga0105239_10781695 3300010375 Bacteria 1093
157 Ga0105246_10074935 3300011119 Bacteria 2394
158 Ga0157371_10465735 3300013102 Unclassified 930
159 Ga0157370_10542922 3300013104 Bacteria 1066
160 Ga0157374_10188619 3300013296 Bacteria 2016
161 Ga0157378_10134216 3300013297 Bacteria 2294
162 Ga0163162_10018707 3300013306 Bacteria 6789
163 Ga0163162_10043452 3300013306 Bacteria 4499
164 Ga0157372_10044872 3300013307 Bacteria 4899
165 Ga0182008_10111129 3300014497 Bacteria 1358
166 Ga0157379_10272546 3300014968 Bacteria 1539
167 Ga0157376_10076153 3300014969 Bacteria 2866
168 Ga0157376_10086891 3300014969 Bacteria 2697
169 Ga0224712_10127334 3300022467 Bacteria 1109
170 Ga0207692_10001112 3300025898 Bacteria 9879
171 Ga0207692_10041466 3300025898 Bacteria 2279
172 Ga0207692_10043502 3300025898 Bacteria 2235
173 Ga0207692_10087259 3300025898 Bacteria 1683
174 Ga0207692_10132053 3300025898 Bacteria 1411
175 Ga0207688_10002396 3300025901 Bacteria 10099
176 Ga0207688_10112103 3300025901 Bacteria 1584
177 Ga0207680_10142094 3300025903 Bacteria 1592
178 Ga0207699_10002882 3300025906 Bacteria 8162
179 Ga0207699_10026180 3300025906 Bacteria 3211
180 Ga0207699_10032645 3300025906 Bacteria 2934
181 Ga0207684_10028579 3300025910 Bacteria 4751
182 Ga0207684_10056705 3300025910 Bacteria 3324
183 Ga0207684_10266740 3300025910 Bacteria 1477
184 Ga0207707_10278009 3300025912 Bacteria 1450
185 Ga0207693_10001968 3300025915 Bacteria 18005
186 Ga0207693_10006757 3300025915 Bacteria 9472
187 Ga0207693_10021569 3300025915 Bacteria 5118
188 Ga0207693_10223802 3300025915 Bacteria 1478
189 Ga0207693_10288978 3300025915 Bacteria 1285
190 Ga0207693_10325375 3300025915 Bacteria 1203
191 Ga0207663_10016702 3300025916 Bacteria 4077
192 Ga0207663_10052592 3300025916 Bacteria 2541
193 Ga0207663_10074947 3300025916 Bacteria 2194
194 Ga0207663_10089219 3300025916 Bacteria 2041
195 Ga0207663_10102595 3300025916 Bacteria 1925
196 Ga0207663_10179850 3300025916 Bacteria 1509
197 Ga0207663_10228706 3300025916 Bacteria 1358
198 Ga0207660_10304016 3300025917 Bacteria 1270
199 Ga0207662_10023176 3300025918 Bacteria 3565
200 Ga0207646_10010192 3300025922 Bacteria 9203
201 Ga0207646_10046074 3300025922 Bacteria 3914
202 Ga0207646_10055654 3300025922 Bacteria 3536
203 Ga0207694_10040520 3300025924 Bacteria 3586
204 Ga0207687_10062648 3300025927 Bacteria 2631
205 Ga0207700_10005886 3300025928 Bacteria 7371
206 Ga0207700_10021274 3300025928 Bacteria 4425
207 Ga0207700_10034658 3300025928 Bacteria 3626
208 Ga0207700_10047554 3300025928 Bacteria 3181
209 Ga0207700_10052750 3300025928 Bacteria 3042
210 Ga0207700_10053798 3300025928 Bacteria 3018
211 Ga0207700_10060960 3300025928 Bacteria 2859
212 Ga0207700_10117269 3300025928 Bacteria 2152
213 Ga0207700_10131761 3300025928 Bacteria 2042
214 Ga0207700_10356134 3300025928 Bacteria 1275
215 Ga0207664_10010596 3300025929 Bacteria 6514
216 Ga0207664_10011338 3300025929 Bacteria 6327
217 Ga0207664_10029596 3300025929 Bacteria 4173
218 Ga0207664_10031083 3300025929 Bacteria 4082
219 Ga0207664_10051452 3300025929 Bacteria 3253
220 Ga0207664_10053030 3300025929 Bacteria 3208
221 Ga0207664_10077273 3300025929 Bacteria 2697
222 Ga0207664_10108422 3300025929 Bacteria 2306
223 Ga0207664_10110634 3300025929 Bacteria 2284
224 Ga0207664_10165471 3300025929 Bacteria 1889
225 Ga0207690_10226082 3300025932 Bacteria 1434
226 Ga0207706_10002325 3300025933 Bacteria 18554
227 Ga0207706_10006532 3300025933 Bacteria 10806
228 Ga0207706_10076927 3300025933 Bacteria 2935
229 Ga0207686_10034815 3300025934 Bacteria 3017
230 Ga0207669_10023647 3300025937 Bacteria 3287
231 Ga0207669_10102284 3300025937 Bacteria 1898
232 Ga0207704_10033232 3300025938 Bacteria 2930
233 Ga0207665_10001614 3300025939 Bacteria 15213
234 Ga0207665_10004928 3300025939 Bacteria 8901
235 Ga0207665_10010166 3300025939 Bacteria 6177
236 Ga0207665_10025993 3300025939 Bacteria 3862
237 Ga0207689_10016614 3300025942 Bacteria 6228
238 Ga0207661_10312599 3300025944 Bacteria 1411
239 Ga0207667_10290497 3300025949 Bacteria 1670
240 Ga0207712_10107149 3300025961 Bacteria 2089
241 Ga0207712_10154140 3300025961 Bacteria 1778
242 Ga0207668_10425266 3300025972 Bacteria 1128
243 Ga0207678_10005759 3300026067 Bacteria 11050
244 Ga0207708_10020939 3300026075 Bacteria 4934
245 Ga0207702_10126868 3300026078 Bacteria 2292
246 Ga0207702_10149483 3300026078 Bacteria 2123
247 Ga0207702_10628926 3300026078 Bacteria 1055
248 Ga0207641_10428762 3300026088 Bacteria 1274
249 Ga0207648_10082131 3300026089 Bacteria 2810
250 Ga0207674_10006832 3300026116 Bacteria 13380
251 Ga0207675_100004599 3300026118 Bacteria 13296
252 Ga0207675_100011570 3300026118 Bacteria 8250
253 Ga0207675_100037905 3300026118 Bacteria 4498
254 Ga0207683_10011227 3300026121 Bacteria 7635
255 Ga0209813_10005266 3300027866 Bacteria 3131
256 Ga0207428_10001448 3300027907 Bacteria 24838
257 Ga0207428_10002935 3300027907 Bacteria 16896
258 Ga0268264_10072827 3300028381 Bacteria 2914
259 Ga0265337_1005691 3300028556 Bacteria 4906
260 Ga0265326_10000682 3300028558 Bacteria 12597
261 Ga0265319_1004253 3300028563 Bacteria 7137
262 Ga0265334_10003003 3300028573 Bacteria 7709
263 Ga0265323_10012083 3300028653 Bacteria 3468
264 Ga0265322_10022590 3300028654 Bacteria 1799
265 Ga0265338_10000059 3300028800 Bacteria 198047
266 Ga0265324_10000821 3300029957 Bacteria 20206
267 Ga0307512_10006731 3300030522 Bacteria 11560
268 Ga0265332_10004728 3300031238 Bacteria 6352
269 Ga0265320_10006149 3300031240 Bacteria 7599
270 Ga0265325_10014788 3300031241 Bacteria 4403
271 Ga0265340_10006340 3300031247 Bacteria 6520
272 Ga0265339_10133698 3300031249 Bacteria 1266
273 Ga0265316_10013649 3300031344 Bacteria 7207
274 Ga0307513_10018496 3300031456 Bacteria 8323
275 Ga0307513_10469394 3300031456 Bacteria 980
276 Ga0307408_100007903 3300031548 Bacteria 7033
277 Ga0265313_10009896 3300031595 Bacteria 6127
278 Ga0265314_10014727 3300031711 Bacteria 6239
279 Ga0265342_10001214 3300031712 Bacteria 24392
280 Ga0307516_10162518 3300031730 Bacteria 1982
281 Ga0307405_10002428 3300031731 Bacteria 8205
282 Ga0307405_10024907 3300031731 Bacteria 3427
283 Ga0307413_10094481 3300031824 Bacteria 1957
284 Ga0307413_10374695 3300031824 Bacteria 1107
285 Ga0307518_10128744 3300031838 Bacteria 1782
286 Ga0307410_10001225 3300031852 Bacteria 11387
287 Ga0307410_10003667 3300031852 Bacteria 7759
288 Ga0307410_10009870 3300031852 Bacteria 5379
289 Ga0307410_10552719 3300031852 Bacteria 954
290 Ga0307406_10000385 3300031901 Bacteria 25476
291 Ga0307406_10001181 3300031901 Bacteria 14603
292 Ga0307406_10108777 3300031901 Bacteria 1904
293 Ga0307407_10005227 3300031903 Bacteria 5604
294 Ga0307407_10058447 3300031903 Bacteria 2241
295 Ga0307407_10080083 3300031903 Bacteria 1972
296 Ga0307409_100000802 3300031995 Bacteria 14352
297 Ga0307409_100058367 3300031995 Bacteria 2997
298 Ga0307409_100138858 3300031995 Bacteria 2090
299 Ga0307416_100000957 3300032002 Bacteria 15248
300 Ga0307414_10000836 3300032004 Bacteria 15715
301 Ga0307414_10169620 3300032004 Bacteria 1743
302 Ga0307414_10289421 3300032004 Unclassified 1380
303 Ga0307411_10012234 3300032005 Bacteria 4672
304 Ga0307411_10195544 3300032005 Unclassified 1548
305 Ga0307411_10259007 3300032005 Bacteria 1372
306 Ga0307411_10507304 3300032005 Bacteria 1021
307 Ga0307415_100021429 3300032126 Bacteria 3973
308 Ga0307415_100135252 3300032126 Bacteria 1873
309 Ga0307415_100226903 3300032126 Bacteria 1501
310 Ga0307507_10000113 3300033179 Bacteria 133812
311 Ga0373948_0002719 3300034817 Bacteria 2646
312 Ga0373926_0000322 3300035083 Bacteria 11932
313 Ga0373926_0007259 3300035083 Bacteria 3694
314 Ga0373929_0016062 3300035085 Bacteria 1463
315 Ga0373934_0008045 3300035086 Bacteria 3924
316 Ga0373934_0068802 3300035086 Bacteria 1414
317 Ga0373944_0020364 3300035089 Bacteria 1910
318 Ga0373952_0003468 3300035092 Bacteria 2847
319 Ga0373936_0000698 3300035113 Bacteria 11738
320 Ga0373936_0001663 3300035113 Bacteria 8150
321 Ga0373939_0035175 3300035114 Bacteria 1474
322 Ga0373945_0000194 3300035116 Bacteria 16504
323 Ga0373945_0001968 3300035116 Bacteria 6376
324 Ga0373945_0031182 3300035116 Bacteria 1883
325 Ga0373953_0023345 3300035117 Bacteria 2340
326 Ga0373953_0081647 3300035117 Bacteria 1344
327 Ga0373954_0022558 3300035118 Bacteria 2857
328 Ga0373954_0074046 3300035118 Bacteria 1621
329 Ga0373956_0023102 3300035119 Bacteria 2666
330 Ga0373956_0046245 3300035119 Bacteria 1943
331 Ga0373957_0000988 3300035120 Bacteria 7483
332 Ga0373957_0015871 3300035120 Bacteria 2599
333 Ga0373957_0033675 3300035120 Bacteria 1893
334 Ga0373943_0000231 3300035170 Bacteria 22802
335 Ga0373943_0009232 3300035170 Bacteria 4419
336 Ga0373943_0013316 3300035170 Bacteria 3714
337 Ga0373943_0063120 3300035170 Bacteria 1856
338 Ga0373943_0197233 3300035170 Bacteria 1113
339 Ga0373946_0001176 3300035171 Bacteria 9069
340 Ga0373946_0061489 3300035171 Bacteria 1599
341 Ga0373955_0008188 3300035172 Bacteria 4842
342 Ga0373955_0050320 3300035172 Bacteria 2265
343 Ga0373955_0056654 3300035172 Bacteria 2150
344 Ga0373942_0043555 3300035207 Bacteria 1234
345 Ga0373961_0105464 3300035241 Bacteria 917
346 Ga0373962_0006182 3300035242 Bacteria 2896
347 Ga0373924_0002392 3300035410 Bacteria 6311
348 Ga0373924_0010209 3300035410 Bacteria 3456
349 Ga0373931_0028101 3300035691 Bacteria 2876
350 Ga0373935_0004555 3300035692 Bacteria 8149
351 Ga0373935_0007081 3300035692 Bacteria 6697
352 Ga0373935_0428403 3300035692 Bacteria 953
353 Ga0373927_0007094 3300035695 Bacteria 7601
354 Ga0373927_0008331 3300035695 Bacteria 6980
355 Ga0373927_0044340 3300035695 Bacteria 2878
356 Ga0373927_0141027 3300035695 Bacteria 1576
357 Ga0373933_0021367 3300035724 Bacteria 3676
358 Ga0373933_0025677 3300035724 Bacteria 3379
359 Ga0373947_0000336 3300035725 Bacteria 26498
360 Ga0373947_0000416 3300035725 Bacteria 24181
361 Ga0373947_0047794 3300035725 Bacteria 2565
362 Ga0373937_0009545 3300036401 Bacteria 8440
363 Ga0373937_0123235 3300036401 Bacteria 2416
364 Ga0373937_0163142 3300036401 Bacteria 2089
365 Ga0373937_0207511 3300036401 Bacteria 1842
366 Ga0373937_0269021 3300036401 Bacteria 1608
367 Ga0373937_0311687 3300036401 Bacteria 1488
368 Ga0373937_0516886 3300036401 Bacteria 1134
369 Ga0373925_0000388 3300037068 Bacteria 45168
370 Ga0373925_0019909 3300037068 Bacteria 4881
371 Ga0373925_0039684 3300037068 Bacteria 3483
372 Ga0373925_0063405 3300037068 Bacteria 2781
373 Ga0373925_0073368 3300037068 Bacteria 2590
374 Ga0373925_0185800 3300037068 Bacteria 1647
375 Ga0395899_0150829 3300037312 Bacteria 1648
376 Ga0395905_0126718 3300037471 Bacteria 2401
377 Ga0436364_1491650 3300037853 Bacteria 3677
378 Ga0395901_0178070 3300038443 Bacteria 2230
379 Ga0395901_0307008 3300038443 Bacteria 1644
380 Ga0451841_1409783 3300041498 Bacteria 1741
381 Ga0439448_0017969 3300042005 Bacteria 2162
382 Ga0439448_0026744 3300042005 Bacteria 1815
383 Ga0439448_0036345 3300042005 Bacteria 1580
384 Ga0439450_004827 3300042008 Bacteria 2331
385 Ga0439463_002108 3300042016 Bacteria 5143
386 Ga0439444_0004787 3300042437 Bacteria 1982
387 Ga0439464_0018352 3300042439 Bacteria 1903
388 Ga0439460_0026370 3300042461 Bacteria 1625
389 Ga0439440_0039003 3300042993 Bacteria 1151
390 Ga0439440_0046849 3300042993 Bacteria 1069
391 Ga0466963_0187828 3300044694 Bacteria 1443
392 Ga0466967_0003976 3300045976 Bacteria 9844
393 Ga0466967_0018600 3300045976 Bacteria 5559
394 Ga0466967_0120630 3300045976 Bacteria 2422
395 Ga0495592_0015295 3300046454 Bacteria 5822
396 Ga0495603_0005376 3300046455 Bacteria 7638
397 Ga0495603_0067507 3300046455 Bacteria 2105
398 Ga0495629_0002832 3300046459 Bacteria 13257
399 Ga0495629_0006031 3300046459 Bacteria 9009
400 Ga0495629_0025563 3300046459 Bacteria 4195
401 Ga0495629_0056940 3300046459 Bacteria 2733
402 Ga0495641_0014059 3300046461 Bacteria 4353
403 Ga0495641_0019189 3300046461 Bacteria 3507
404 Ga0495641_0043702 3300046461 Bacteria 2071
405 Ga0495651_0011899 3300046462 Bacteria 6693
406 Ga0495651_0015879 3300046462 Bacteria 5830
407 Ga0495651_0018821 3300046462 Bacteria 5349
408 Ga0495651_0078661 3300046462 Bacteria 2494
409 Ga0495653_0010999 3300046463 Bacteria 7404
410 Ga0495653_0069338 3300046463 Bacteria 2642
411 Ga0495653_0096041 3300046463 Bacteria 2155
412 Ga0495580_0057075 3300046472 Bacteria 2748
413 Ga0495580_0059896 3300046472 Bacteria 2675
414 Ga0495582_0006598 3300046473 Bacteria 6442
415 Ga0495582_0010742 3300046473 Bacteria 5037
416 Ga0495582_0012503 3300046473 Bacteria 4678
417 Ga0495582_0157452 3300046473 Bacteria 1291
418 Ga0495639_0001085 3300046475 Bacteria 12251
419 Ga0495639_0015642 3300046475 Bacteria 3290
420 Ga0495639_0015895 3300046475 Bacteria 3264
421 Ga0495662_0000072 3300046476 Bacteria 35449
422 Ga0495662_0016584 3300046476 Bacteria 3569
423 Ga0495662_0018801 3300046476 Bacteria 3344
424 Ga0495662_0038552 3300046476 Bacteria 2309
425 Ga0495662_0043433 3300046476 Bacteria 2169
426 Ga0495664_0000705 3300046477 Bacteria 17012
427 Ga0495664_0010525 3300046477 Bacteria 5192
428 Ga0495664_0045099 3300046477 Bacteria 2614
429 Ga0495664_0062041 3300046477 Bacteria 2225
430 Ga0495664_0179883 3300046477 Bacteria 1282
431 Ga0495664_0189632 3300046477 Bacteria 1246
432 Ga0495608_0018014 3300046511 Bacteria 4879
433 Ga0495608_0038045 3300046511 Bacteria 3234
434 Ga0495608_0064672 3300046511 Bacteria 2397
435 Ga0495608_0102618 3300046511 Bacteria 1843
436 Ga0495618_0014126 3300046514 Bacteria 4862
437 Ga0495618_0046863 3300046514 Bacteria 2728
438 Ga0495618_0049749 3300046514 Bacteria 2647
439 Ga0495628_0020741 3300046516 Bacteria 5415
440 Ga0495628_0107915 3300046516 Bacteria 2143
441 Ga0495628_0164962 3300046516 Bacteria 1682
442 Ga0495630_0008525 3300046517 Bacteria 7357
443 Ga0495630_0034906 3300046517 Bacteria 3757
444 Ga0495630_0044605 3300046517 Bacteria 3314
445 Ga0495630_0061310 3300046517 Bacteria 2824
446 Ga0495630_0108798 3300046517 Bacteria 2100
447 Ga0495666_0010423 3300046526 Bacteria 4635
448 Ga0495666_0014384 3300046526 Bacteria 3940
449 Ga0495652_0011657 3300046529 Bacteria 7945
450 Ga0495652_0176592 3300046529 Bacteria 1643
451 Ga0495652_0205001 3300046529 Bacteria 1493
452 Ga0495665_0042240 3300046531 Bacteria 2427
453 Ga0495640_0034637 3300046533 Bacteria 3577
454 Ga0495640_0094410 3300046533 Bacteria 1970
455 Ga0495586_0032980 3300046535 Bacteria 2778
456 Ga0495586_0191832 3300046535 Unclassified 1157
457 Ga0495587_0047423 3300046536 Bacteria 2547
458 Ga0495587_0108991 3300046536 Bacteria 1591
459 Ga0495645_0006680 3300046543 Bacteria 8013
460 Ga0495645_0018464 3300046543 Bacteria 5008
461 Ga0495645_0077957 3300046543 Bacteria 2382
462 Ga0495645_0081247 3300046543 Bacteria 2325
463 Ga0495645_0174357 3300046543 Bacteria 1478
464 Ga0495667_0005926 3300046559 Bacteria 8272
465 Ga0495667_0025524 3300046559 Bacteria 3981
466 Ga0495667_0030425 3300046559 Bacteria 3627
467 Ga0495667_0030947 3300046559 Bacteria 3594
468 Ga0495667_0057787 3300046559 Bacteria 2549
469 Ga0495667_0088016 3300046559 Bacteria 2013
470 Ga0495667_0213989 3300046559 Bacteria 1231
471 Ga0495656_0098902 3300046615 Bacteria 1346
472 Ga0495634_0019496 3300046642 Bacteria 4817
473 Ga0495634_0021656 3300046642 Bacteria 4539
474 Ga0495634_0029896 3300046642 Bacteria 3767
475 Ga0495634_0083905 3300046642 Bacteria 2078
476 Ga0495634_0124339 3300046642 Bacteria 1649
477 Ga0495635_0017860 3300046663 Bacteria 4954
478 Ga0495635_0041558 3300046663 Bacteria 3175
479 Ga0495635_0065469 3300046663 Bacteria 2493
480 Ga0495635_0165142 3300046663 Bacteria 1506
481 Ga0495635_0216754 3300046663 Bacteria 1295
482 Ga0495635_0446643 3300046663 Bacteria 855
483 Ga0495588_0119375 3300046674 Bacteria 1390
484 Ga0495657_0014491 3300046675 Bacteria 5786
485 Ga0495657_0024638 3300046675 Bacteria 4283
486 Ga0495657_0038360 3300046675 Bacteria 3297
487 Ga0495657_0040424 3300046675 Bacteria 3198
488 Ga0495657_0115361 3300046675 Bacteria 1697
489 Ga0495657_0203861 3300046675 Bacteria 1204
490 Ga0495599_0002523 3300046678 Bacteria 10650
491 Ga0495599_0018542 3300046678 Bacteria 4335
492 Ga0495599_0051202 3300046678 Bacteria 2588
493 Ga0495599_0173904 3300046678 Bacteria 1328
494 Ga0495623_0041857 3300046679 Bacteria 2920
495 Ga0495623_0041927 3300046679 Bacteria 2917
496 Ga0495623_0166813 3300046679 Bacteria 1289
497 Ga0495646_0003516 3300046680 Bacteria 9759
498 Ga0495658_0010427 3300046683 Bacteria 4649
499 Ga0495658_0010930 3300046683 Bacteria 4550
500 Ga0495613_0001052 3300046689 Bacteria 21060
501 Ga0495613_0050959 3300046689 Bacteria 3052
502 Ga0495613_0089011 3300046689 Bacteria 2236
503 Ga0495613_0107182 3300046689 Bacteria 2016
504 Ga0495613_0113868 3300046689 Bacteria 1947
505 Ga0495624_0042212 3300046690 Bacteria 2915
506 Ga0495624_0058422 3300046690 Bacteria 2422
507 Ga0495624_0078763 3300046690 Bacteria 2043
508 Ga0495624_0108671 3300046690 Bacteria 1706
509 Ga0495624_0231027 3300046690 Bacteria 1120
510 Ga0495600_0016221 3300046809 Bacteria 4723
511 Ga0495600_0048740 3300046809 Bacteria 2763
512 Ga0495600_0051056 3300046809 Bacteria 2699
513 Ga0495581_0000171 3300047315 Bacteria 29338
514 Ga0495581_0005798 3300047315 Bacteria 7161
515 Ga0495581_0008819 3300047315 Bacteria 5837
516 Ga0495581_0008932 3300047315 Bacteria 5801
517 Ga0495581_0195158 3300047315 Bacteria 1184
518 Ga0495604_0041021 3300047317 Bacteria 3632
519 Ga0495604_0060874 3300047317 Bacteria 2889
520 Ga0495674_0001843 3300047319 Bacteria 20894
521 Ga0495674_0004679 3300047319 Bacteria 13158
522 Ga0495674_0028926 3300047319 Bacteria 5048
523 Ga0495674_0035509 3300047319 Bacteria 4495
524 Ga0495674_0065338 3300047319 Bacteria 3160
525 Ga0495674_0105580 3300047319 Bacteria 2393
526 Ga0495674_0168076 3300047319 Bacteria 1831
527 Ga0495676_0008582 3300047321 Bacteria 9359
528 Ga0495676_0033313 3300047321 Bacteria 4341
529 Ga0495680_0006831 3300047322 Bacteria 10541
530 Ga0495680_0008389 3300047322 Bacteria 9397
531 Ga0495680_0011636 3300047322 Bacteria 7775
532 Ga0495680_0013934 3300047322 Bacteria 6991
533 Ga0495680_0102773 3300047322 Bacteria 2127
534 Ga0495680_0240060 3300047322 Bacteria 1287
535 Ga0495687_074177 3300047443 Bacteria 1354
536 Ga0495675_0030343 3300047444 Bacteria 3449
537 Ga0495675_0048495 3300047444 Bacteria 2701
538 Ga0495675_0249180 3300047444 Bacteria 1067
539 Ga0495684_0003627 3300047471 Bacteria 12033
540 Ga0495684_0010765 3300047471 Bacteria 7068
541 Ga0495684_0013363 3300047471 Bacteria 6322
542 Ga0495684_0015961 3300047471 Bacteria 5784
543 Ga0495684_0016920 3300047471 Bacteria 5617
544 Ga0495684_0023318 3300047471 Bacteria 4758
545 Ga0495684_0069058 3300047471 Bacteria 2687
546 Ga0495684_0159498 3300047471 Bacteria 1683
547 Ga0495684_0185372 3300047471 Bacteria 1541
548 Ga0495593_0041759 3300047673 Bacteria 2464
549 Ga0495593_0072712 3300047673 Bacteria 1784
550 Ga0495602_0039018 3300048088 Bacteria 4380
551 Ga0495602_0041002 3300048088 Bacteria 4233
552 Ga0495602_0051644 3300048088 Bacteria 3660
553 Ga0495602_0059659 3300048088 Bacteria 3328
554 Ga0495602_0068411 3300048088 Bacteria 3049
555 Ga0495614_0018624 3300048089 Bacteria 3007
556 Ga0495614_0036387 3300048089 Bacteria 2113
557 Ga0496100_0172345 3300048903 Bacteria 1559
558 Ga0496100_0492471 3300048903 Bacteria 944
559 Ga0496102_0053189 3300048905 Bacteria 3692
560 Ga0496102_0188567 3300048905 Bacteria 1943
561 Ga0496103_0081545 3300048906 Bacteria 2035
562 Ga0496104_0000996 3300048907 Bacteria 24228
563 Ga0496104_0063109 3300048907 Bacteria 3513
564 Ga0496104_0169964 3300048907 Bacteria 2090
565 Ga0496104_0194823 3300048907 Bacteria 1938
566 Ga0496104_0210967 3300048907 Bacteria 1853
567 Ga0496105_0001412 3300048908 Bacteria 16884
568 Ga0496105_0036418 3300048908 Bacteria 4053
569 Ga0496105_0202592 3300048908 Bacteria 1619
570 Ga0496106_0097133 3300048909 Bacteria 2280
571 Ga0496108_0034312 3300048911 Bacteria 4215
572 Ga0496108_0145649 3300048911 Bacteria 2042
573 Ga0496109_0012494 3300048912 Bacteria 7332
574 Ga0496109_0057856 3300048912 Bacteria 3540
575 Ga0496110_0171646 3300048913 Bacteria 1968
576 Ga0496111_0201479 3300048914 Bacteria 1479
577 Ga0496112_0002003 3300048915 Bacteria 16109
578 Ga0496112_0369690 3300048915 Bacteria 1375
579 Ga0496113_0064224 3300048916 Bacteria 2775
580 Ga0496113_0225936 3300048916 Bacteria 1492
581 Ga0496114_0070930 3300048917 Bacteria 2927
582 Ga0496114_0292384 3300048917 Bacteria 1437
583 Ga0496114_0308535 3300048917 Bacteria 1397
584 Ga0496115_0019288 3300048918 Bacteria 5248
585 Ga0496115_0039179 3300048918 Bacteria 3762
586 Ga0496115_0056515 3300048918 Bacteria 3154
587 Ga0496115_0058612 3300048918 Bacteria 3099
588 Ga0496126_0114752 3300048929 Bacteria 2343
589 Ga0501038_0361767 3300049574 Bacteria 1128
590 Ga0501047_0032084 3300049581 Bacteria 5070
591 Ga0501047_0085272 3300049581 Bacteria 3035
592 Ga0501077_0078308 3300049593 Bacteria 2095
593 Ga0501208_011849 3300049655 Bacteria 1268
594 nmdc:mga06z11_11971_c1 3300050494 Bacteria 3760
595 nmdc:mga04h51_4100_c1 3300050495 Bacteria 3593
596 nmdc:mga05p37_137190_c1 3300050507 Bacteria 2998
597 nmdc:mga05p37_17510_c1 3300050507 Bacteria 8650
598 nmdc:mga05p37_24233_c1 3300050507 Bacteria 7374
599 nmdc:mga09592_14878_c1 3300050508 Bacteria 6354
600 nmdc:mga09592_40109_c1 3300050508 Bacteria 3934
601 nmdc:mga0qj67_1820_c1 3300050509 Bacteria 15094
602 nmdc:mga06r32_5618_c1 3300050510 Bacteria 11277
603 nmdc:mga08y16_3739_c1 3300050511 Bacteria 15846
604 nmdc:mga08y16_8129_c1 3300050511 Bacteria 10972
605 nmdc:mga08y16_98733_c1 3300050511 Bacteria 3041
606 nmdc:mga0n895_2266_c1 3300050512 Bacteria 14912
607 nmdc:mga0n895_25972_c1 3300050512 Bacteria 5540
608 nmdc:mga0n895_40493_c1 3300050512 Bacteria 4526
609 nmdc:mga0rr50_1259_c1 3300050513 Bacteria 13790
610 nmdc:mga0rr50_4000_c1 3300050513 Bacteria 8592
611 nmdc:mga0rr50_9469_c1 3300050513 Bacteria 6125
612 nmdc:mga08x19_58237_c1 3300050514 Bacteria 2498
613 nmdc:mga08x19_59181_c1 3300050514 Bacteria 2480
614 nmdc:mga0a205_17163_c1 3300050515 Bacteria 6780
615 nmdc:mga0a205_315397_c1 3300050515 Bacteria 1435
616 nmdc:mga0a205_3599_c1 3300050515 Bacteria 13867
617 nmdc:mga0a205_4794_c1 3300050515 Bacteria 12159
618 nmdc:mga0a205_7549_c2 3300050515 Bacteria 7279
619 Ga0495601_0032660 3300053077 Bacteria 3241
620 Ga0495601_0067835 3300053077 Bacteria 2272
621 Ga0495601_0157238 3300053077 Bacteria 1484
622 Ga0495612_0006093 3300053078 Bacteria 4962
623 Ga0495612_0008753 3300053078 Bacteria 4106
624 Ga0495612_0016123 3300053078 Bacteria 2994
625 Ga0495612_0070444 3300053078 Bacteria 1457
626 Ga0495595_0042150 3300053084 Bacteria 2091
627 Ga0495619_0016223 3300053085 Bacteria 4714
628 Ga0495619_0112958 3300053085 Bacteria 1857
629 Ga0466962_0041894 3300061719 Bacteria 2191
630 2558905607 2558860112 Bacteria 9931328
631 2686537171 2684623035 Bacteria 8032739
632 2795782378 2795385470 Bacteria 8317180
633 Ga0496126_0013787
634 JGI24739J22299_10018707
635 JGI24737J22298_10024631
636 JGI24738J21930_10008833
637 JGI25406J46586_10076147
638 rootL2_10137437
639 JGI25404J52841_10007612
640 Ga0070680_100596940
641 Ga0070682_100090851
642 Ga0070660_100231613
643 Ga0070689_100512627
644 Ga0070661_100053958
645 Ga0070674_100087761
646 Ga0070667_100261250
647 Ga0070709_10020100
648 Ga0070709_10033632
649 Ga0070709_10067358
650 Ga0070709_10178241
651 Ga0070709_10188431
652 Ga0070709_10282665
653 Ga0070714_100060989
654 Ga0070714_100088317
655 Ga0070714_100117490
656 Ga0070714_100144816
657 Ga0070714_100163835
658 Ga0070714_100246495
659 Ga0070713_100040354
660 Ga0070713_100058556
661 Ga0070713_100080824
662 Ga0070713_100089407
663 Ga0070713_100185831
664 Ga0070710_10005396
665 Ga0070710_10101394
666 Ga0070710_10106722
667 Ga0070710_10109329
668 Ga0070710_10144556
669 Ga0070711_100012344
670 Ga0070711_100047455
671 Ga0070711_100098312
672 Ga0070711_100218376
673 Ga0070700_100016315
674 Ga0070708_100071696
675 Ga0070708_100690599
676 Ga0070662_100012372
677 Ga0070662_100519514
678 Ga0070681_10145848
679 Ga0068867_100497967
680 Ga0070706_100014433
681 Ga0070706_100152449
682 Ga0070706_100175270
683 Ga0070706_100355445
684 Ga0070707_100041071
685 Ga0070707_100065647
686 Ga0070707_100104425
687 Ga0070698_100048534
688 Ga0070698_100151851
689 Ga0070699_100003177
690 Ga0070679_100134255
691 Ga0070684_100052434
692 Ga0070697_100001236
693 Ga0070697_100027203
694 Ga0068853_100122364
695 Ga0070695_100113985
696 Ga0070693_100184140
697 Ga0068855_100061014
698 Ga0068857_100046067
699 Ga0068856_100003242
700 Ga0068856_100057332
701 Ga0068856_100161019
702 Ga0070702_100115407
703 Ga0068852_100380369
704 Ga0068861_100286424
705 Ga0068861_100597088
706 Ga0068863_100171767
707 Ga0068863_100329176
708 Ga0068858_100143369
709 Ga0068860_100135683
710 Ga0068862_100258660
711 Ga0081455_10272792
712 Ga0081540_1002341
713 Ga0081539_10000289
714 Ga0081539_10000573
715 Ga0081539_10001928
716 Ga0081539_10036540
717 Ga0070717_10001073
718 Ga0070717_10046654
719 Ga0070717_10079051
720 Ga0070717_10106234
721 Ga0070717_10122030
722 Ga0070717_10297443
723 Ga0070717_10346432
724 Ga0070717_10565891
725 Ga0075368_10000590
726 Ga0075432_10000317
727 Ga0075432_10004080
728 Ga0070715_10014149
729 Ga0070715_10017507
730 Ga0070715_10036409
731 Ga0070715_10093262
732 Ga0070715_10101157
733 Ga0070716_100015607
734 Ga0070716_100016760
735 Ga0070716_100023513
736 Ga0070712_100156105
737 Ga0070712_100218462
738 Ga0070712_100252298
739 Ga0075367_10006083
740 Ga0075427_10002455
741 Ga0097621_100386745
742 Ga0068871_100044568
743 Ga0068871_100265321
744 Ga0075428_100011893
745 Ga0075428_100184721
746 Ga0075428_100565734
747 Ga0075430_100069435
748 Ga0075430_100085531
749 Ga0075431_100035390
750 Ga0075433_10001153
751 Ga0075433_10004431
752 Ga0075433_10029117
753 Ga0075433_10276042
754 Ga0075433_10482684
755 Ga0075434_100000949
756 Ga0075434_100036405
757 Ga0075429_100021839
758 Ga0075429_100030139
759 Ga0068865_100013753
760 Ga0075436_100030770
761 Ga0075436_100086686
762 Ga0075435_100000988
763 Ga0105251_10034154
764 Ga0105250_10079626
765 Ga0105240_10147873
766 Ga0105240_10551129
767 Ga0111539_10002959
768 Ga0111539_10010319
769 Ga0111539_10011807
770 Ga0111539_10035517
771 Ga0105245_10014991
772 Ga0105245_10100888
773 Ga0105245_10123238
774 Ga0105245_10309415
775 Ga0105247_10134314
776 Ga0114129_10013764
777 Ga0114129_10027629
778 Ga0114129_10078177
779 Ga0114129_10194547
780 Ga0105243_10003549
781 Ga0105243_10724726
782 Ga0105242_10057411
783 Ga0105248_10199338
784 Ga0105238_10566320
785 Ga0105249_10013796
786 Ga0099796_10119324
787 Ga0105239_10095318
788 Ga0105239_10781695
789 Ga0105246_10074935
790 Ga0157371_10465735
791 Ga0157370_10542922
792 Ga0157374_10188619
793 Ga0157378_10134216
794 Ga0163162_10018707
795 Ga0163162_10043452
796 Ga0157372_10044872
797 Ga0182008_10111129
798 Ga0157379_10272546
799 Ga0157376_10076153
800 Ga0157376_10086891
801 Ga0224712_10127334
802 Ga0207692_10001112
803 Ga0207692_10041466
804 Ga0207692_10043502
805 Ga0207692_10087259
806 Ga0207692_10132053
807 Ga0207688_10002396
808 Ga0207688_10112103
809 Ga0207680_10142094
810 Ga0207699_10002882
811 Ga0207699_10026180
812 Ga0207699_10032645
813 Ga0207684_10028579
814 Ga0207684_10056705
815 Ga0207684_10266740
816 Ga0207707_10278009
817 Ga0207693_10001968
818 Ga0207693_10006757
819 Ga0207693_10021569
820 Ga0207693_10223802
821 Ga0207693_10288978
822 Ga0207693_10325375
823 Ga0207663_10016702
824 Ga0207663_10052592
825 Ga0207663_10074947
826 Ga0207663_10089219
827 Ga0207663_10102595
828 Ga0207663_10179850
829 Ga0207663_10228706
830 Ga0207660_10304016
831 Ga0207662_10023176
832 Ga0207646_10010192
833 Ga0207646_10046074
834 Ga0207646_10055654
835 Ga0207694_10040520
836 Ga0207687_10062648
837 Ga0207700_10005886
838 Ga0207700_10021274
839 Ga0207700_10034658
840 Ga0207700_10047554
841 Ga0207700_10052750
842 Ga0207700_10053798
843 Ga0207700_10060960
844 Ga0207700_10117269
845 Ga0207700_10131761
846 Ga0207700_10356134
847 Ga0207664_10010596
848 Ga0207664_10011338
849 Ga0207664_10029596
850 Ga0207664_10031083
851 Ga0207664_10051452
852 Ga0207664_10053030
853 Ga0207664_10077273
854 Ga0207664_10108422
855 Ga0207664_10110634
856 Ga0207664_10165471
857 Ga0207690_10226082
858 Ga0207706_10002325
859 Ga0207706_10006532
860 Ga0207706_10076927
861 Ga0207686_10034815
862 Ga0207669_10023647
863 Ga0207669_10102284
864 Ga0207704_10033232
865 Ga0207665_10001614
866 Ga0207665_10004928
867 Ga0207665_10010166
868 Ga0207665_10025993
869 Ga0207689_10016614
870 Ga0207661_10312599
871 Ga0207667_10290497
872 Ga0207712_10107149
873 Ga0207712_10154140
874 Ga0207668_10425266
875 Ga0207678_10005759
876 Ga0207708_10020939
877 Ga0207702_10126868
878 Ga0207702_10149483
879 Ga0207702_10628926
880 Ga0207641_10428762
881 Ga0207648_10082131
882 Ga0207674_10006832
883 Ga0207675_100004599
884 Ga0207675_100011570
885 Ga0207675_100037905
886 Ga0207683_10011227
887 Ga0209813_10005266
888 Ga0207428_10001448
889 Ga0207428_10002935
890 Ga0268264_10072827
891 Ga0265337_1005691
892 Ga0265326_10000682
893 Ga0265319_1004253
894 Ga0265334_10003003
895 Ga0265323_10012083
896 Ga0265322_10022590
897 Ga0265338_10000059
898 Ga0265324_10000821
899 Ga0307512_10006731
900 Ga0265332_10004728
901 Ga0265320_10006149
902 Ga0265325_10014788
903 Ga0265340_10006340
904 Ga0265339_10133698
905 Ga0265316_10013649
906 Ga0307513_10018496
907 Ga0307513_10469394
908 Ga0307408_100007903
909 Ga0265313_10009896
910 Ga0265314_10014727
911 Ga0265342_10001214
912 Ga0307516_10162518
913 Ga0307405_10002428
914 Ga0307405_10024907
915 Ga0307413_10094481
916 Ga0307413_10374695
917 Ga0307518_10128744
918 Ga0307410_10001225
919 Ga0307410_10003667
920 Ga0307410_10009870
921 Ga0307410_10552719
922 Ga0307406_10000385
923 Ga0307406_10001181
924 Ga0307406_10108777
925 Ga0307407_10005227
926 Ga0307407_10058447
927 Ga0307407_10080083
928 Ga0307409_100000802
929 Ga0307409_100058367
930 Ga0307409_100138858
931 Ga0307416_100000957
932 Ga0307414_10000836
933 Ga0307414_10169620
934 Ga0307414_10289421
935 Ga0307411_10012234
936 Ga0307411_10195544
937 Ga0307411_10259007
938 Ga0307411_10507304
939 Ga0307415_100021429
940 Ga0307415_100135252
941 Ga0307415_100226903
942 Ga0307507_10000113
943 Ga0373948_0002719
944 Ga0373926_0000322
945 Ga0373926_0007259
946 Ga0373929_0016062
947 Ga0373934_0008045
948 Ga0373934_0068802
949 Ga0373944_0020364
950 Ga0373952_0003468
951 Ga0373936_0000698
952 Ga0373936_0001663
953 Ga0373939_0035175
954 Ga0373945_0000194
955 Ga0373945_0001968
956 Ga0373945_0031182
957 Ga0373953_0023345
958 Ga0373953_0081647
959 Ga0373954_0022558
960 Ga0373954_0074046
961 Ga0373956_0023102
962 Ga0373956_0046245
963 Ga0373957_0000988
964 Ga0373957_0015871
965 Ga0373957_0033675
966 Ga0373943_0000231
967 Ga0373943_0009232
968 Ga0373943_0013316
969 Ga0373943_0063120
970 Ga0373943_0197233
971 Ga0373946_0001176
972 Ga0373946_0061489
973 Ga0373955_0008188
974 Ga0373955_0050320
975 Ga0373955_0056654
976 Ga0373942_0043555
977 Ga0373961_0105464
978 Ga0373962_0006182
979 Ga0373924_0002392
980 Ga0373924_0010209
981 Ga0373931_0028101
982 Ga0373935_0004555
983 Ga0373935_0007081
984 Ga0373935_0428403
985 Ga0373927_0007094
986 Ga0373927_0008331
987 Ga0373927_0044340
988 Ga0373927_0141027
989 Ga0373933_0021367
990 Ga0373933_0025677
991 Ga0373947_0000336
992 Ga0373947_0000416
993 Ga0373947_0047794
994 Ga0373937_0009545
995 Ga0373937_0123235
996 Ga0373937_0163142
997 Ga0373937_0207511
998 Ga0373937_0269021
999 Ga0373937_0311687
1000 Ga0373937_0516886
1001 Ga0373925_0000388
1002 Ga0373925_0019909
1003 Ga0373925_0039684
1004 Ga0373925_0063405
1005 Ga0373925_0073368
1006 Ga0373925_0185800
1007 Ga0395899_0150829
1008 Ga0395905_0126718
1009 Ga0436364_1491650
1010 Ga0395901_0178070
1011 Ga0395901_0307008
1012 Ga0451841_1409783
1013 Ga0439448_0017969
1014 Ga0439448_0026744
1015 Ga0439448_0036345
1016 Ga0439450_004827
1017 Ga0439463_002108
1018 Ga0439444_0004787
1019 Ga0439464_0018352
1020 Ga0439460_0026370
1021 Ga0439440_0039003
1022 Ga0439440_0046849
1023 Ga0466963_0187828
1024 Ga0466967_0003976
1025 Ga0466967_0018600
1026 Ga0466967_0120630
1027 Ga0495592_0015295
1028 Ga0495603_0005376
1029 Ga0495603_0067507
1030 Ga0495629_0002832
1031 Ga0495629_0006031
1032 Ga0495629_0025563
1033 Ga0495629_0056940
1034 Ga0495641_0014059
1035 Ga0495641_0019189
1036 Ga0495641_0043702
1037 Ga0495651_0011899
1038 Ga0495651_0015879
1039 Ga0495651_0018821
1040 Ga0495651_0078661
1041 Ga0495653_0010999
1042 Ga0495653_0069338
1043 Ga0495653_0096041
1044 Ga0495580_0057075
1045 Ga0495580_0059896
1046 Ga0495582_0006598
1047 Ga0495582_0010742
1048 Ga0495582_0012503
1049 Ga0495582_0157452
1050 Ga0495639_0001085
1051 Ga0495639_0015642
1052 Ga0495639_0015895
1053 Ga0495662_0000072
1054 Ga0495662_0016584
1055 Ga0495662_0018801
1056 Ga0495662_0038552
1057 Ga0495662_0043433
1058 Ga0495664_0000705
1059 Ga0495664_0010525
1060 Ga0495664_0045099
1061 Ga0495664_0062041
1062 Ga0495664_0179883
1063 Ga0495664_0189632
1064 Ga0495608_0018014
1065 Ga0495608_0038045
1066 Ga0495608_0064672
1067 Ga0495608_0102618
1068 Ga0495618_0014126
1069 Ga0495618_0046863
1070 Ga0495618_0049749
1071 Ga0495628_0020741
1072 Ga0495628_0107915
1073 Ga0495628_0164962
1074 Ga0495630_0008525
1075 Ga0495630_0034906
1076 Ga0495630_0044605
1077 Ga0495630_0061310
1078 Ga0495630_0108798
1079 Ga0495666_0010423
1080 Ga0495666_0014384
1081 Ga0495652_0011657
1082 Ga0495652_0176592
1083 Ga0495652_0205001
1084 Ga0495665_0042240
1085 Ga0495640_0034637
1086 Ga0495640_0094410
1087 Ga0495586_0032980
1088 Ga0495586_0191832
1089 Ga0495587_0047423
1090 Ga0495587_0108991
1091 Ga0495645_0006680
1092 Ga0495645_0018464
1093 Ga0495645_0077957
1094 Ga0495645_0081247
1095 Ga0495645_0174357
1096 Ga0495667_0005926
1097 Ga0495667_0025524
1098 Ga0495667_0030425
1099 Ga0495667_0030947
1100 Ga0495667_0057787
1101 Ga0495667_0088016
1102 Ga0495667_0213989
1103 Ga0495656_0098902
1104 Ga0495634_0019496
1105 Ga0495634_0021656
1106 Ga0495634_0029896
1107 Ga0495634_0083905
1108 Ga0495634_0124339
1109 Ga0495635_0017860
1110 Ga0495635_0041558
1111 Ga0495635_0065469
1112 Ga0495635_0165142
1113 Ga0495635_0216754
1114 Ga0495635_0446643
1115 Ga0495588_0119375
1116 Ga0495657_0014491
1117 Ga0495657_0024638
1118 Ga0495657_0038360
1119 Ga0495657_0040424
1120 Ga0495657_0115361
1121 Ga0495657_0203861
1122 Ga0495599_0002523
1123 Ga0495599_0018542
1124 Ga0495599_0051202
1125 Ga0495599_0173904
1126 Ga0495623_0041857
1127 Ga0495623_0041927
1128 Ga0495623_0166813
1129 Ga0495646_0003516
1130 Ga0495658_0010427
1131 Ga0495658_0010930
1132 Ga0495613_0001052
1133 Ga0495613_0050959
1134 Ga0495613_0089011
1135 Ga0495613_0107182
1136 Ga0495613_0113868
1137 Ga0495624_0042212
1138 Ga0495624_0058422
1139 Ga0495624_0078763
1140 Ga0495624_0108671
1141 Ga0495624_0231027
1142 Ga0495600_0016221
1143 Ga0495600_0048740
1144 Ga0495600_0051056
1145 Ga0495581_0000171
1146 Ga0495581_0005798
1147 Ga0495581_0008819
1148 Ga0495581_0008932
1149 Ga0495581_0195158
1150 Ga0495604_0041021
1151 Ga0495604_0060874
1152 Ga0495674_0001843
1153 Ga0495674_0004679
1154 Ga0495674_0028926
1155 Ga0495674_0035509
1156 Ga0495674_0065338
1157 Ga0495674_0105580
1158 Ga0495674_0168076
1159 Ga0495676_0008582
1160 Ga0495676_0033313
1161 Ga0495680_0006831
1162 Ga0495680_0008389
1163 Ga0495680_0011636
1164 Ga0495680_0013934
1165 Ga0495680_0102773
1166 Ga0495680_0240060
1167 Ga0495687_074177
1168 Ga0495675_0030343
1169 Ga0495675_0048495
1170 Ga0495675_0249180
1171 Ga0495684_0003627
1172 Ga0495684_0010765
1173 Ga0495684_0013363
1174 Ga0495684_0015961
1175 Ga0495684_0016920
1176 Ga0495684_0023318
1177 Ga0495684_0069058
1178 Ga0495684_0159498
1179 Ga0495684_0185372
1180 Ga0495593_0041759
1181 Ga0495593_0072712
1182 Ga0495602_0039018
1183 Ga0495602_0041002
1184 Ga0495602_0051644
1185 Ga0495602_0059659
1186 Ga0495602_0068411
1187 Ga0495614_0018624
1188 Ga0495614_0036387
1189 Ga0496100_0172345
1190 Ga0496100_0492471
1191 Ga0496102_0053189
1192 Ga0496102_0188567
1193 Ga0496103_0081545
1194 Ga0496104_0000996
1195 Ga0496104_0063109
1196 Ga0496104_0169964
1197 Ga0496104_0194823
1198 Ga0496104_0210967
1199 Ga0496105_0001412
1200 Ga0496105_0036418
1201 Ga0496105_0202592
1202 Ga0496106_0097133
1203 Ga0496108_0034312
1204 Ga0496108_0145649
1205 Ga0496109_0012494
1206 Ga0496109_0057856
1207 Ga0496110_0171646
1208 Ga0496111_0201479
1209 Ga0496112_0002003
1210 Ga0496112_0369690
1211 Ga0496113_0064224
1212 Ga0496113_0225936
1213 Ga0496114_0070930
1214 Ga0496114_0292384
1215 Ga0496114_0308535
1216 Ga0496115_0019288
1217 Ga0496115_0039179
1218 Ga0496115_0056515
1219 Ga0496115_0058612
1220 Ga0496126_0114752
1221 Ga0501038_0361767
1222 Ga0501047_0032084
1223 Ga0501047_0085272
1224 Ga0501077_0078308
1225 Ga0501208_011849
1226 nmdc:mga06z11_11971_c1
1227 nmdc:mga04h51_4100_c1
1228 nmdc:mga05p37_137190_c1
1229 nmdc:mga05p37_17510_c1
1230 nmdc:mga05p37_24233_c1
1231 nmdc:mga09592_14878_c1
1232 nmdc:mga09592_40109_c1
1233 nmdc:mga0qj67_1820_c1
1234 nmdc:mga06r32_5618_c1
1235 nmdc:mga08y16_3739_c1
1236 nmdc:mga08y16_8129_c1
1237 nmdc:mga08y16_98733_c1
1238 nmdc:mga0n895_2266_c1
1239 nmdc:mga0n895_25972_c1
1240 nmdc:mga0n895_40493_c1
1241 nmdc:mga0rr50_1259_c1
1242 nmdc:mga0rr50_4000_c1
1243 nmdc:mga0rr50_9469_c1
1244 nmdc:mga08x19_58237_c1
1245 nmdc:mga08x19_59181_c1
1246 nmdc:mga0a205_17163_c1
1247 nmdc:mga0a205_315397_c1
1248 nmdc:mga0a205_3599_c1
1249 nmdc:mga0a205_4794_c1
1250 nmdc:mga0a205_7549_c2
1251 Ga0495601_0032660
1252 Ga0495601_0067835
1253 Ga0495601_0157238
1254 Ga0495612_0006093
1255 Ga0495612_0008753
1256 Ga0495612_0016123
1257 Ga0495612_0070444
1258 Ga0495595_0042150
1259 Ga0495619_0016223
1260 Ga0495619_0112958
1261 Ga0466962_0041894
1262 2558905607
1263 2686537171
1264 2795782378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

67

304

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dk0-assembly1.cif.gz_A crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma-valerolactone 0.8554 2 276
4gna-assembly1.cif.gz_A mouse smp30/gnl-xylitol complex 0.8548 1 280
4gna-assembly1.cif.gz_A mouse smp30/gnl-xylitol complex 0.852 1 280
5gtq-assembly1.cif.gz_A luciferin-regenerating enzyme at cryogenic temperature 0.8518 1 278
7riz-assembly1.cif.gz_A crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline 0.8492 6 276
ID Description Score Start End Superfamily
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8649 1 278 2.120.10.30
5xfeA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8605 3 278 2.120.10.30
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8562 1 278 2.120.10.30
af_K7L9K2_51_151_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8503 11 78 2.40.10.500
af_A0A2R8Q900_1_232_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8467 13 233 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A4R2J6F0-F1-model_v4 Sugar lactone lactonase YvrE 0.9848 5 272 GO:0016787
AF-A0A6A7MRX3-F1-model_v4 deleted 0.9834 5 237
AF-A0A836TRG1-F1-model_v4 SMP-30/Gluconolactonase/LRE-like region domain-containing protein 0.9791 94 182 GO:0016787
AF-A0A535NBD8-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9774 95 280 GO:0016787
GO:0046872
AF-A0A535NBD8-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9722 95 280 GO:0016787
GO:0046872

Map