F470877

General Info

Members Datasets Scaffolds Average Seq Length
630 360 1260 315

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2510065045|2510252758
Length 376
Sequence SVKDDGASPKNLSNFLSWRPNCLPRPTGLAGASLIQSDRRDALQVIERGRILVCSPVIDPGEIMQKRRIGRSELQVVPLMFGGNVFGWTADEATSFSILDAFVDAGLNFIDTADVYSAWVPGNQGGESETILGKWFRRSGKREQIVLATKVSKHPQRKGLSAANIQAALEDSLRRLQTDYIDVYFSHDDDTSTPLAETLGAYQKLIEAGKVRVIGASNYSGARVEEALAVSRRHGLPEYQLLQPEYNLYDRAQYERDSEPVALAHHLGVVVYYSLASGFLSGKYRSEADLAGKARGSRVEKYLNGRGLRILGALDGVAQRHGSTPAAIALAWLIARPSVTAPIASATSVAQLKGLAAAVQLSLTADDIRELDEASA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
68 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
139 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
143 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
279 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
280 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
281 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
284 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
285 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
286 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
289 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
290 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
291 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
292 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
293 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
294 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
295 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
296 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
297 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
298 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
299 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
300 2519103095 Burkholderia sp. KJ006 Isolate Nodule
301 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
302 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
303 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
304 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
305 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
306 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
307 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
308 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
309 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
310 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
311 2734482264 Dyella sp. AD052 Isolate Unclassified
312 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
313 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
314 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
315 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
316 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
317 2738543009 Luteibacter sp. OK325 Isolate Unclassified
318 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
319 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
320 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
321 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
322 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
323 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
324 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
325 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
326 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
327 2818991450 Burkholderia sp. 604 Isolate Unclassified
328 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
329 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
330 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
331 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
332 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
333 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
334 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
335 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
336 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
337 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
338 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
339 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
340 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
341 2919085039 Luteibacter sp. 1214 Isolate Unclassified
342 2919404418 Luteibacter sp. 3190 Isolate Unclassified
343 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
344 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
345 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
346 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
347 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
348 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
349 2941471342 Luteibacter sp. 621 Isolate Unclassified
350 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
351 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
352 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
353 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
354 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
355 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
356 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
357 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
358 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
359 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
360 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.57
Metatranscriptomes 0
Isolates 11.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.98
Nodule 2.7
Rhizoplane 3.49
Rhizosphere 73.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000545 3300001989 Bacteria 13451
2 JGI24737J22298_10050678 3300001990 Bacteria 1261
3 JGI24735J21928_10000277 3300002067 Bacteria 17882
4 JGI24735J21928_10000913 3300002067 Bacteria 10544
5 JGI24735J21928_10032201 3300002067 Bacteria 1552
6 JGI24738J21930_10000750 3300002075 Bacteria 9340
7 JGI25156J39149_1001344 3300002705 Bacteria 10552
8 JGI25162J39368_1006470 3300002737 Bacteria 2018
9 JGI25152J39213_1015717 3300002773 Bacteria 1483
10 JGI25165J46597_1000902 3300003214 Bacteria 20631
11 rootH2_10014801 3300003320 Bacteria 13269
12 rootH2_10155113 3300003320 Bacteria 1674
13 rootH2_10215603 3300003320 Bacteria 2401
14 JGI25160J50197_1000016 3300003354 Bacteria 247819
15 Ga0055533_1000119 3300003756 Bacteria 90106
16 Ga0055533_1000650 3300003756 Bacteria 11667
17 Ga0055532_1000043 3300003758 Bacteria 195042
18 Ga0055527_1000026 3300003760 Bacteria 192398
19 Ga0055535_1000032 3300003761 Bacteria 195042
20 Ga0055542_1000049 3300003762 Bacteria 195042
21 Ga0055529_1000059 3300003763 Bacteria 195042
22 Ga0065165_1000199 3300005262 Bacteria 104204
23 Ga0065165_1001610 3300005262 Bacteria 23068
24 Ga0065715_10215092 3300005293 Bacteria 1296
25 Ga0070658_10313454 3300005327 Bacteria 1339
26 Ga0070676_10008118 3300005328 Bacteria 5647
27 Ga0068869_100045473 3300005334 Bacteria 3161
28 Ga0070666_10017159 3300005335 Bacteria 4639
29 Ga0070682_100002464 3300005337 Bacteria 10226
30 Ga0070660_100024553 3300005339 Bacteria 4472
31 Ga0070689_100202429 3300005340 Bacteria 1622
32 Ga0070661_100049795 3300005344 Bacteria 3067
33 Ga0070668_100282298 3300005347 Bacteria 1387
34 Ga0070659_100216489 3300005366 Bacteria 1580
35 Ga0070667_100000304 3300005367 Bacteria 54815
36 Ga0070667_100024369 3300005367 Bacteria 5026
37 Ga0070667_100036738 3300005367 Bacteria 4107
38 Ga0070667_100049368 3300005367 Bacteria 3544
39 Ga0070711_100017641 3300005439 Bacteria 4548
40 Ga0070705_100033003 3300005440 Bacteria 2882
41 Ga0070663_100003314 3300005455 Bacteria 9280
42 Ga0070663_100052883 3300005455 Bacteria 2898
43 Ga0070663_100302848 3300005455 Bacteria 1280
44 Ga0070662_100298094 3300005457 Bacteria 1309
45 Ga0070681_10406578 3300005458 Bacteria 1273
46 Ga0070706_100014238 3300005467 Bacteria 7349
47 Ga0068853_100002470 3300005539 Bacteria 13844
48 Ga0068853_100002777 3300005539 Bacteria 13235
49 Ga0068853_100015728 3300005539 Bacteria 6214
50 Ga0068853_100166630 3300005539 Bacteria 1991
51 Ga0070693_100006346 3300005547 Bacteria 5733
52 Ga0070665_100000069 3300005548 Bacteria 202384
53 Ga0070665_100047042 3300005548 Bacteria 4330
54 Ga0070665_100078323 3300005548 Bacteria 3311
55 Ga0068855_100087772 3300005563 Bacteria 3594
56 Ga0068857_100201227 3300005577 Bacteria 1816
57 Ga0068856_100311432 3300005614 Bacteria 1592
58 Ga0068864_100108578 3300005618 Bacteria 2469
59 Ga0068870_10122638 3300005840 Bacteria 1499
60 Ga0068858_100133908 3300005842 Bacteria 2324
61 Ga0068862_100190553 3300005844 Bacteria 1845
62 Ga0081540_1002296 3300005983 Bacteria 15697
63 Ga0070717_10008732 3300006028 Bacteria 7581
64 Ga0075365_10017453 3300006038 Bacteria 4391
65 Ga0068871_100037000 3300006358 Bacteria 3890
66 Ga0105251_10000147 3300009011 Bacteria 71952
67 Ga0105251_10006630 3300009011 Bacteria 7327
68 Ga0105251_10026809 3300009011 Bacteria 2930
69 Ga0105251_10078351 3300009011 Bacteria 1531
70 Ga0105244_10080251 3300009036 Bacteria 1616
71 Ga0105240_10201214 3300009093 Bacteria 2334
72 Ga0105241_10169093 3300009174 Bacteria 1804
73 Ga0105248_10000133 3300009177 Bacteria 86577
74 Ga0105248_10049422 3300009177 Bacteria 4717
75 Ga0105248_10177520 3300009177 Bacteria 2400
76 Ga0105237_10003036 3300009545 Bacteria 20251
77 Ga0105237_10102036 3300009545 Bacteria 2861
78 Ga0105238_10271415 3300009551 Bacteria 1677
79 Ga0105238_10434812 3300009551 Bacteria 1308
80 Ga0105249_10000687 3300009553 Bacteria 30763
81 Ga0105239_10017336 3300010375 Bacteria 7966
82 Ga0105239_10060807 3300010375 Bacteria 4146
83 Ga0105239_10116847 3300010375 Bacteria 2960
84 Ga0157370_10000224 3300013104 Bacteria 71976
85 Ga0157369_10017355 3300013105 Bacteria 8091
86 Ga0157369_10024246 3300013105 Bacteria 6752
87 Ga0157374_10188214 3300013296 Bacteria 2019
88 Ga0163162_10007584 3300013306 Bacteria 10562
89 Ga0157372_10202178 3300013307 Bacteria 2301
90 Ga0182008_10070254 3300014497 Bacteria 1723
91 Ga0182008_10125906 3300014497 Bacteria 1276
92 Ga0182008_10125908 3300014497 Bacteria 1276
93 Ga0182006_1000058 3300015261 Bacteria 167164
94 Ga0182006_1000098 3300015261 Bacteria 101707
95 Ga0182007_10000232 3300015262 Bacteria 37427
96 Ga0182007_10018668 3300015262 Bacteria 2509
97 Ga0182005_1000015 3300015265 Bacteria 387565
98 Ga0182005_1001383 3300015265 Bacteria 9880
99 Ga0182005_1004888 3300015265 Bacteria 4255
100 Ga0182005_1008438 3300015265 Bacteria 3033
101 Ga0183361_10001 3300016635 Bacteria 908583
102 Ga0163161_10000883 3300017792 Bacteria 23311
103 Ga0209674_100017 3300025226 Bacteria 689087
104 Ga0209674_100121 3300025226 Bacteria 132260
105 Ga0209674_100689 3300025226 Bacteria 11835
106 Ga0209672_100001 3300025228 Bacteria 2828210
107 Ga0209147_100022 3300025229 Bacteria 443906
108 Ga0207427_100861 3300025231 Bacteria 13440
109 Ga0209437_101355 3300025233 Bacteria 6357
110 Ga0209258_100033 3300025242 Bacteria 443845
111 Ga0209148_1000046 3300025254 Bacteria 443881
112 Ga0209148_1003015 3300025254 Bacteria 5025
113 Ga0209759_1000071 3300025256 Bacteria 178632
114 Ga0209759_1000118 3300025256 Bacteria 141411
115 Ga0209759_1000162 3300025256 Bacteria 115250
116 Ga0209129_1000356 3300025258 Bacteria 38490
117 Ga0209233_1000050 3300025261 Bacteria 450736
118 Ga0209455_1000038 3300025272 Bacteria 443899
119 Ga0209564_1004774 3300025295 Bacteria 8092
120 Ga0209256_1007368 3300025299 Bacteria 5456
121 Ga0207426_1000007 3300025302 Bacteria 971011
122 Ga0209257_1025798 3300025304 Bacteria 1998
123 Ga0207713_1000064 3300025735 Bacteria 200324
124 Ga0207688_10052367 3300025901 Bacteria 2287
125 Ga0207647_10000005 3300025904 Bacteria 223490
126 Ga0207647_10000806 3300025904 Bacteria 24307
127 Ga0207647_10088756 3300025904 Bacteria 1846
128 Ga0207647_10096137 3300025904 Bacteria 1763
129 Ga0207705_10106564 3300025909 Bacteria 2067
130 Ga0207705_10175894 3300025909 Bacteria 1613
131 Ga0207684_10012632 3300025910 Bacteria 7334
132 Ga0207695_10271046 3300025913 Bacteria 1593
133 Ga0207671_10002990 3300025914 Bacteria 17324
134 Ga0207671_10125641 3300025914 Bacteria 1964
135 Ga0207663_10152306 3300025916 Bacteria 1623
136 Ga0207657_10068050 3300025919 Bacteria 3026
137 Ga0207649_10144685 3300025920 Bacteria 1630
138 Ga0207649_10180054 3300025920 Bacteria 1479
139 Ga0207694_10212820 3300025924 Bacteria 1575
140 Ga0207694_10236134 3300025924 Bacteria 1493
141 Ga0207650_10033804 3300025925 Bacteria 3705
142 Ga0207644_10043554 3300025931 Bacteria 3186
143 Ga0207711_10009537 3300025941 Bacteria 8097
144 Ga0207711_10045319 3300025941 Bacteria 3758
145 Ga0207711_10178002 3300025941 Bacteria 1933
146 Ga0207689_10096149 3300025942 Bacteria 2433
147 Ga0207667_10374804 3300025949 Bacteria 1450
148 Ga0207712_10000230 3300025961 Bacteria 55280
149 Ga0207668_10290393 3300025972 Bacteria 1345
150 Ga0207640_10344093 3300025981 Bacteria 1196
151 Ga0207658_10000104 3300025986 Bacteria 92659
152 Ga0207703_10235479 3300026035 Bacteria 1643
153 Ga0207639_10001288 3300026041 Bacteria 16915
154 Ga0207639_10005836 3300026041 Bacteria 8341
155 Ga0207639_10165527 3300026041 Bacteria 1867
156 Ga0207678_10010389 3300026067 Bacteria 8173
157 Ga0207678_10023311 3300026067 Bacteria 5414
158 Ga0207678_10031576 3300026067 Bacteria 4620
159 Ga0207678_10220509 3300026067 Bacteria 1623
160 Ga0207678_10446998 3300026067 Bacteria 1123
161 Ga0207702_10345234 3300026078 Bacteria 1423
162 Ga0207641_10122894 3300026088 Bacteria 2319
163 Ga0207674_10212729 3300026116 Bacteria 1882
164 Ga0207675_100049514 3300026118 Bacteria 3921
165 Ga0207683_10397906 3300026121 Bacteria 1267
166 Ga0207698_10208519 3300026142 Bacteria 1756
167 Ga0268266_10000001 3300028379 Bacteria 4040580
168 Ga0268266_10087940 3300028379 Bacteria 2719
169 Ga0268265_10086989 3300028380 Bacteria 2485
170 Ga0268264_10066923 3300028381 Bacteria 3031
171 Ga0265332_10089759 3300031238 Bacteria 1300
172 Ga0265316_10126055 3300031344 Bacteria 1931
173 Ga0307408_100001982 3300031548 Bacteria 14776
174 Ga0307408_100011562 3300031548 Bacteria 5833
175 Ga0307408_100024768 3300031548 Bacteria 4102
176 Ga0307408_100044108 3300031548 Bacteria 3177
177 Ga0307405_10006524 3300031731 Bacteria 5747
178 Ga0307405_10046370 3300031731 Bacteria 2670
179 Ga0307405_10185647 3300031731 Bacteria 1497
180 Ga0307413_10012167 3300031824 Bacteria 4271
181 Ga0307413_10034011 3300031824 Bacteria 2908
182 Ga0307413_10053950 3300031824 Bacteria 2436
183 Ga0307413_10124877 3300031824 Bacteria 1750
184 Ga0307413_10149677 3300031824 Bacteria 1625
185 Ga0307410_10053057 3300031852 Bacteria 2742
186 Ga0307410_10185292 3300031852 Bacteria 1579
187 Ga0307410_10273984 3300031852 Bacteria 1321
188 Ga0307410_10419508 3300031852 Bacteria 1085
189 Ga0307406_10307579 3300031901 Bacteria 1220
190 Ga0307407_10013285 3300031903 Bacteria 3991
191 Ga0307407_10026718 3300031903 Bacteria 3061
192 Ga0307407_10176050 3300031903 Bacteria 1413
193 Ga0307412_10000011 3300031911 Bacteria 405842
194 Ga0307412_10000221 3300031911 Bacteria 38318
195 Ga0307412_10015225 3300031911 Bacteria 4553
196 Ga0307412_10043437 3300031911 Bacteria 2926
197 Ga0307412_10060270 3300031911 Bacteria 2546
198 Ga0307412_10466257 3300031911 Bacteria 1044
199 Ga0307409_100033967 3300031995 Bacteria 3719
200 Ga0307409_100157869 3300031995 Bacteria 1979
201 Ga0307409_100174269 3300031995 Bacteria 1897
202 Ga0307409_100226566 3300031995 Bacteria 1691
203 Ga0307409_100310946 3300031995 Bacteria 1470
204 Ga0307409_100321396 3300031995 Bacteria 1448
205 Ga0307416_100058502 3300032002 Bacteria 3125
206 Ga0307416_100352842 3300032002 Bacteria 1489
207 Ga0307416_100378983 3300032002 Bacteria 1444
208 Ga0307416_100445891 3300032002 Bacteria 1345
209 Ga0307414_10003578 3300032004 Bacteria 8314
210 Ga0307414_10043727 3300032004 Bacteria 3053
211 Ga0307414_10047942 3300032004 Bacteria 2944
212 Ga0307414_10078056 3300032004 Bacteria 2413
213 Ga0307414_10172738 3300032004 Bacteria 1729
214 Ga0307414_10184552 3300032004 Bacteria 1681
215 Ga0307411_10027312 3300032005 Bacteria 3451
216 Ga0307411_10038347 3300032005 Bacteria 3022
217 Ga0307411_10060084 3300032005 Bacteria 2522
218 Ga0307411_10293917 3300032005 Bacteria 1299
219 Ga0307415_100004280 3300032126 Bacteria 7382
220 Ga0307415_100030686 3300032126 Bacteria 3454
221 Ga0307415_100086163 3300032126 Bacteria 2259
222 Ga0307415_100160542 3300032126 Bacteria 1742
223 Ga0307415_100186865 3300032126 Bacteria 1631
224 Ga0307415_100382567 3300032126 Bacteria 1195
225 Ga0307507_10124676 3300033179 Bacteria 2044
226 Ga0373923_0135679 3300035111 Bacteria 1109
227 Ga0373937_0117139 3300036401 Bacteria 2481
228 Ga0395900_0010104 3300037418 Bacteria 9652
229 Ga0395905_0000128 3300037471 Bacteria 124305
230 Ga0395905_0000199 3300037471 Bacteria 93586
231 Ga0395901_0002350 3300038443 Bacteria 19231
232 Ga0439436_0000003 3300041404 Bacteria 186684
233 Ga0451795_0522187 3300041456 Bacteria 1344
234 Ga0450908_000580 3300042184 Bacteria 7029
235 Ga0466969_0006581 3300044656 Bacteria 6178
236 Ga0466972_0054210 3300044658 Bacteria 1930
237 Ga0466973_0051562 3300044659 Bacteria 3796
238 Ga0466982_0000093 3300044672 Bacteria 21924
239 Ga0466965_0003256 3300044683 Bacteria 7104
240 Ga0466961_0015640 3300044693 Bacteria 4868
241 Ga0466961_0018300 3300044693 Bacteria 4504
242 Ga0466963_0000865 3300044694 Bacteria 15323
243 Ga0466970_0020372 3300044765 Bacteria 3445
244 Ga0466970_0025136 3300044765 Bacteria 3117
245 Ga0466957_0016241 3300044842 Bacteria 4353
246 Ga0466957_0142835 3300044842 Bacteria 1543
247 Ga0466959_0000851 3300045049 Bacteria 18027
248 Ga0495617_000119 3300046452 Bacteria 52294
249 Ga0495617_001040 3300046452 Bacteria 12708
250 Ga0495627_010147 3300046453 Bacteria 3437
251 Ga0495603_0001900 3300046455 Bacteria 12330
252 Ga0495603_0003113 3300046455 Bacteria 9856
253 Ga0495603_0037756 3300046455 Bacteria 2897
254 Ga0495590_0007567 3300046457 Bacteria 4180
255 Ga0495591_018880 3300046458 Bacteria 2326
256 Ga0495629_0000017 3300046459 Bacteria 169512
257 Ga0495629_0000829 3300046459 Bacteria 25070
258 Ga0495629_0004634 3300046459 Bacteria 10294
259 Ga0495629_0082017 3300046459 Bacteria 2250
260 Ga0495638_0000089 3300046460 Bacteria 151067
261 Ga0495641_0103049 3300046461 Bacteria 1273
262 Ga0495641_0114790 3300046461 Bacteria 1201
263 Ga0495651_0085587 3300046462 Bacteria 2374
264 Ga0495651_0187063 3300046462 Bacteria 1460
265 Ga0495653_0004287 3300046463 Bacteria 11551
266 Ga0495653_0005571 3300046463 Bacteria 10268
267 Ga0495653_0005901 3300046463 Bacteria 10024
268 Ga0495653_0018512 3300046463 Bacteria 5653
269 Ga0495653_0046000 3300046463 Bacteria 3380
270 Ga0495650_0001600 3300046471 Bacteria 21185
271 Ga0495650_0029545 3300046471 Bacteria 2497
272 Ga0495580_0000069 3300046472 Bacteria 62719
273 Ga0495580_0000619 3300046472 Bacteria 30059
274 Ga0495580_0011226 3300046472 Bacteria 6930
275 Ga0495580_0022125 3300046472 Bacteria 4683
276 Ga0495580_0063994 3300046472 Bacteria 2578
277 Ga0495580_0064194 3300046472 Bacteria 2574
278 Ga0495582_0010026 3300046473 Bacteria 5215
279 Ga0495582_0012164 3300046473 Bacteria 4740
280 Ga0495605_0006141 3300046474 Bacteria 6927
281 Ga0495605_0012094 3300046474 Bacteria 4796
282 Ga0495605_0071777 3300046474 Bacteria 1634
283 Ga0495662_0064450 3300046476 Bacteria 1771
284 Ga0495664_0000725 3300046477 Bacteria 16818
285 Ga0495664_0011637 3300046477 Bacteria 4965
286 Ga0495664_0079741 3300046477 Bacteria 1962
287 Ga0495584_0009530 3300046491 Bacteria 5000
288 Ga0495585_0001268 3300046492 Bacteria 20229
289 Ga0495585_0025371 3300046492 Bacteria 3396
290 Ga0495596_0059660 3300046500 Bacteria 1487
291 Ga0495607_0000020 3300046501 Bacteria 164851
292 Ga0495607_0000228 3300046501 Bacteria 59878
293 Ga0495607_0022433 3300046501 Bacteria 3964
294 Ga0495607_0028884 3300046501 Bacteria 3416
295 Ga0495583_0018463 3300046506 Bacteria 3670
296 Ga0495606_0001351 3300046507 Bacteria 33295
297 Ga0495606_0002192 3300046507 Bacteria 23418
298 Ga0495606_0010083 3300046507 Bacteria 7890
299 Ga0495606_0032319 3300046507 Bacteria 3627
300 Ga0495606_0057495 3300046507 Bacteria 2504
301 Ga0495606_0088618 3300046507 Bacteria 1907
302 Ga0495606_0095329 3300046507 Bacteria 1822
303 Ga0495610_0079843 3300046512 Bacteria 1505
304 Ga0495616_0000028 3300046513 Bacteria 133873
305 Ga0495616_0004751 3300046513 Bacteria 8512
306 Ga0495620_0000186 3300046515 Bacteria 47973
307 Ga0495620_0010028 3300046515 Bacteria 5010
308 Ga0495620_0039008 3300046515 Bacteria 2103
309 Ga0495628_0040963 3300046516 Bacteria 3698
310 Ga0495628_0126737 3300046516 Bacteria 1955
311 Ga0495628_0155860 3300046516 Bacteria 1737
312 Ga0495628_0186654 3300046516 Bacteria 1566
313 Ga0495628_0207173 3300046516 Bacteria 1476
314 Ga0495630_0004671 3300046517 Bacteria 9611
315 Ga0495631_0000147 3300046518 Bacteria 48184
316 Ga0495631_0000159 3300046518 Bacteria 45657
317 Ga0495632_0000005 3300046519 Bacteria 362872
318 Ga0495632_0012325 3300046519 Bacteria 4935
319 Ga0495648_0000506 3300046524 Bacteria 41982
320 Ga0495648_0006807 3300046524 Bacteria 9235
321 Ga0495648_0008279 3300046524 Bacteria 8201
322 Ga0495648_0011238 3300046524 Bacteria 6759
323 Ga0495648_0019485 3300046524 Bacteria 4769
324 Ga0495666_0031118 3300046526 Bacteria 2615
325 Ga0495666_0066021 3300046526 Bacteria 1725
326 Ga0495652_0098721 3300046529 Bacteria 2373
327 Ga0495652_0119849 3300046529 Bacteria 2100
328 Ga0495654_0071990 3300046530 Bacteria 1637
329 Ga0495665_0007021 3300046531 Bacteria 6078
330 Ga0495665_0103068 3300046531 Bacteria 1497
331 Ga0495640_0046042 3300046533 Bacteria 3025
332 Ga0495586_0013319 3300046535 Bacteria 4360
333 Ga0495586_0022239 3300046535 Bacteria 3383
334 Ga0495587_0003683 3300046536 Bacteria 10195
335 Ga0495587_0017422 3300046536 Bacteria 4463
336 Ga0495609_0047668 3300046538 Bacteria 1917
337 Ga0495597_0014727 3300046542 Bacteria 3720
338 Ga0495645_0000160 3300046543 Bacteria 46637
339 Ga0495645_0004276 3300046543 Bacteria 9755
340 Ga0495645_0017057 3300046543 Bacteria 5199
341 Ga0495622_0098362 3300046557 Bacteria 1342
342 Ga0495633_0000514 3300046558 Bacteria 38936
343 Ga0495667_0013873 3300046559 Bacteria 5441
344 Ga0495634_0035795 3300046642 Bacteria 3397
345 Ga0495611_0000005 3300046648 Bacteria 284271
346 Ga0495611_0000039 3300046648 Bacteria 100068
347 Ga0495611_0008407 3300046648 Bacteria 4371
348 Ga0495611_0025829 3300046648 Bacteria 2561
349 Ga0495625_0000285 3300046660 Bacteria 78065
350 Ga0495625_0043214 3300046660 Bacteria 3269
351 Ga0495625_0051636 3300046660 Bacteria 2947
352 Ga0495625_0111578 3300046660 Bacteria 1869
353 Ga0495635_0015001 3300046663 Bacteria 5419
354 Ga0495635_0080666 3300046663 Bacteria 2227
355 Ga0495635_0151045 3300046663 Bacteria 1581
356 Ga0495661_0001996 3300046665 Bacteria 16099
357 Ga0495661_0009457 3300046665 Bacteria 6689
358 Ga0495661_0034814 3300046665 Bacteria 3166
359 Ga0495661_0143035 3300046665 Bacteria 1299
360 Ga0495599_0035769 3300046678 Bacteria 3117
361 Ga0495599_0050209 3300046678 Bacteria 2613
362 Ga0495646_0033658 3300046680 Bacteria 3186
363 Ga0495646_0104167 3300046680 Bacteria 1622
364 Ga0495646_0112708 3300046680 Bacteria 1547
365 Ga0495613_0008999 3300046689 Bacteria 7410
366 Ga0495613_0188526 3300046689 Bacteria 1458
367 Ga0495624_0002593 3300046690 Bacteria 13645
368 Ga0495624_0051919 3300046690 Bacteria 2592
369 Ga0495624_0098327 3300046690 Bacteria 1802
370 Ga0495624_0106324 3300046690 Bacteria 1726
371 Ga0495624_0156755 3300046690 Bacteria 1391
372 Ga0495670_0003631 3300046691 Bacteria 7581
373 Ga0495670_0004761 3300046691 Bacteria 6666
374 Ga0495670_0012499 3300046691 Bacteria 4177
375 Ga0495670_0017073 3300046691 Bacteria 3569
376 Ga0495671_0000268 3300046692 Bacteria 43919
377 Ga0495649_0000727 3300046694 Bacteria 26775
378 Ga0495649_0007157 3300046694 Bacteria 6852
379 Ga0495649_0016090 3300046694 Bacteria 4245
380 Ga0495589_0000026 3300046794 Bacteria 184723
381 Ga0495589_0046164 3300046794 Bacteria 2163
382 Ga0495589_0112732 3300046794 Bacteria 1312
383 Ga0495600_0155339 3300046809 Bacteria 1480
384 Ga0495660_0001659 3300046810 Bacteria 14916
385 Ga0495660_0027117 3300046810 Bacteria 3241
386 Ga0495581_0019436 3300047315 Bacteria 3942
387 Ga0495581_0120982 3300047315 Bacteria 1523
388 Ga0495604_0006498 3300047317 Bacteria 9266
389 Ga0495604_0031126 3300047317 Bacteria 4234
390 Ga0495604_0091827 3300047317 Bacteria 2250
391 Ga0495636_0011062 3300047318 Bacteria 3570
392 Ga0495674_0001778 3300047319 Bacteria 21250
393 Ga0495674_0007056 3300047319 Bacteria 10746
394 Ga0495674_0012124 3300047319 Bacteria 8124
395 Ga0495674_0060121 3300047319 Bacteria 3316
396 Ga0495674_0094143 3300047319 Bacteria 2555
397 Ga0495674_0285369 3300047319 Bacteria 1351
398 Ga0495672_0002227 3300047320 Bacteria 18032
399 Ga0495676_0012089 3300047321 Bacteria 7786
400 Ga0495680_0023398 3300047322 Bacteria 5137
401 Ga0495680_0070642 3300047322 Bacteria 2661
402 Ga0495683_0002081 3300047323 Bacteria 12400
403 Ga0495683_0002238 3300047323 Bacteria 11832
404 Ga0495683_0016566 3300047323 Bacteria 3827
405 Ga0495683_0026319 3300047323 Bacteria 2977
406 Ga0495683_0039025 3300047323 Bacteria 2401
407 Ga0495687_000011 3300047443 Bacteria 397225
408 Ga0495675_0037801 3300047444 Bacteria 3074
409 Ga0495675_0147945 3300047444 Bacteria 1452
410 Ga0495679_000010 3300047446 Bacteria 337760
411 Ga0495679_000057 3300047446 Bacteria 110720
412 Ga0495679_000573 3300047446 Bacteria 25546
413 Ga0495679_003704 3300047446 Bacteria 7274
414 Ga0495673_0000038 3300047469 Bacteria 303785
415 Ga0495673_0000045 3300047469 Bacteria 280765
416 Ga0495673_0000780 3300047469 Bacteria 30070
417 Ga0495673_0010761 3300047469 Bacteria 4956
418 Ga0495684_0020504 3300047471 Bacteria 5095
419 Ga0495684_0025261 3300047471 Bacteria 4567
420 Ga0495686_0000014 3300047472 Bacteria 474014
421 Ga0495686_0000050 3300047472 Bacteria 269010
422 Ga0495686_0000297 3300047472 Bacteria 85762
423 Ga0495686_0010602 3300047472 Bacteria 6545
424 Ga0495686_0052802 3300047472 Bacteria 2547
425 Ga0495593_0010789 3300047673 Bacteria 5266
426 Ga0495593_0013823 3300047673 Bacteria 4598
427 Ga0495593_0051017 3300047673 Bacteria 2190
428 Ga0495593_0069735 3300047673 Bacteria 1827
429 Ga0495593_0074340 3300047673 Bacteria 1762
430 Ga0495593_0090004 3300047673 Bacteria 1581
431 Ga0495602_0003647 3300048088 Bacteria 15951
432 Ga0495602_0164333 3300048088 Bacteria 1729
433 Ga0495602_0263103 3300048088 Bacteria 1278
434 Ga0495602_0310654 3300048088 Bacteria 1150
435 Ga0495614_0010634 3300048089 Bacteria 4055
436 Ga0495615_0014194 3300048090 Bacteria 1679
437 Ga0496100_0034361 3300048903 Bacteria 3181
438 Ga0496101_0008300 3300048904 Bacteria 6785
439 Ga0496101_0010371 3300048904 Bacteria 6153
440 Ga0496101_0047668 3300048904 Bacteria 3077
441 Ga0496102_0000530 3300048905 Bacteria 41349
442 Ga0496102_0003631 3300048905 Bacteria 13052
443 Ga0496102_0013465 3300048905 Bacteria 7085
444 Ga0496102_0201148 3300048905 Bacteria 1878
445 Ga0496103_0002884 3300048906 Bacteria 10672
446 Ga0496103_0009339 3300048906 Bacteria 5810
447 Ga0496103_0013954 3300048906 Bacteria 4769
448 Ga0496104_0022202 3300048907 Bacteria 5829
449 Ga0496105_0071308 3300048908 Bacteria 2871
450 Ga0496106_0000677 3300048909 Bacteria 24417
451 Ga0496106_0034490 3300048909 Bacteria 3780
452 Ga0496106_0041324 3300048909 Bacteria 3455
453 Ga0496112_0033740 3300048915 Bacteria 4976
454 Ga0496113_0002929 3300048916 Bacteria 10075
455 Ga0496113_0032876 3300048916 Bacteria 3772
456 Ga0496115_0190344 3300048918 Bacteria 1695
457 Ga0496116_0040222 3300048919 Bacteria 3222
458 Ga0496117_0007144 3300048920 Bacteria 11032
459 Ga0496117_0015703 3300048920 Bacteria 6431
460 Ga0496117_0023403 3300048920 Bacteria 4925
461 Ga0496117_0031422 3300048920 Bacteria 4053
462 Ga0496117_0048905 3300048920 Bacteria 3014
463 Ga0496117_0072470 3300048920 Bacteria 2302
464 Ga0496118_0001887 3300048921 Bacteria 29908
465 Ga0496118_0002065 3300048921 Bacteria 28282
466 Ga0496118_0002185 3300048921 Bacteria 27211
467 Ga0496118_0002193 3300048921 Bacteria 27137
468 Ga0496118_0024729 3300048921 Bacteria 5173
469 Ga0496118_0025141 3300048921 Bacteria 5116
470 Ga0496118_0034037 3300048921 Bacteria 4167
471 Ga0496118_0055500 3300048921 Bacteria 2989
472 Ga0496118_0107098 3300048921 Bacteria 1867
473 Ga0496118_0114414 3300048921 Bacteria 1779
474 Ga0496119_0014380 3300048922 Bacteria 6201
475 Ga0496121_0000464 3300048924 Bacteria 79337
476 Ga0496121_0001268 3300048924 Bacteria 43515
477 Ga0496121_0004779 3300048924 Bacteria 17867
478 Ga0496121_0057460 3300048924 Bacteria 3225
479 Ga0496121_0067112 3300048924 Bacteria 2908
480 Ga0496121_0070684 3300048924 Bacteria 2810
481 Ga0496121_0305646 3300048924 Bacteria 1077
482 Ga0496122_0000136 3300048925 Bacteria 170671
483 Ga0496122_0044797 3300048925 Bacteria 3448
484 Ga0496122_0064052 3300048925 Bacteria 2677
485 Ga0496122_0069898 3300048925 Bacteria 2512
486 Ga0496123_0001133 3300048926 Bacteria 39810
487 Ga0496123_0019462 3300048926 Bacteria 5350
488 Ga0496123_0026150 3300048926 Bacteria 4381
489 Ga0496123_0040545 3300048926 Bacteria 3241
490 Ga0496123_0059521 3300048926 Bacteria 2468
491 Ga0496124_0001041 3300048927 Bacteria 43798
492 Ga0496124_0001123 3300048927 Bacteria 42076
493 Ga0496124_0043631 3300048927 Bacteria 3854
494 Ga0496124_0084175 3300048927 Bacteria 2609
495 Ga0496125_0014986 3300048928 Bacteria 7527
496 Ga0496125_0051021 3300048928 Bacteria 3417
497 Ga0496125_0108090 3300048928 Bacteria 2024
498 Ga0496126_0000038 3300048929 Bacteria 347738
499 Ga0496126_0094882 3300048929 Bacteria 2617
500 Ga0496126_0195963 3300048929 Bacteria 1708
501 Ga0495678_000253 3300049459 Bacteria 60057
502 Ga0495682_0002711 3300049460 Bacteria 8213
503 Ga0501032_0015520 3300049569 Bacteria 5371
504 Ga0501033_0000650 3300049570 Bacteria 32204
505 Ga0501033_0125209 3300049570 Bacteria 1863
506 Ga0501034_0062331 3300049571 Bacteria 3744
507 Ga0501034_0063352 3300049571 Bacteria 3711
508 Ga0501036_0002697 3300049572 Bacteria 14012
509 Ga0501036_0466173 3300049572 Bacteria 1052
510 Ga0501037_0128301 3300049573 Bacteria 1819
511 Ga0501037_0155418 3300049573 Bacteria 1633
512 Ga0501038_0007073 3300049574 Bacteria 10363
513 Ga0501039_0045789 3300049575 Bacteria 3379
514 Ga0501042_0093807 3300049578 Bacteria 2156
515 Ga0501042_0182039 3300049578 Bacteria 1516
516 Ga0501043_0055315 3300049579 Bacteria 3117
517 Ga0501046_0030779 3300049580 Bacteria 4354
518 Ga0501047_0072399 3300049581 Bacteria 3317
519 Ga0501048_0015305 3300049582 Bacteria 5664
520 Ga0501067_0005340 3300049583 Bacteria 7137
521 Ga0501068_0022441 3300049584 Bacteria 3691
522 Ga0501069_0017439 3300049585 Bacteria 3863
523 Ga0501070_0417056 3300049586 Bacteria 1084
524 Ga0501072_0011187 3300049588 Bacteria 6849
525 Ga0501073_0015333 3300049589 Bacteria 5557
526 Ga0501073_0023928 3300049589 Bacteria 4386
527 Ga0501073_0045672 3300049589 Bacteria 3084
528 Ga0501074_0017443 3300049590 Bacteria 5209
529 Ga0501074_0051355 3300049590 Bacteria 2975
530 Ga0501074_0161324 3300049590 Bacteria 1601
531 Ga0501075_0267176 3300049591 Bacteria 1304
532 Ga0501076_0050394 3300049592 Bacteria 3294
533 Ga0501076_0061743 3300049592 Bacteria 2983
534 Ga0501079_0179112 3300049741 Bacteria 1654
535 Ga0501080_0011527 3300049742 Bacteria 8095
536 Ga0501080_0014299 3300049742 Bacteria 7308
537 Ga0501080_0023134 3300049742 Bacteria 5762
538 Ga0501080_0350746 3300049742 Bacteria 1332
539 Ga0501081_0022679 3300049743 Bacteria 4202
540 Ga0501083_0045054 3300049744 Bacteria 2984
541 Ga0501035_0080678 3300049822 Bacteria 2872
542 Ga0501044_0091803 3300049823 Bacteria 3063
543 Ga0501044_0223997 3300049823 Bacteria 1830
544 nmdc:mga0yw44_21680_c1 3300050492 Bacteria 3589
545 nmdc:mga0sz30_29409_c1 3300050516 Bacteria 2265
546 Ga0500643_000074 3300053087 Bacteria 111502
547 Ga0500643_009114 3300053087 Bacteria 3821
548 Ga0500651_0034245 3300053093 Bacteria 3202
549 Ga0500555_000400 3300053103 Bacteria 18093
550 Ga0500597_000274 3300053120 Bacteria 10380
551 Ga0500618_005895 3300053125 Bacteria 3665
552 Ga0500559_0082830 3300053136 Bacteria 1460
553 Ga0500604_0002396 3300053151 Bacteria 5119
554 Ga0500620_004917 3300053155 Bacteria 3039
555 Ga0500634_0000009 3300053161 Bacteria 144333
556 Ga0500645_006171 3300053730 Bacteria 4306
557 Ga0501084_0281555 3300054114 Bacteria 1404
558 Ga0466962_0011017 3300061719 Bacteria 4352
559 2510252758 2510065045 Bacteria 7761063
560 2501078400 2501025502 Bacteria 9641094
561 2501410165 2501025504 Bacteria 8008976
562 2511090101 2510917013 Bacteria 9951648
563 2512347002 2512047030 Bacteria 9031815
564 2513554543 2513237082 Bacteria 8640282
565 2513563491 2513237083 Bacteria 8410967
566 2514046936 2513237166 Bacteria 10373764
567 2515683364 2515154122 Bacteria 8609520
568 2515690851 2515154123 Bacteria 6387382
569 2516018522 2515154189 Bacteria 9629850
570 2519460702 2519103095 Bacteria 6629912
571 2527078539 2526164713 Bacteria 6780608
572 2563055547 2562617112 Bacteria 10918404
573 2585293155 2582581311 Bacteria 6763856
574 2595449212 2593339238 Bacteria 4182970
575 2595450496 2593339239 Bacteria 4124669
576 2600813236 2600255067 Bacteria 6795583
577 2713478805 2711768613 Bacteria 11048459
578 2719641861 2718217991 Bacteria 7829542
579 2721029225 2718218334 Bacteria 4765486
580 2723878365 2721755763 Bacteria 4464185
581 2735835191 2734482264 Unclassified 5014763
582 2738823122 2738541296 Bacteria 7285013
583 2738835329 2738541298 Bacteria 7286732
584 2738876808 2738541306 Bacteria 7284992
585 2739188729 2738543002 Bacteria 7284546
586 2739223381 2738543008 Bacteria 7282815
587 2739229038 2738543009 Bacteria 4944499
588 2746086809 2744054900 Bacteria 8399525
589 2746094208 2744054901 Bacteria 8397047
590 2753568696 2751185846 Bacteria 7242164
591 2808967570 2808606384 Bacteria 8474373
592 2809002401 2808606390 Bacteria 8476311
593 2809009679 2808606391 Bacteria 8308166
594 2817257545 2816332253 Bacteria 6764532
595 2817282051 2816332256 Bacteria 6891714
596 2817451488 2816332286 Bacteria 6853759
597 2819622657 2818991450 Bacteria 6962147
598 2842329263 2842324504 Bacteria 9364110
599 2842353318 2842348783 Bacteria 9002918
600 2842458948 2842454564 Bacteria 8730687
601 2842916849 2842914999 Bacteria 4419378
602 2842922321 2842918807 Bacteria 4289178
603 2856291371 2856287931 Bacteria 7223934
604 2857360003 2857357740 Bacteria 9937880
605 2883096150 2883087390 Bacteria 9532701
606 2884342429 2884338543 Bacteria 4610696
607 2885273756 2885270888 Bacteria 9831543
608 2900636874 2900634093 Bacteria 10263517
609 2902691565 2902682994 Bacteria 8951596
610 2904488085 2904483920 Bacteria 7545285
611 2919088098 2919085039 Bacteria 4532964
612 2919407570 2919404418 Bacteria 4232372
613 2919453104 2919450847 Bacteria 5631160
614 2919531155 2919527303 Bacteria 7718827
615 2921652393 2921643360 Bacteria 11448031
616 2928112619 2928108538 Bacteria 7360024
617 2928139592 2928135762 Bacteria 7259641
618 2928509258 2928503688 Bacteria 7268108
619 2941475257 2941471342 Bacteria 5018624
620 2945934787 2945934425 Bacteria 7444609
621 2953996781 2953994433 Bacteria 4303959
622 2990704694 2990703756 Bacteria 7715990
623 642425193 641736151 Bacteria 7477263
624 642594791 642555112 Bacteria 8676562
625 642623418 642555113 Bacteria 8214658
626 8001850522 8001845381 Bacteria 5804942
627 8003960237 8003955200 Bacteria 8601927
628 8020811153 8020807995 Bacteria 6801506
629 8040175954 8040173305 Bacteria 6827067
630 8055307708 8055301274 Bacteria 8587385
631 JGI24739J22299_10000545
632 JGI24737J22298_10050678
633 JGI24735J21928_10000277
634 JGI24735J21928_10000913
635 JGI24735J21928_10032201
636 JGI24738J21930_10000750
637 JGI25156J39149_1001344
638 JGI25162J39368_1006470
639 JGI25152J39213_1015717
640 JGI25165J46597_1000902
641 rootH2_10014801
642 rootH2_10155113
643 rootH2_10215603
644 JGI25160J50197_1000016
645 Ga0055533_1000119
646 Ga0055533_1000650
647 Ga0055532_1000043
648 Ga0055527_1000026
649 Ga0055535_1000032
650 Ga0055542_1000049
651 Ga0055529_1000059
652 Ga0065165_1000199
653 Ga0065165_1001610
654 Ga0065715_10215092
655 Ga0070658_10313454
656 Ga0070676_10008118
657 Ga0068869_100045473
658 Ga0070666_10017159
659 Ga0070682_100002464
660 Ga0070660_100024553
661 Ga0070689_100202429
662 Ga0070661_100049795
663 Ga0070668_100282298
664 Ga0070659_100216489
665 Ga0070667_100000304
666 Ga0070667_100024369
667 Ga0070667_100036738
668 Ga0070667_100049368
669 Ga0070711_100017641
670 Ga0070705_100033003
671 Ga0070663_100003314
672 Ga0070663_100052883
673 Ga0070663_100302848
674 Ga0070662_100298094
675 Ga0070681_10406578
676 Ga0070706_100014238
677 Ga0068853_100002470
678 Ga0068853_100002777
679 Ga0068853_100015728
680 Ga0068853_100166630
681 Ga0070693_100006346
682 Ga0070665_100000069
683 Ga0070665_100047042
684 Ga0070665_100078323
685 Ga0068855_100087772
686 Ga0068857_100201227
687 Ga0068856_100311432
688 Ga0068864_100108578
689 Ga0068870_10122638
690 Ga0068858_100133908
691 Ga0068862_100190553
692 Ga0081540_1002296
693 Ga0070717_10008732
694 Ga0075365_10017453
695 Ga0068871_100037000
696 Ga0105251_10000147
697 Ga0105251_10006630
698 Ga0105251_10026809
699 Ga0105251_10078351
700 Ga0105244_10080251
701 Ga0105240_10201214
702 Ga0105241_10169093
703 Ga0105248_10000133
704 Ga0105248_10049422
705 Ga0105248_10177520
706 Ga0105237_10003036
707 Ga0105237_10102036
708 Ga0105238_10271415
709 Ga0105238_10434812
710 Ga0105249_10000687
711 Ga0105239_10017336
712 Ga0105239_10060807
713 Ga0105239_10116847
714 Ga0157370_10000224
715 Ga0157369_10017355
716 Ga0157369_10024246
717 Ga0157374_10188214
718 Ga0163162_10007584
719 Ga0157372_10202178
720 Ga0182008_10070254
721 Ga0182008_10125906
722 Ga0182008_10125908
723 Ga0182006_1000058
724 Ga0182006_1000098
725 Ga0182007_10000232
726 Ga0182007_10018668
727 Ga0182005_1000015
728 Ga0182005_1001383
729 Ga0182005_1004888
730 Ga0182005_1008438
731 Ga0183361_10001
732 Ga0163161_10000883
733 Ga0209674_100017
734 Ga0209674_100121
735 Ga0209674_100689
736 Ga0209672_100001
737 Ga0209147_100022
738 Ga0207427_100861
739 Ga0209437_101355
740 Ga0209258_100033
741 Ga0209148_1000046
742 Ga0209148_1003015
743 Ga0209759_1000071
744 Ga0209759_1000118
745 Ga0209759_1000162
746 Ga0209129_1000356
747 Ga0209233_1000050
748 Ga0209455_1000038
749 Ga0209564_1004774
750 Ga0209256_1007368
751 Ga0207426_1000007
752 Ga0209257_1025798
753 Ga0207713_1000064
754 Ga0207688_10052367
755 Ga0207647_10000005
756 Ga0207647_10000806
757 Ga0207647_10088756
758 Ga0207647_10096137
759 Ga0207705_10106564
760 Ga0207705_10175894
761 Ga0207684_10012632
762 Ga0207695_10271046
763 Ga0207671_10002990
764 Ga0207671_10125641
765 Ga0207663_10152306
766 Ga0207657_10068050
767 Ga0207649_10144685
768 Ga0207649_10180054
769 Ga0207694_10212820
770 Ga0207694_10236134
771 Ga0207650_10033804
772 Ga0207644_10043554
773 Ga0207711_10009537
774 Ga0207711_10045319
775 Ga0207711_10178002
776 Ga0207689_10096149
777 Ga0207667_10374804
778 Ga0207712_10000230
779 Ga0207668_10290393
780 Ga0207640_10344093
781 Ga0207658_10000104
782 Ga0207703_10235479
783 Ga0207639_10001288
784 Ga0207639_10005836
785 Ga0207639_10165527
786 Ga0207678_10010389
787 Ga0207678_10023311
788 Ga0207678_10031576
789 Ga0207678_10220509
790 Ga0207678_10446998
791 Ga0207702_10345234
792 Ga0207641_10122894
793 Ga0207674_10212729
794 Ga0207675_100049514
795 Ga0207683_10397906
796 Ga0207698_10208519
797 Ga0268266_10000001
798 Ga0268266_10087940
799 Ga0268265_10086989
800 Ga0268264_10066923
801 Ga0265332_10089759
802 Ga0265316_10126055
803 Ga0307408_100001982
804 Ga0307408_100011562
805 Ga0307408_100024768
806 Ga0307408_100044108
807 Ga0307405_10006524
808 Ga0307405_10046370
809 Ga0307405_10185647
810 Ga0307413_10012167
811 Ga0307413_10034011
812 Ga0307413_10053950
813 Ga0307413_10124877
814 Ga0307413_10149677
815 Ga0307410_10053057
816 Ga0307410_10185292
817 Ga0307410_10273984
818 Ga0307410_10419508
819 Ga0307406_10307579
820 Ga0307407_10013285
821 Ga0307407_10026718
822 Ga0307407_10176050
823 Ga0307412_10000011
824 Ga0307412_10000221
825 Ga0307412_10015225
826 Ga0307412_10043437
827 Ga0307412_10060270
828 Ga0307412_10466257
829 Ga0307409_100033967
830 Ga0307409_100157869
831 Ga0307409_100174269
832 Ga0307409_100226566
833 Ga0307409_100310946
834 Ga0307409_100321396
835 Ga0307416_100058502
836 Ga0307416_100352842
837 Ga0307416_100378983
838 Ga0307416_100445891
839 Ga0307414_10003578
840 Ga0307414_10043727
841 Ga0307414_10047942
842 Ga0307414_10078056
843 Ga0307414_10172738
844 Ga0307414_10184552
845 Ga0307411_10027312
846 Ga0307411_10038347
847 Ga0307411_10060084
848 Ga0307411_10293917
849 Ga0307415_100004280
850 Ga0307415_100030686
851 Ga0307415_100086163
852 Ga0307415_100160542
853 Ga0307415_100186865
854 Ga0307415_100382567
855 Ga0307507_10124676
856 Ga0373923_0135679
857 Ga0373937_0117139
858 Ga0395900_0010104
859 Ga0395905_0000128
860 Ga0395905_0000199
861 Ga0395901_0002350
862 Ga0439436_0000003
863 Ga0451795_0522187
864 Ga0450908_000580
865 Ga0466969_0006581
866 Ga0466972_0054210
867 Ga0466973_0051562
868 Ga0466982_0000093
869 Ga0466965_0003256
870 Ga0466961_0015640
871 Ga0466961_0018300
872 Ga0466963_0000865
873 Ga0466970_0020372
874 Ga0466970_0025136
875 Ga0466957_0016241
876 Ga0466957_0142835
877 Ga0466959_0000851
878 Ga0495617_000119
879 Ga0495617_001040
880 Ga0495627_010147
881 Ga0495603_0001900
882 Ga0495603_0003113
883 Ga0495603_0037756
884 Ga0495590_0007567
885 Ga0495591_018880
886 Ga0495629_0000017
887 Ga0495629_0000829
888 Ga0495629_0004634
889 Ga0495629_0082017
890 Ga0495638_0000089
891 Ga0495641_0103049
892 Ga0495641_0114790
893 Ga0495651_0085587
894 Ga0495651_0187063
895 Ga0495653_0004287
896 Ga0495653_0005571
897 Ga0495653_0005901
898 Ga0495653_0018512
899 Ga0495653_0046000
900 Ga0495650_0001600
901 Ga0495650_0029545
902 Ga0495580_0000069
903 Ga0495580_0000619
904 Ga0495580_0011226
905 Ga0495580_0022125
906 Ga0495580_0063994
907 Ga0495580_0064194
908 Ga0495582_0010026
909 Ga0495582_0012164
910 Ga0495605_0006141
911 Ga0495605_0012094
912 Ga0495605_0071777
913 Ga0495662_0064450
914 Ga0495664_0000725
915 Ga0495664_0011637
916 Ga0495664_0079741
917 Ga0495584_0009530
918 Ga0495585_0001268
919 Ga0495585_0025371
920 Ga0495596_0059660
921 Ga0495607_0000020
922 Ga0495607_0000228
923 Ga0495607_0022433
924 Ga0495607_0028884
925 Ga0495583_0018463
926 Ga0495606_0001351
927 Ga0495606_0002192
928 Ga0495606_0010083
929 Ga0495606_0032319
930 Ga0495606_0057495
931 Ga0495606_0088618
932 Ga0495606_0095329
933 Ga0495610_0079843
934 Ga0495616_0000028
935 Ga0495616_0004751
936 Ga0495620_0000186
937 Ga0495620_0010028
938 Ga0495620_0039008
939 Ga0495628_0040963
940 Ga0495628_0126737
941 Ga0495628_0155860
942 Ga0495628_0186654
943 Ga0495628_0207173
944 Ga0495630_0004671
945 Ga0495631_0000147
946 Ga0495631_0000159
947 Ga0495632_0000005
948 Ga0495632_0012325
949 Ga0495648_0000506
950 Ga0495648_0006807
951 Ga0495648_0008279
952 Ga0495648_0011238
953 Ga0495648_0019485
954 Ga0495666_0031118
955 Ga0495666_0066021
956 Ga0495652_0098721
957 Ga0495652_0119849
958 Ga0495654_0071990
959 Ga0495665_0007021
960 Ga0495665_0103068
961 Ga0495640_0046042
962 Ga0495586_0013319
963 Ga0495586_0022239
964 Ga0495587_0003683
965 Ga0495587_0017422
966 Ga0495609_0047668
967 Ga0495597_0014727
968 Ga0495645_0000160
969 Ga0495645_0004276
970 Ga0495645_0017057
971 Ga0495622_0098362
972 Ga0495633_0000514
973 Ga0495667_0013873
974 Ga0495634_0035795
975 Ga0495611_0000005
976 Ga0495611_0000039
977 Ga0495611_0008407
978 Ga0495611_0025829
979 Ga0495625_0000285
980 Ga0495625_0043214
981 Ga0495625_0051636
982 Ga0495625_0111578
983 Ga0495635_0015001
984 Ga0495635_0080666
985 Ga0495635_0151045
986 Ga0495661_0001996
987 Ga0495661_0009457
988 Ga0495661_0034814
989 Ga0495661_0143035
990 Ga0495599_0035769
991 Ga0495599_0050209
992 Ga0495646_0033658
993 Ga0495646_0104167
994 Ga0495646_0112708
995 Ga0495613_0008999
996 Ga0495613_0188526
997 Ga0495624_0002593
998 Ga0495624_0051919
999 Ga0495624_0098327
1000 Ga0495624_0106324
1001 Ga0495624_0156755
1002 Ga0495670_0003631
1003 Ga0495670_0004761
1004 Ga0495670_0012499
1005 Ga0495670_0017073
1006 Ga0495671_0000268
1007 Ga0495649_0000727
1008 Ga0495649_0007157
1009 Ga0495649_0016090
1010 Ga0495589_0000026
1011 Ga0495589_0046164
1012 Ga0495589_0112732
1013 Ga0495600_0155339
1014 Ga0495660_0001659
1015 Ga0495660_0027117
1016 Ga0495581_0019436
1017 Ga0495581_0120982
1018 Ga0495604_0006498
1019 Ga0495604_0031126
1020 Ga0495604_0091827
1021 Ga0495636_0011062
1022 Ga0495674_0001778
1023 Ga0495674_0007056
1024 Ga0495674_0012124
1025 Ga0495674_0060121
1026 Ga0495674_0094143
1027 Ga0495674_0285369
1028 Ga0495672_0002227
1029 Ga0495676_0012089
1030 Ga0495680_0023398
1031 Ga0495680_0070642
1032 Ga0495683_0002081
1033 Ga0495683_0002238
1034 Ga0495683_0016566
1035 Ga0495683_0026319
1036 Ga0495683_0039025
1037 Ga0495687_000011
1038 Ga0495675_0037801
1039 Ga0495675_0147945
1040 Ga0495679_000010
1041 Ga0495679_000057
1042 Ga0495679_000573
1043 Ga0495679_003704
1044 Ga0495673_0000038
1045 Ga0495673_0000045
1046 Ga0495673_0000780
1047 Ga0495673_0010761
1048 Ga0495684_0020504
1049 Ga0495684_0025261
1050 Ga0495686_0000014
1051 Ga0495686_0000050
1052 Ga0495686_0000297
1053 Ga0495686_0010602
1054 Ga0495686_0052802
1055 Ga0495593_0010789
1056 Ga0495593_0013823
1057 Ga0495593_0051017
1058 Ga0495593_0069735
1059 Ga0495593_0074340
1060 Ga0495593_0090004
1061 Ga0495602_0003647
1062 Ga0495602_0164333
1063 Ga0495602_0263103
1064 Ga0495602_0310654
1065 Ga0495614_0010634
1066 Ga0495615_0014194
1067 Ga0496100_0034361
1068 Ga0496101_0008300
1069 Ga0496101_0010371
1070 Ga0496101_0047668
1071 Ga0496102_0000530
1072 Ga0496102_0003631
1073 Ga0496102_0013465
1074 Ga0496102_0201148
1075 Ga0496103_0002884
1076 Ga0496103_0009339
1077 Ga0496103_0013954
1078 Ga0496104_0022202
1079 Ga0496105_0071308
1080 Ga0496106_0000677
1081 Ga0496106_0034490
1082 Ga0496106_0041324
1083 Ga0496112_0033740
1084 Ga0496113_0002929
1085 Ga0496113_0032876
1086 Ga0496115_0190344
1087 Ga0496116_0040222
1088 Ga0496117_0007144
1089 Ga0496117_0015703
1090 Ga0496117_0023403
1091 Ga0496117_0031422
1092 Ga0496117_0048905
1093 Ga0496117_0072470
1094 Ga0496118_0001887
1095 Ga0496118_0002065
1096 Ga0496118_0002185
1097 Ga0496118_0002193
1098 Ga0496118_0024729
1099 Ga0496118_0025141
1100 Ga0496118_0034037
1101 Ga0496118_0055500
1102 Ga0496118_0107098
1103 Ga0496118_0114414
1104 Ga0496119_0014380
1105 Ga0496121_0000464
1106 Ga0496121_0001268
1107 Ga0496121_0004779
1108 Ga0496121_0057460
1109 Ga0496121_0067112
1110 Ga0496121_0070684
1111 Ga0496121_0305646
1112 Ga0496122_0000136
1113 Ga0496122_0044797
1114 Ga0496122_0064052
1115 Ga0496122_0069898
1116 Ga0496123_0001133
1117 Ga0496123_0019462
1118 Ga0496123_0026150
1119 Ga0496123_0040545
1120 Ga0496123_0059521
1121 Ga0496124_0001041
1122 Ga0496124_0001123
1123 Ga0496124_0043631
1124 Ga0496124_0084175
1125 Ga0496125_0014986
1126 Ga0496125_0051021
1127 Ga0496125_0108090
1128 Ga0496126_0000038
1129 Ga0496126_0094882
1130 Ga0496126_0195963
1131 Ga0495678_000253
1132 Ga0495682_0002711
1133 Ga0501032_0015520
1134 Ga0501033_0000650
1135 Ga0501033_0125209
1136 Ga0501034_0062331
1137 Ga0501034_0063352
1138 Ga0501036_0002697
1139 Ga0501036_0466173
1140 Ga0501037_0128301
1141 Ga0501037_0155418
1142 Ga0501038_0007073
1143 Ga0501039_0045789
1144 Ga0501042_0093807
1145 Ga0501042_0182039
1146 Ga0501043_0055315
1147 Ga0501046_0030779
1148 Ga0501047_0072399
1149 Ga0501048_0015305
1150 Ga0501067_0005340
1151 Ga0501068_0022441
1152 Ga0501069_0017439
1153 Ga0501070_0417056
1154 Ga0501072_0011187
1155 Ga0501073_0015333
1156 Ga0501073_0023928
1157 Ga0501073_0045672
1158 Ga0501074_0017443
1159 Ga0501074_0051355
1160 Ga0501074_0161324
1161 Ga0501075_0267176
1162 Ga0501076_0050394
1163 Ga0501076_0061743
1164 Ga0501079_0179112
1165 Ga0501080_0011527
1166 Ga0501080_0014299
1167 Ga0501080_0023134
1168 Ga0501080_0350746
1169 Ga0501081_0022679
1170 Ga0501083_0045054
1171 Ga0501035_0080678
1172 Ga0501044_0091803
1173 Ga0501044_0223997
1174 nmdc:mga0yw44_21680_c1
1175 nmdc:mga0sz30_29409_c1
1176 Ga0500643_000074
1177 Ga0500643_009114
1178 Ga0500651_0034245
1179 Ga0500555_000400
1180 Ga0500597_000274
1181 Ga0500618_005895
1182 Ga0500559_0082830
1183 Ga0500604_0002396
1184 Ga0500620_004917
1185 Ga0500634_0000009
1186 Ga0500645_006171
1187 Ga0501084_0281555
1188 Ga0466962_0011017
1189 2510252758
1190 2501078400
1191 2501410165
1192 2511090101
1193 2512347002
1194 2513554543
1195 2513563491
1196 2514046936
1197 2515683364
1198 2515690851
1199 2516018522
1200 2519460702
1201 2527078539
1202 2563055547
1203 2585293155
1204 2595449212
1205 2595450496
1206 2600813236
1207 2713478805
1208 2719641861
1209 2721029225
1210 2723878365
1211 2735835191
1212 2738823122
1213 2738835329
1214 2738876808
1215 2739188729
1216 2739223381
1217 2739229038
1218 2746086809
1219 2746094208
1220 2753568696
1221 2808967570
1222 2809002401
1223 2809009679
1224 2817257545
1225 2817282051
1226 2817451488
1227 2819622657
1228 2842329263
1229 2842353318
1230 2842458948
1231 2842916849
1232 2842922321
1233 2856291371
1234 2857360003
1235 2883096150
1236 2884342429
1237 2885273756
1238 2900636874
1239 2902691565
1240 2904488085
1241 2919088098
1242 2919407570
1243 2919453104
1244 2919531155
1245 2921652393
1246 2928112619
1247 2928139592
1248 2928509258
1249 2941475257
1250 2945934787
1251 2953996781
1252 2990704694
1253 642425193
1254 642594791
1255 642623418
1256 8001850522
1257 8003960237
1258 8020811153
1259 8040175954
1260 8055307708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

78

376

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9483 1 313
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9466 1 313
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9418 1 313
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9386 1 313
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9286 1 313
ID Description Score Start End Superfamily
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9192 1 312 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9175 1 313 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9163 1 311 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9136 1 312 3.20.20.100
3up8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9126 15 310 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A354YH22-F1-model_v4 Alcohol dehydrogenase 0.997 2 148 GO:0005829
AF-A0A0E1VUQ4-F1-model_v4 Oxidoreductase 0.9955 1 313 GO:0005829
GO:0016491
AF-B9B0Z6-F1-model_v4 deleted 0.9954 1 313
AF-A0A1G3FR90-F1-model_v4 Alcohol dehydrogenase 0.9954 1 210 GO:0005829
GO:0016491
AF-A0A499VCQ7-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9945 1 155 GO:0005829
GO:0016491

Map