F470817

General Info

Members Datasets Scaffolds Average Seq Length
630 312 630 242

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10082640|Ga0105245_100826403
Length 277
Sequence MVREGTEAMKWCRVEAPDGASYAELDGEHVELLDAAPFADCRRTGRRYRLDEMKLLPPVIPANFYAAGLNFGSHVEWAKQYHGMTHLKIPDQADIGYRSPSALIGSGADIVVPLDSSGPVEYEGELVAIIGRRAKYLAENDALECVAGYTLGNDLSERAWQKSDRTLWRAKNCDTFKPMGPVVVSGIDPMAQTIGVRINGKTVSEYSTSAMLFSVAHWVSRISRYTTLYPGDVLWLGCDGVTIPALQPGDLVEVVNDAIGVLANRVVRETEQREQLE

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
308 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 3.33
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10384339 3300005289 Bacteria 762
2 Ga0065712_10077951 3300005290 Bacteria 3421
3 Ga0065707_10087312 3300005295 Bacteria 5069
4 Ga0065707_10227721 3300005295 Bacteria 1200
5 Ga0070676_10046768 3300005328 Bacteria 2525
6 Ga0070676_10050513 3300005328 Unclassified 2438
7 Ga0070676_10382023 3300005328 Bacteria 975
8 Ga0070683_100001483 3300005329 Bacteria 18089
9 Ga0070683_100492067 3300005329 Unclassified 1171
10 Ga0070690_100002963 3300005330 Bacteria 9182
11 Ga0070690_100359312 3300005330 Unclassified 1059
12 Ga0070670_100039308 3300005331 Bacteria 4068
13 Ga0070670_100053843 3300005331 Bacteria 3455
14 Ga0070670_100223753 3300005331 Bacteria 1637
15 Ga0070670_100241606 3300005331 Bacteria 1572
16 Ga0068869_100000766 3300005334 Bacteria 18276
17 Ga0068869_100009133 3300005334 Bacteria 6424
18 Ga0070666_10244038 3300005335 Bacteria 1270
19 Ga0070680_100000089 3300005336 Bacteria 51222
20 Ga0070680_100201961 3300005336 Bacteria 1677
21 Ga0070680_100252193 3300005336 Bacteria 1492
22 Ga0070682_100007516 3300005337 Bacteria 6143
23 Ga0068868_100003541 3300005338 Bacteria 10883
24 Ga0068868_100013652 3300005338 Bacteria 5965
25 Ga0068868_100020533 3300005338 Bacteria 4966
26 Ga0070689_100010938 3300005340 Bacteria 6485
27 Ga0070689_100064273 3300005340 Bacteria 2856
28 Ga0070689_100065686 3300005340 Bacteria 2826
29 Ga0070689_100078877 3300005340 Bacteria 2582
30 Ga0070691_10009666 3300005341 Bacteria 4401
31 Ga0070687_100002470 3300005343 Bacteria 6949
32 Ga0070661_100008287 3300005344 Bacteria 7176
33 Ga0070692_10017000 3300005345 Bacteria 3470
34 Ga0070692_10111567 3300005345 Bacteria 1513
35 Ga0070668_100029893 3300005347 Bacteria 4139
36 Ga0070669_100008399 3300005353 Bacteria 7369
37 Ga0070675_100002980 3300005354 Bacteria 12787
38 Ga0070675_100045202 3300005354 Bacteria 3603
39 Ga0070675_100110141 3300005354 Bacteria 2328
40 Ga0070675_100221278 3300005354 Bacteria 1648
41 Ga0070675_100280223 3300005354 Bacteria 1465
42 Ga0070671_100004931 3300005355 Bacteria 10616
43 Ga0070671_100180001 3300005355 Bacteria 1789
44 Ga0070671_100226140 3300005355 Bacteria 1588
45 Ga0070674_100046248 3300005356 Bacteria 2976
46 Ga0070674_100059454 3300005356 Bacteria 2661
47 Ga0070673_100004828 3300005364 Bacteria 8572
48 Ga0070673_100016593 3300005364 Bacteria 5212
49 Ga0070673_100039188 3300005364 Bacteria 3624
50 Ga0070673_100088996 3300005364 Bacteria 2519
51 Ga0070673_100154931 3300005364 Bacteria 1944
52 Ga0070688_100147901 3300005365 Bacteria 1603
53 Ga0070688_100271769 3300005365 Bacteria 1214
54 Ga0070667_100005133 3300005367 Bacteria 10962
55 Ga0070667_100200527 3300005367 Bacteria 1770
56 Ga0070709_10012617 3300005434 Bacteria 4733
57 Ga0070710_10060017 3300005437 Bacteria 2162
58 Ga0070701_10000224 3300005438 Bacteria 17823
59 Ga0070705_100002532 3300005440 Bacteria 9182
60 Ga0070700_100001299 3300005441 Bacteria 12426
61 Ga0070700_100004515 3300005441 Bacteria 7277
62 Ga0070694_100001971 3300005444 Bacteria 12174
63 Ga0070694_100042550 3300005444 Bacteria 3035
64 Ga0070694_100531996 3300005444 Bacteria 939
65 Ga0070708_100009280 3300005445 Bacteria 7928
66 Ga0070708_100139945 3300005445 Bacteria 2244
67 Ga0070708_100500183 3300005445 Bacteria 1147
68 Ga0070663_100082456 3300005455 Bacteria 2366
69 Ga0070678_100013046 3300005456 Bacteria 5193
70 Ga0070678_100069427 3300005456 Bacteria 2631
71 Ga0070678_100236880 3300005456 Bacteria 1524
72 Ga0070678_100623804 3300005456 Bacteria 965
73 Ga0070662_100040483 3300005457 Unclassified 3318
74 Ga0070681_10047645 3300005458 Bacteria 4285
75 Ga0070681_10101280 3300005458 Bacteria 2826
76 Ga0070681_10437682 3300005458 Unclassified 1219
77 Ga0068867_100000933 3300005459 Bacteria 19900
78 Ga0068867_100005200 3300005459 Bacteria 9182
79 Ga0068867_100032581 3300005459 Unclassified 3770
80 Ga0068867_100047763 3300005459 Bacteria 3147
81 Ga0068867_100946011 3300005459 Bacteria 778
82 Ga0070707_100471161 3300005468 Bacteria 1217
83 Ga0070679_100068668 3300005530 Bacteria 3535
84 Ga0070679_100268660 3300005530 Bacteria 1660
85 Ga0070684_100027121 3300005535 Bacteria 4832
86 Ga0070697_100004993 3300005536 Bacteria 10186
87 Ga0070697_100006211 3300005536 Bacteria 9246
88 Ga0068853_100321106 3300005539 Bacteria 1435
89 Ga0070672_100018753 3300005543 Bacteria 5010
90 Ga0070672_100117048 3300005543 Bacteria 2178
91 Ga0070686_100002771 3300005544 Bacteria 9649
92 Ga0070686_100593523 3300005544 Bacteria 872
93 Ga0070695_100000207 3300005545 Bacteria 28678
94 Ga0070696_100000958 3300005546 Bacteria 18702
95 Ga0070696_100016842 3300005546 Bacteria 4930
96 Ga0070693_100001070 3300005547 Bacteria 12237
97 Ga0070693_100245616 3300005547 Unclassified 1184
98 Ga0070665_100014355 3300005548 Bacteria 7952
99 Ga0070704_100008889 3300005549 Bacteria 6047
100 Ga0070704_100623268 3300005549 Bacteria 950
101 Ga0068855_100014749 3300005563 Bacteria 9416
102 Ga0068855_100103065 3300005563 Bacteria 3284
103 Ga0070664_100032286 3300005564 Bacteria 4379
104 Ga0070664_100101414 3300005564 Bacteria 2503
105 Ga0068857_100005938 3300005577 Bacteria 10426
106 Ga0068854_100027072 3300005578 Unclassified 3948
107 Ga0070702_100000051 3300005615 Bacteria 32802
108 Ga0070702_100012703 3300005615 Bacteria 4232
109 Ga0070702_100093597 3300005615 Bacteria 1828
110 Ga0068852_100004249 3300005616 Bacteria 10115
111 Ga0068859_100008140 3300005617 Bacteria 10631
112 Ga0068859_100042548 3300005617 Bacteria 4563
113 Ga0068859_100303364 3300005617 Bacteria 1690
114 Ga0068864_100007594 3300005618 Bacteria 8932
115 Ga0068864_100008022 3300005618 Bacteria 8711
116 Ga0068864_100013279 3300005618 Bacteria 6822
117 Ga0068864_100172212 3300005618 Bacteria 1974
118 Ga0068866_10000950 3300005718 Bacteria 12744
119 Ga0068866_10050302 3300005718 Bacteria 2116
120 Ga0068866_10051532 3300005718 Bacteria 2096
121 Ga0068861_100002773 3300005719 Bacteria 11497
122 Ga0068861_100010391 3300005719 Bacteria 6458
123 Ga0068861_100010443 3300005719 Bacteria 6445
124 Ga0068861_100139266 3300005719 Bacteria 1979
125 Ga0068851_10009210 3300005834 Bacteria 4583
126 Ga0068870_10015905 3300005840 Bacteria 3582
127 Ga0068863_100080391 3300005841 Bacteria 3087
128 Ga0068863_100103506 3300005841 Bacteria 2708
129 Ga0068863_100218008 3300005841 Bacteria 1838
130 Ga0068858_100007174 3300005842 Bacteria 10810
131 Ga0068858_100009709 3300005842 Bacteria 9166
132 Ga0068858_100077059 3300005842 Bacteria 3097
133 Ga0068860_100007869 3300005843 Bacteria 10641
134 Ga0068860_100034055 3300005843 Bacteria 4885
135 Ga0068862_100007285 3300005844 Bacteria 9182
136 Ga0068862_100011831 3300005844 Bacteria 7206
137 Ga0068862_100020835 3300005844 Bacteria 5477
138 Ga0068862_100186786 3300005844 Bacteria 1863
139 Ga0081540_1001281 3300005983 Bacteria 21930
140 Ga0070717_10317727 3300006028 Bacteria 1387
141 Ga0075362_10190436 3300006177 Bacteria 996
142 Ga0097621_100002764 3300006237 Bacteria 12002
143 Ga0097621_100039421 3300006237 Bacteria 3794
144 Ga0097621_100208450 3300006237 Bacteria 1699
145 Ga0075370_10315244 3300006353 Bacteria 931
146 Ga0068871_100007784 3300006358 Bacteria 7671
147 Ga0068871_100025039 3300006358 Bacteria 4637
148 Ga0075428_100000581 3300006844 Bacteria 37409
149 Ga0075428_100005195 3300006844 Bacteria 14462
150 Ga0075428_100925434 3300006844 Unclassified 924
151 Ga0075430_100067598 3300006846 Bacteria 3000
152 Ga0075430_100075920 3300006846 Bacteria 2817
153 Ga0075431_100003369 3300006847 Bacteria 15494
154 Ga0075431_100055871 3300006847 Bacteria 4073
155 Ga0075431_100305373 3300006847 Bacteria 1607
156 Ga0075433_10020868 3300006852 Bacteria 5484
157 Ga0075433_10146101 3300006852 Bacteria 2102
158 Ga0075433_10442513 3300006852 Bacteria 1146
159 Ga0075434_100000018 3300006871 Bacteria 73715
160 Ga0075434_100367675 3300006871 Bacteria 1459
161 Ga0075429_100000103 3300006880 Bacteria 47421
162 Ga0075429_100011647 3300006880 Bacteria 7627
163 Ga0075429_100012874 3300006880 Bacteria 7257
164 Ga0075429_100057163 3300006880 Bacteria 3396
165 Ga0068865_100000447 3300006881 Bacteria 22945
166 Ga0068865_100006240 3300006881 Bacteria 7258
167 Ga0068865_100084014 3300006881 Bacteria 2293
168 Ga0068865_100146278 3300006881 Bacteria 1788
169 Ga0068865_100313452 3300006881 Unclassified 1259
170 Ga0075436_100129106 3300006914 Bacteria 1772
171 Ga0097620_100008140 3300006931 Bacteria 10631
172 Ga0097620_100042551 3300006931 Bacteria 4563
173 Ga0097620_100135675 3300006931 Bacteria 2534
174 Ga0097620_100303354 3300006931 Bacteria 1690
175 Ga0075435_100001709 3300007076 Bacteria 14257
176 Ga0075435_100097126 3300007076 Bacteria 2437
177 Ga0099794_10036918 3300007265 Bacteria 2312
178 Ga0099794_10125540 3300007265 Bacteria 1294
179 Ga0105251_10051926 3300009011 Unclassified 1954
180 Ga0111539_10007241 3300009094 Bacteria 14214
181 Ga0111539_10031496 3300009094 Bacteria 6442
182 Ga0111539_10049570 3300009094 Bacteria 5006
183 Ga0111539_10055424 3300009094 Bacteria 4712
184 Ga0111539_10057719 3300009094 Bacteria 4608
185 Ga0111539_10074774 3300009094 Bacteria 3992
186 Ga0111539_10258370 3300009094 Bacteria 2028
187 Ga0111539_10263739 3300009094 Bacteria 2005
188 Ga0111539_10307426 3300009094 Bacteria 1845
189 Ga0111539_11129526 3300009094 Bacteria 910
190 Ga0105245_10004425 3300009098 Bacteria 12431
191 Ga0105245_10082640 3300009098 Bacteria 2939
192 Ga0105245_10102208 3300009098 Bacteria 2654
193 Ga0105247_10146606 3300009101 Bacteria 1552
194 Ga0114129_10001184 3300009147 Bacteria 34627
195 Ga0114129_10246446 3300009147 Bacteria 2400
196 Ga0114129_10539249 3300009147 Bacteria 1519
197 Ga0105243_10003720 3300009148 Bacteria 12240
198 Ga0105243_10043914 3300009148 Bacteria 3504
199 Ga0105243_10339070 3300009148 Bacteria 1376
200 Ga0105243_10699493 3300009148 Bacteria 988
201 Ga0105241_10013741 3300009174 Bacteria 5931
202 Ga0105242_10003302 3300009176 Bacteria 12562
203 Ga0105242_10597170 3300009176 Bacteria 1066
204 Ga0105242_10754276 3300009176 Bacteria 958
205 Ga0105248_10019941 3300009177 Bacteria 7423
206 Ga0105248_10028790 3300009177 Bacteria 6192
207 Ga0105248_10060761 3300009177 Bacteria 4242
208 Ga0105248_10663870 3300009177 Bacteria 1176
209 Ga0105248_10663882 3300009177 Bacteria 1176
210 Ga0105249_10000917 3300009553 Bacteria 26070
211 Ga0105249_10004574 3300009553 Bacteria 11954
212 Ga0105249_10092777 3300009553 Bacteria 2827
213 Ga0105249_10221190 3300009553 Bacteria 1863
214 Ga0105239_10008582 3300010375 Bacteria 11592
215 Ga0157370_10176374 3300013104 Unclassified 1986
216 Ga0157369_10207902 3300013105 Unclassified 2052
217 Ga0157374_10019315 3300013296 Bacteria 6030
218 Ga0157374_10439171 3300013296 Bacteria 1305
219 Ga0157378_10004581 3300013297 Bacteria 12120
220 Ga0157378_10033107 3300013297 Bacteria 4568
221 Ga0157378_10038691 3300013297 Unclassified 4228
222 Ga0157378_10039028 3300013297 Bacteria 4210
223 Ga0157378_10522476 3300013297 Bacteria 1189
224 Ga0163162_10030171 3300013306 Bacteria 5372
225 Ga0163162_10076028 3300013306 Bacteria 3419
226 Ga0163162_10184892 3300013306 Bacteria 2211
227 Ga0157372_10501884 3300013307 Bacteria 1415
228 Ga0157375_10015951 3300013308 Bacteria 6738
229 Ga0157375_10056999 3300013308 Bacteria 3860
230 Ga0157375_10259599 3300013308 Bacteria 1899
231 Ga0157375_10332824 3300013308 Bacteria 1683
232 Ga0157375_10419339 3300013308 Bacteria 1504
233 Ga0157375_10590573 3300013308 Bacteria 1270
234 Ga0157375_10639620 3300013308 Bacteria 1220
235 Ga0157380_10014049 3300014326 Bacteria 5850
236 Ga0157380_10208628 3300014326 Bacteria 1739
237 Ga0157380_10268051 3300014326 Bacteria 1555
238 Ga0157380_10355097 3300014326 Bacteria 1373
239 Ga0157379_10005009 3300014968 Bacteria 11367
240 Ga0157379_10544827 3300014968 Bacteria 1079
241 Ga0157376_10003398 3300014969 Bacteria 10956
242 Ga0157376_10004392 3300014969 Bacteria 9818
243 Ga0157376_10005968 3300014969 Bacteria 8558
244 Ga0163161_10118584 3300017792 Bacteria 1986
245 Ga0213876_10224120 3300021384 Bacteria 999
246 Ga0213875_10005102 3300021388 Bacteria 7106
247 Ga0213871_10078997 3300021441 Bacteria 940
248 Ga0209758_1000362 3300025297 Bacteria 80796
249 Ga0207697_10019263 3300025315 Bacteria 2795
250 Ga0207697_10055368 3300025315 Bacteria 1644
251 Ga0207682_10003021 3300025893 Bacteria 7377
252 Ga0207682_10074392 3300025893 Bacteria 1444
253 Ga0207692_10036807 3300025898 Bacteria 2389
254 Ga0207642_10001134 3300025899 Bacteria 8234
255 Ga0207642_10049559 3300025899 Bacteria 1889
256 Ga0207642_10078436 3300025899 Bacteria 1596
257 Ga0207642_10188381 3300025899 Bacteria 1130
258 Ga0207685_10097946 3300025905 Bacteria 1248
259 Ga0207645_10062708 3300025907 Unclassified 2375
260 Ga0207645_10083705 3300025907 Bacteria 2046
261 Ga0207645_10207559 3300025907 Bacteria 1290
262 Ga0207643_10006986 3300025908 Bacteria 6052
263 Ga0207643_10427155 3300025908 Bacteria 840
264 Ga0207654_10013963 3300025911 Bacteria 4140
265 Ga0207707_10268490 3300025912 Unclassified 1479
266 Ga0207660_10008341 3300025917 Bacteria 6699
267 Ga0207662_10000215 3300025918 Bacteria 26901
268 Ga0207662_10039341 3300025918 Bacteria 2774
269 Ga0207662_10065002 3300025918 Bacteria 2196
270 Ga0207662_10377583 3300025918 Bacteria 957
271 Ga0207649_10014627 3300025920 Bacteria 4397
272 Ga0207649_10380099 3300025920 Bacteria 1052
273 Ga0207646_10393884 3300025922 Bacteria 1251
274 Ga0207646_10488270 3300025922 Bacteria 1110
275 Ga0207681_10002427 3300025923 Bacteria 11816
276 Ga0207681_10126276 3300025923 Bacteria 1884
277 Ga0207681_10525245 3300025923 Bacteria 972
278 Ga0207694_10408266 3300025924 Bacteria 1130
279 Ga0207650_10009035 3300025925 Bacteria 6813
280 Ga0207650_10038898 3300025925 Bacteria 3476
281 Ga0207650_10287506 3300025925 Bacteria 1340
282 Ga0207659_10064900 3300025926 Bacteria 2644
283 Ga0207687_10001049 3300025927 Bacteria 18747
284 Ga0207687_10042502 3300025927 Bacteria 3127
285 Ga0207700_10199934 3300025928 Bacteria 1684
286 Ga0207706_10112282 3300025933 Unclassified 2398
287 Ga0207706_10211331 3300025933 Bacteria 1701
288 Ga0207686_10002720 3300025934 Bacteria 9588
289 Ga0207686_10425358 3300025934 Bacteria 1017
290 Ga0207709_10003890 3300025935 Bacteria 8729
291 Ga0207709_10003995 3300025935 Bacteria 8600
292 Ga0207709_10228406 3300025935 Bacteria 1347
293 Ga0207670_10002408 3300025936 Bacteria 9804
294 Ga0207670_10003744 3300025936 Bacteria 8077
295 Ga0207670_10019339 3300025936 Bacteria 4159
296 Ga0207670_10059051 3300025936 Bacteria 2608
297 Ga0207670_10410352 3300025936 Bacteria 1085
298 Ga0207669_10039565 3300025937 Bacteria 2726
299 Ga0207669_10068717 3300025937 Bacteria 2214
300 Ga0207704_10001044 3300025938 Bacteria 12293
301 Ga0207704_10001267 3300025938 Bacteria 11301
302 Ga0207704_10118319 3300025938 Bacteria 1807
303 Ga0207704_10151695 3300025938 Bacteria 1636
304 Ga0207665_10071496 3300025939 Bacteria 2369
305 Ga0207665_10783916 3300025939 Bacteria 752
306 Ga0207691_10004344 3300025940 Bacteria 13749
307 Ga0207691_10068861 3300025940 Bacteria 3197
308 Ga0207691_10141828 3300025940 Bacteria 2117
309 Ga0207711_10058867 3300025941 Bacteria 3307
310 Ga0207711_10283498 3300025941 Bacteria 1526
311 Ga0207711_10504937 3300025941 Bacteria 1127
312 Ga0207689_10000007 3300025942 Bacteria 132362
313 Ga0207689_10001267 3300025942 Bacteria 24358
314 Ga0207661_10002250 3300025944 Bacteria 13306
315 Ga0207679_10011613 3300025945 Bacteria 5715
316 Ga0207679_10133432 3300025945 Bacteria 1995
317 Ga0207667_10012993 3300025949 Bacteria 9558
318 Ga0207651_10009087 3300025960 Bacteria 5411
319 Ga0207651_10011744 3300025960 Bacteria 4916
320 Ga0207651_10040441 3300025960 Bacteria 3085
321 Ga0207651_10056867 3300025960 Bacteria 2695
322 Ga0207651_10074117 3300025960 Bacteria 2423
323 Ga0207712_10006352 3300025961 Bacteria 7456
324 Ga0207712_10032651 3300025961 Bacteria 3514
325 Ga0207712_10041924 3300025961 Bacteria 3149
326 Ga0207640_10010129 3300025981 Bacteria 5301
327 Ga0207640_10025271 3300025981 Unclassified 3593
328 Ga0207658_10567291 3300025986 Bacteria 1017
329 Ga0207677_10002194 3300026023 Bacteria 10259
330 Ga0207677_10008899 3300026023 Bacteria 5629
331 Ga0207703_10004921 3300026035 Bacteria 10839
332 Ga0207703_10005035 3300026035 Bacteria 10715
333 Ga0207703_10071140 3300026035 Bacteria 2873
334 Ga0207639_10029407 3300026041 Bacteria 4022
335 Ga0207639_10292976 3300026041 Bacteria 1436
336 Ga0207708_10001220 3300026075 Bacteria 19421
337 Ga0207708_10014298 3300026075 Bacteria 5937
338 Ga0207708_10039912 3300026075 Bacteria 3578
339 Ga0207708_10192164 3300026075 Bacteria 1625
340 Ga0207641_10029278 3300026088 Bacteria 4552
341 Ga0207641_10087012 3300026088 Bacteria 2726
342 Ga0207648_10000135 3300026089 Bacteria 73544
343 Ga0207648_10002758 3300026089 Bacteria 18666
344 Ga0207648_10007543 3300026089 Bacteria 10674
345 Ga0207648_10063238 3300026089 Unclassified 3226
346 Ga0207648_10097650 3300026089 Bacteria 2571
347 Ga0207648_10928445 3300026089 Bacteria 814
348 Ga0207676_10008772 3300026095 Bacteria 7196
349 Ga0207676_10157379 3300026095 Bacteria 1964
350 Ga0207676_10158790 3300026095 Bacteria 1956
351 Ga0207676_10179642 3300026095 Bacteria 1852
352 Ga0207676_10635180 3300026095 Bacteria 1029
353 Ga0207674_10036389 3300026116 Bacteria 5131
354 Ga0207675_100000825 3300026118 Bacteria 30861
355 Ga0207675_100002436 3300026118 Bacteria 18434
356 Ga0207675_100019002 3300026118 Bacteria 6416
357 Ga0207675_100177632 3300026118 Bacteria 2037
358 Ga0207683_10001605 3300026121 Bacteria 20325
359 Ga0207683_10022789 3300026121 Bacteria 5379
360 Ga0207683_10640644 3300026121 Bacteria 984
361 Ga0207698_10009224 3300026142 Bacteria 6277
362 Ga0210000_1006284 3300027462 Bacteria 1729
363 Ga0209995_1003052 3300027471 Bacteria 2657
364 Ga0209983_1004825 3300027665 Bacteria 2815
365 Ga0209974_10020791 3300027876 Bacteria 2175
366 Ga0207428_10000265 3300027907 Bacteria 70984
367 Ga0207428_10010533 3300027907 Bacteria 8255
368 Ga0207428_10216925 3300027907 Bacteria 1435
369 Ga0268266_10058329 3300028379 Bacteria 3324
370 Ga0268266_10212260 3300028379 Bacteria 1776
371 Ga0268265_10001812 3300028380 Bacteria 17085
372 Ga0268265_10003652 3300028380 Bacteria 10970
373 Ga0268265_10081646 3300028380 Bacteria 2553
374 Ga0268265_10092160 3300028380 Bacteria 2425
375 Ga0268265_10115036 3300028380 Bacteria 2204
376 Ga0268265_10272914 3300028380 Bacteria 1509
377 Ga0268264_10001495 3300028381 Bacteria 21802
378 Ga0268264_10018097 3300028381 Bacteria 5763
379 Ga0268264_10305250 3300028381 Bacteria 1500
380 Ga0265318_10007463 3300028577 Bacteria 4943
381 Ga0265330_10005907 3300031235 Bacteria 6064
382 Ga0265332_10012748 3300031238 Bacteria 3729
383 Ga0265320_10045606 3300031240 Bacteria 2153
384 Ga0265316_10029413 3300031344 Bacteria 4518
385 Ga0265314_10003722 3300031711 Bacteria 14592
386 Ga0307412_10280111 3300031911 Bacteria 1309
387 Ga0307416_100108630 3300032002 Bacteria 2438
388 Ga0307510_10000002 3300033180 Bacteria 801565
389 Ga0373959_0034008 3300034820 Bacteria 1042
390 Ga0373938_0011679 3300034957 Bacteria 1637
391 Ga0373926_0029879 3300035083 Bacteria 1916
392 Ga0373928_0006247 3300035084 Bacteria 2288
393 Ga0373929_0006633 3300035085 Bacteria 2095
394 Ga0373929_0011649 3300035085 Bacteria 1660
395 Ga0373934_0000044 3300035086 Bacteria 41857
396 Ga0373944_0003470 3300035089 Bacteria 4073
397 Ga0373944_0020545 3300035089 Bacteria 1904
398 Ga0373952_0020693 3300035092 Bacteria 1381
399 Ga0373952_0063544 3300035092 Bacteria 908
400 Ga0373923_0023030 3300035111 Bacteria 2447
401 Ga0373923_0046930 3300035111 Bacteria 1798
402 Ga0373932_0019906 3300035112 Bacteria 1754
403 Ga0373936_0000601 3300035113 Bacteria 12463
404 Ga0373936_0019200 3300035113 Bacteria 2648
405 Ga0373939_0023657 3300035114 Bacteria 1704
406 Ga0373945_0000490 3300035116 Bacteria 11249
407 Ga0373945_0035109 3300035116 Bacteria 1791
408 Ga0373953_0003011 3300035117 Bacteria 5160
409 Ga0373954_0000012 3300035118 Bacteria 73616
410 Ga0373954_0018088 3300035118 Bacteria 3170
411 Ga0373954_0143501 3300035118 Bacteria 1165
412 Ga0373956_0002849 3300035119 Bacteria 6998
413 Ga0373957_0001310 3300035120 Bacteria 6684
414 Ga0373957_0004446 3300035120 Bacteria 4265
415 Ga0373960_0003931 3300035121 Bacteria 3388
416 Ga0373943_0186463 3300035170 Bacteria 1142
417 Ga0373946_0007524 3300035171 Bacteria 3983
418 Ga0373946_0157178 3300035171 Bacteria 1065
419 Ga0373955_0000470 3300035172 Bacteria 16971
420 Ga0373955_0010226 3300035172 Bacteria 4424
421 Ga0373955_0087656 3300035172 Bacteria 1769
422 Ga0373942_0053737 3300035207 Bacteria 1136
423 Ga0373961_0043058 3300035241 Bacteria 1311
424 Ga0373962_0003002 3300035242 Bacteria 4046
425 Ga0373924_0000643 3300035410 Bacteria 10842
426 Ga0373924_0001386 3300035410 Bacteria 7846
427 Ga0373924_0110164 3300035410 Bacteria 1189
428 Ga0373931_0001393 3300035691 Bacteria 10357
429 Ga0373931_0005783 3300035691 Bacteria 5748
430 Ga0373931_0026800 3300035691 Bacteria 2937
431 Ga0373931_0148187 3300035691 Bacteria 1365
432 Ga0373935_0004736 3300035692 Bacteria 8002
433 Ga0373935_0018543 3300035692 Bacteria 4235
434 Ga0373935_0058785 3300035692 Bacteria 2456
435 Ga0373927_0025024 3300035695 Bacteria 3903
436 Ga0373927_0297247 3300035695 Bacteria 1062
437 Ga0373933_0000107 3300035724 Bacteria 53134
438 Ga0373933_0001549 3300035724 Bacteria 13464
439 Ga0373933_0049886 3300035724 Bacteria 2496
440 Ga0373947_0026360 3300035725 Bacteria 3396
441 Ga0373947_0101274 3300035725 Bacteria 1810
442 Ga0373947_0496790 3300035725 Bacteria 829
443 Ga0373937_0000810 3300036401 Bacteria 26724
444 Ga0373937_0002420 3300036401 Bacteria 15516
445 Ga0373937_0008090 3300036401 Bacteria 9128
446 Ga0373937_0031763 3300036401 Bacteria 4786
447 Ga0373925_0019590 3300037068 Bacteria 4923
448 Ga0373925_0050873 3300037068 Bacteria 3091
449 Ga0436360_0512522 3300039438 Bacteria 2827
450 Ga0436361_0295678 3300039447 Bacteria 1667
451 Ga0439435_0066788 3300042436 Bacteria 1058
452 Ga0439435_0115465 3300042436 Bacteria 837
453 Ga0451577_0102038 3300042876 Bacteria 2563
454 Ga0453684_0150383 3300044712 Bacteria 2768
455 Ga0451576_0006018 3300045051 Bacteria 14993
456 Ga0451576_0022710 3300045051 Bacteria 6796
457 Ga0451576_0287673 3300045051 Bacteria 1718
458 Ga0451576_0679266 3300045051 Bacteria 1082
459 Ga0495592_0071528 3300046454 Bacteria 2525
460 Ga0495603_0003474 3300046455 Bacteria 9373
461 Ga0495629_0269151 3300046459 Bacteria 1171
462 Ga0495641_0003233 3300046461 Bacteria 12354
463 Ga0495651_0000105 3300046462 Bacteria 61688
464 Ga0495651_0003319 3300046462 Bacteria 12355
465 Ga0495653_0012885 3300046463 Bacteria 6827
466 Ga0495580_0003325 3300046472 Bacteria 13747
467 Ga0495580_0026172 3300046472 Bacteria 4256
468 Ga0495582_0067044 3300046473 Bacteria 1983
469 Ga0495582_0073525 3300046473 Bacteria 1892
470 Ga0495639_0018448 3300046475 Bacteria 3038
471 Ga0495639_0018888 3300046475 Bacteria 3005
472 Ga0495662_0023260 3300046476 Bacteria 2992
473 Ga0495608_0053894 3300046511 Bacteria 2659
474 Ga0495608_0326134 3300046511 Bacteria 948
475 Ga0495628_0011511 3300046516 Bacteria 7478
476 Ga0495628_0015785 3300046516 Bacteria 6303
477 Ga0495628_0052061 3300046516 Bacteria 3235
478 Ga0495630_0008055 3300046517 Bacteria 7575
479 Ga0495666_0026179 3300046526 Bacteria 2878
480 Ga0495666_0028857 3300046526 Bacteria 2729
481 Ga0495642_0253927 3300046528 Bacteria 769
482 Ga0495652_0040846 3300046529 Bacteria 4009
483 Ga0495665_0065227 3300046531 Bacteria 1922
484 Ga0495640_0022913 3300046533 Bacteria 4561
485 Ga0495586_0003781 3300046535 Bacteria 8111
486 Ga0495586_0015739 3300046535 Bacteria 4023
487 Ga0495586_0041096 3300046535 Bacteria 2490
488 Ga0495586_0082594 3300046535 Bacteria 1767
489 Ga0495587_0002310 3300046536 Bacteria 12764
490 Ga0495645_0452795 3300046543 Bacteria 809
491 Ga0495622_0172375 3300046557 Bacteria 972
492 Ga0495667_0004692 3300046559 Bacteria 9239
493 Ga0495667_0219862 3300046559 Bacteria 1212
494 Ga0495667_0472739 3300046559 Bacteria 786
495 Ga0495634_0012863 3300046642 Bacteria 6057
496 Ga0495588_0035553 3300046674 Bacteria 2525
497 Ga0495657_0002627 3300046675 Bacteria 15037
498 Ga0495657_0122590 3300046675 Bacteria 1636
499 Ga0495657_0160678 3300046675 Bacteria 1390
500 Ga0495599_0081236 3300046678 Bacteria 2024
501 Ga0495647_0000588 3300046681 Bacteria 10771
502 Ga0495647_0001106 3300046681 Bacteria 8240
503 Ga0495658_0002559 3300046683 Bacteria 9145
504 Ga0495658_0047992 3300046683 Bacteria 2406
505 Ga0495658_0106956 3300046683 Bacteria 1677
506 Ga0495658_0283913 3300046683 Bacteria 1045
507 Ga0495669_0074223 3300046684 Bacteria 1555
508 Ga0495669_0132397 3300046684 Bacteria 1174
509 Ga0495613_0006955 3300046689 Bacteria 8437
510 Ga0495624_0098587 3300046690 Bacteria 1800
511 Ga0495600_0000689 3300046809 Bacteria 17658
512 Ga0495581_0077946 3300047315 Bacteria 1918
513 Ga0495581_0135214 3300047315 Bacteria 1437
514 Ga0495604_0130574 3300047317 Bacteria 1806
515 Ga0495674_0000463 3300047319 Bacteria 36736
516 Ga0495676_0056302 3300047321 Bacteria 3110
517 Ga0495680_0027640 3300047322 Bacteria 4657
518 Ga0495680_0037275 3300047322 Bacteria 3895
519 Ga0495680_0228162 3300047322 Bacteria 1327
520 Ga0495680_0352169 3300047322 Bacteria 1025
521 Ga0495684_0001586 3300047471 Bacteria 18214
522 Ga0496100_0039048 3300048903 Bacteria 3012
523 Ga0496101_0054297 3300048904 Bacteria 2892
524 Ga0496102_0165138 3300048905 Bacteria 2083
525 Ga0496103_0152173 3300048906 Bacteria 1482
526 Ga0496104_0002475 3300048907 Bacteria 15914
527 Ga0496104_0015427 3300048907 Bacteria 6919
528 Ga0496105_0011725 3300048908 Bacteria 6937
529 Ga0496106_0019897 3300048909 Bacteria 4978
530 Ga0496106_0039984 3300048909 Bacteria 3511
531 Ga0496107_0168039 3300048910 Bacteria 1627
532 Ga0496108_0009808 3300048911 Bacteria 7757
533 Ga0496108_0134102 3300048911 Bacteria 2129
534 Ga0496108_0431193 3300048911 Bacteria 1151
535 Ga0496110_0039992 3300048913 Bacteria 4086
536 Ga0496110_0052896 3300048913 Bacteria 3568
537 Ga0496111_0024775 3300048914 Bacteria 4232
538 Ga0496112_0039691 3300048915 Bacteria 4601
539 Ga0496113_0025103 3300048916 Bacteria 4245
540 Ga0496114_0011772 3300048917 Bacteria 6999
541 Ga0496114_0200860 3300048917 Bacteria 1746
542 Ga0496115_0063377 3300048918 Bacteria 2982
543 Ga0496121_0000795 3300048924 Bacteria 57731
544 Ga0496126_0008797 3300048929 Bacteria 10831
545 Ga0496126_0093971 3300048929 Bacteria 2632
546 Ga0496126_0263616 3300048929 Bacteria 1432
547 Ga0496126_0307144 3300048929 Bacteria 1307
548 Ga0501291_043531 3300049514 Bacteria 797
549 Ga0501033_0036268 3300049570 Bacteria 3695
550 Ga0501034_0185291 3300049571 Bacteria 2045
551 Ga0501036_0229446 3300049572 Bacteria 1558
552 Ga0501037_0003806 3300049573 Bacteria 10947
553 Ga0501037_0094303 3300049573 Bacteria 2164
554 Ga0501038_0000994 3300049574 Bacteria 25505
555 Ga0501039_0003932 3300049575 Bacteria 11168
556 Ga0501039_0012378 3300049575 Bacteria 6511
557 Ga0501040_0030971 3300049576 Bacteria 3615
558 Ga0501041_0003756 3300049577 Bacteria 8737
559 Ga0501041_0004135 3300049577 Bacteria 8394
560 Ga0501042_0006414 3300049578 Bacteria 7630
561 Ga0501042_0029632 3300049578 Bacteria 3860
562 Ga0501043_0010120 3300049579 Bacteria 7394
563 Ga0501046_0004336 3300049580 Bacteria 12915
564 Ga0501047_0135821 3300049581 Bacteria 2340
565 Ga0501048_0000293 3300049582 Bacteria 34000
566 Ga0501068_0033695 3300049584 Bacteria 3051
567 Ga0501068_0244525 3300049584 Bacteria 1142
568 Ga0501070_0047758 3300049586 Bacteria 3557
569 Ga0501071_0018669 3300049587 Bacteria 4807
570 Ga0501071_0024763 3300049587 Bacteria 4198
571 Ga0501072_0008621 3300049588 Bacteria 7739
572 Ga0501072_0067258 3300049588 Bacteria 2827
573 Ga0501072_0302661 3300049588 Bacteria 1271
574 Ga0501074_0112907 3300049590 Bacteria 1944
575 Ga0501075_0002497 3300049591 Bacteria 12252
576 Ga0501076_0002131 3300049592 Bacteria 13585
577 Ga0501076_0484992 3300049592 Bacteria 1019
578 Ga0501077_0012170 3300049593 Bacteria 5385
579 Ga0501079_0004238 3300049741 Bacteria 10636
580 Ga0501079_0008832 3300049741 Bacteria 7630
581 Ga0501079_0116300 3300049741 Bacteria 2079
582 Ga0501080_0018160 3300049742 Bacteria 6510
583 Ga0501081_0000696 3300049743 Bacteria 19414
584 Ga0501081_0023597 3300049743 Bacteria 4123
585 Ga0501035_0063920 3300049822 Bacteria 3272
586 Ga0501044_0409718 3300049823 Bacteria 1267
587 Ga0501045_0004598 3300049824 Bacteria 9528
588 Ga0501045_0012797 3300049824 Bacteria 5911
589 Ga0501045_0028707 3300049824 Bacteria 4015
590 nmdc:mga05p37_202939_c1 3300050507 Bacteria 2400
591 nmdc:mga05p37_2836_c1 3300050507 Bacteria 20144
592 nmdc:mga05p37_376862_c1 3300050507 Bacteria 1664
593 nmdc:mga09592_12321_c1 3300050508 Bacteria 6963
594 nmdc:mga09592_20267_c1 3300050508 Bacteria 5466
595 nmdc:mga0qj67_161179_c1 3300050509 Bacteria 1821
596 nmdc:mga06r32_64989_c1 3300050510 Bacteria 3518
597 nmdc:mga08y16_124999_c1 3300050511 Bacteria 2676
598 nmdc:mga08y16_134231_c1 3300050511 Bacteria 2573
599 nmdc:mga08y16_141826_c1 3300050511 Bacteria 2498
600 nmdc:mga08y16_35981_c1 3300050511 Bacteria 5199
601 nmdc:mga08y16_393340_c1 3300050511 Bacteria 1420
602 nmdc:mga08y16_5446_c1 3300050511 Bacteria 13305
603 nmdc:mga08y16_66966_c1 3300050511 Bacteria 3747
604 nmdc:mga08y16_71427_c1 3300050511 Bacteria 3617
605 nmdc:mga0n895_42155_c1 3300050512 Bacteria 4440
606 nmdc:mga0n895_44924_c1 3300050512 Bacteria 4309
607 nmdc:mga0n895_598346_c1 3300050512 Bacteria 1105
608 nmdc:mga0n895_67805_c1 3300050512 Bacteria 3534
609 nmdc:mga0n895_764076_c1 3300050512 Bacteria 959
610 nmdc:mga0rr50_154_c1 3300050513 Bacteria 37500
611 nmdc:mga0rr50_31682_c1 3300050513 Bacteria 3759
612 nmdc:mga0rr50_570391_c1 3300050513 Bacteria 964
613 nmdc:mga0rr50_63304_c1 3300050513 Bacteria 2793
614 nmdc:mga08x19_150217_c1 3300050514 Bacteria 1577
615 nmdc:mga08x19_2283_c1 3300050514 Bacteria 11642
616 nmdc:mga0a205_242_c1 3300050515 Bacteria 22520
617 nmdc:mga0a205_343573_c1 3300050515 Bacteria 1361
618 Ga0495601_0030790 3300053077 Bacteria 3333
619 Ga0495601_0031662 3300053077 Bacteria 3288
620 Ga0495601_0298229 3300053077 Bacteria 1050
621 Ga0495595_0008104 3300053084 Bacteria 4308
622 Ga0495619_0054003 3300053085 Bacteria 2658
623 Ga0495619_0072995 3300053085 Bacteria 2299
624 Ga0500566_0296010 3300053094 Bacteria 764
625 Ga0500618_001640 3300053125 Bacteria 9634
626 Ga0501084_0018451 3300054114 Bacteria 5808
627 Ga0501084_0117467 3300054114 Bacteria 2236
628 Ga0590071_026700 3300059421 Bacteria 1370
629 Ga0501082_0000754 3300060353 Bacteria 28420
630 Ga0530510_0002046 3300061734 Bacteria 13863

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0484992 Ga0501076_0484992_228_929 182
2 3300009094 Ga0111539_11129526 Ga0111539_111295261 190
3 3300049570 Ga0501033_0036268 Ga0501033_0036268_1238_2023 200
4 3300049573 Ga0501037_0094303 Ga0501037_0094303_196_981 200
5 3300049822 Ga0501035_0063920 Ga0501035_0063920_1002_1787 200
6 3300005615 Ga0070702_100012703 Ga0070702_1000127031 201
7 3300025893 Ga0207682_10003021 Ga0207682_100030216 201
8 3300005328 Ga0070676_10382023 Ga0070676_103820231 208
9 3300005354 Ga0070675_100221278 Ga0070675_1002212782 208
10 3300005354 Ga0070675_100280223 Ga0070675_1002802232 208
11 3300005456 Ga0070678_100623804 Ga0070678_1006238041 208
12 3300005549 Ga0070704_100623268 Ga0070704_1006232681 208
13 3300005841 Ga0068863_100218008 Ga0068863_1002180082 208
14 3300006353 Ga0075370_10315244 Ga0075370_103152441 208
15 3300006871 Ga0075434_100367675 Ga0075434_1003676752 208
16 3300009148 Ga0105243_10699493 Ga0105243_106994931 208
17 3300009176 Ga0105242_10754276 Ga0105242_107542762 208
18 3300009177 Ga0105248_10663882 Ga0105248_106638821 208
19 3300013296 Ga0157374_10439171 Ga0157374_104391712 208
20 3300013297 Ga0157378_10522476 Ga0157378_105224762 208
21 3300013307 Ga0157372_10501884 Ga0157372_105018842 208
22 3300013308 Ga0157375_10590573 Ga0157375_105905732 208
23 3300017792 Ga0163161_10118584 Ga0163161_101185842 208
24 3300025907 Ga0207645_10083705 Ga0207645_100837052 208
25 3300025925 Ga0207650_10287506 Ga0207650_102875062 208
26 3300025941 Ga0207711_10504937 Ga0207711_105049371 208
27 3300025960 Ga0207651_10040441 Ga0207651_100404412 208
28 3300026089 Ga0207648_10097650 Ga0207648_100976503 208
29 3300026095 Ga0207676_10635180 Ga0207676_106351801 208
30 3300026121 Ga0207683_10640644 Ga0207683_106406441 208
31 3300028380 Ga0268265_10115036 Ga0268265_101150362 208
32 3300046683 Ga0495658_0106956 Ga0495658_0106956_745_1530 208
33 3300048924 Ga0496121_0000795 Ga0496121_0000795_11031_11816 208
34 3300048929 Ga0496126_0008797 Ga0496126_0008797_2278_3063 208
35 3300048929 Ga0496126_0093971 Ga0496126_0093971_1228_2004 208
36 3300048929 Ga0496126_0307144 Ga0496126_0307144_229_1008 208
37 3300050512 nmdc:mga0n895_764076_c1 nmdc:mga0n895_764076_c1_89_871 208
38 3300053125 Ga0500618_001640 Ga0500618_001640_7021_7827 208
39 3300005295 Ga0065707_10087312 Ga0065707_100873126 209
40 3300005329 Ga0070683_100492067 Ga0070683_1004920672 209
41 3300005330 Ga0070690_100002963 Ga0070690_1000029636 209
42 3300005331 Ga0070670_100241606 Ga0070670_1002416061 209
43 3300005334 Ga0068869_100009133 Ga0068869_1000091339 209
44 3300005336 Ga0070680_100000089 Ga0070680_10000008914 209
45 3300005337 Ga0070682_100007516 Ga0070682_1000075163 209
46 3300005338 Ga0068868_100003541 Ga0068868_10000354111 209
47 3300005340 Ga0070689_100010938 Ga0070689_1000109382 209
48 3300005340 Ga0070689_100064273 Ga0070689_1000642733 209
49 3300005341 Ga0070691_10009666 Ga0070691_100096664 209
50 3300005343 Ga0070687_100002470 Ga0070687_1000024703 209
51 3300005345 Ga0070692_10017000 Ga0070692_100170006 209
52 3300005355 Ga0070671_100226140 Ga0070671_1002261402 209
53 3300005364 Ga0070673_100016593 Ga0070673_1000165937 209
54 3300005365 Ga0070688_100147901 Ga0070688_1001479012 209
55 3300005367 Ga0070667_100200527 Ga0070667_1002005272 209
56 3300005434 Ga0070709_10012617 Ga0070709_100126175 209
57 3300005438 Ga0070701_10000224 Ga0070701_1000022415 209
58 3300005440 Ga0070705_100002532 Ga0070705_1000025329 209
59 3300005441 Ga0070700_100001299 Ga0070700_1000012998 209
60 3300005444 Ga0070694_100001971 Ga0070694_1000019718 209
61 3300005445 Ga0070708_100009280 Ga0070708_1000092806 209
62 3300005445 Ga0070708_100139945 Ga0070708_1001399452 209
63 3300005445 Ga0070708_100500183 Ga0070708_1005001832 209
64 3300005456 Ga0070678_100069427 Ga0070678_1000694273 209
65 3300005456 Ga0070678_100236880 Ga0070678_1002368802 209
66 3300005458 Ga0070681_10047645 Ga0070681_100476453 209
67 3300005459 Ga0068867_100005200 Ga0068867_1000052006 209
68 3300005530 Ga0070679_100068668 Ga0070679_1000686683 209
69 3300005530 Ga0070679_100268660 Ga0070679_1002686601 209
70 3300005536 Ga0070697_100006211 Ga0070697_10000621111 209
71 3300005544 Ga0070686_100002771 Ga0070686_1000027716 209
72 3300005545 Ga0070695_100000207 Ga0070695_1000002078 209
73 3300005546 Ga0070696_100000958 Ga0070696_1000009586 209
74 3300005546 Ga0070696_100016842 Ga0070696_1000168424 209
75 3300005547 Ga0070693_100001070 Ga0070693_1000010708 209
76 3300005549 Ga0070704_100008889 Ga0070704_1000088892 209
77 3300005563 Ga0068855_100014749 Ga0068855_1000147496 209
78 3300005615 Ga0070702_100000051 Ga0070702_1000000518 209
79 3300005617 Ga0068859_100008140 Ga0068859_1000081407 209
80 3300005618 Ga0068864_100008022 Ga0068864_1000080225 209
81 3300005718 Ga0068866_10000950 Ga0068866_100009509 209
82 3300005719 Ga0068861_100010391 Ga0068861_1000103912 209
83 3300005719 Ga0068861_100139266 Ga0068861_1001392662 209
84 3300005842 Ga0068858_100009709 Ga0068858_1000097094 209
85 3300005843 Ga0068860_100007869 Ga0068860_1000078699 209
86 3300005844 Ga0068862_100007285 Ga0068862_1000072856 209
87 3300005844 Ga0068862_100186786 Ga0068862_1001867862 209
88 3300005983 Ga0081540_1001281 Ga0081540_100128119 209
89 3300006028 Ga0070717_10317727 Ga0070717_103177272 209
90 3300006177 Ga0075362_10190436 Ga0075362_101904361 209
91 3300006237 Ga0097621_100002764 Ga0097621_1000027648 209
92 3300006358 Ga0068871_100007784 Ga0068871_1000077843 209
93 3300006844 Ga0075428_100000581 Ga0075428_10000058125 209
94 3300006844 Ga0075428_100005195 Ga0075428_1000051956 209
95 3300006847 Ga0075431_100305373 Ga0075431_1003053733 209
96 3300006880 Ga0075429_100000103 Ga0075429_10000010331 209
97 3300006880 Ga0075429_100011647 Ga0075429_1000116473 209
98 3300006881 Ga0068865_100000447 Ga0068865_10000044719 209
99 3300006914 Ga0075436_100129106 Ga0075436_1001291062 209
100 3300006931 Ga0097620_100008140 Ga0097620_1000081407 209
101 3300007265 Ga0099794_10125540 Ga0099794_101255402 209
102 3300009094 Ga0111539_10007241 Ga0111539_100072418 209
103 3300009094 Ga0111539_10031496 Ga0111539_100314968 209
104 3300009094 Ga0111539_10049570 Ga0111539_100495702 209
105 3300009094 Ga0111539_10057719 Ga0111539_100577192 209
106 3300009094 Ga0111539_10263739 Ga0111539_102637392 209
107 3300009098 Ga0105245_10004425 Ga0105245_100044259 209
108 3300009147 Ga0114129_10001184 Ga0114129_1000118415 209
109 3300009147 Ga0114129_10246446 Ga0114129_102464463 209
110 3300009148 Ga0105243_10003720 Ga0105243_100037208 209
111 3300009148 Ga0105243_10339070 Ga0105243_103390702 209
112 3300009174 Ga0105241_10013741 Ga0105241_100137413 209
113 3300009176 Ga0105242_10003302 Ga0105242_100033028 209
114 3300009177 Ga0105248_10019941 Ga0105248_100199412 209
115 3300009177 Ga0105248_10663870 Ga0105248_106638702 209
116 3300009553 Ga0105249_10000917 Ga0105249_1000091727 209
117 3300010375 Ga0105239_10008582 Ga0105239_100085828 209
118 3300013297 Ga0157378_10004581 Ga0157378_100045818 209
119 3300013306 Ga0163162_10184892 Ga0163162_101848923 209
120 3300013308 Ga0157375_10419339 Ga0157375_104193392 209
121 3300013308 Ga0157375_10639620 Ga0157375_106396202 209
122 3300014326 Ga0157380_10208628 Ga0157380_102086282 209
123 3300014326 Ga0157380_10355097 Ga0157380_103550972 209
124 3300014968 Ga0157379_10544827 Ga0157379_105448272 209
125 3300014969 Ga0157376_10004392 Ga0157376_100043928 209
126 3300025297 Ga0209758_1000362 Ga0209758_100036246 209
127 3300025315 Ga0207697_10019263 Ga0207697_100192633 209
128 3300025899 Ga0207642_10001134 Ga0207642_100011344 209
129 3300025908 Ga0207643_10427155 Ga0207643_104271551 209
130 3300025911 Ga0207654_10013963 Ga0207654_100139636 209
131 3300025917 Ga0207660_10008341 Ga0207660_100083416 209
132 3300025918 Ga0207662_10000215 Ga0207662_1000021514 209
133 3300025918 Ga0207662_10039341 Ga0207662_100393412 209
134 3300025918 Ga0207662_10377583 Ga0207662_103775831 209
135 3300025923 Ga0207681_10525245 Ga0207681_105252452 209
136 3300025924 Ga0207694_10408266 Ga0207694_104082662 209
137 3300025927 Ga0207687_10001049 Ga0207687_1000104914 209
138 3300025928 Ga0207700_10199934 Ga0207700_101999342 209
139 3300025933 Ga0207706_10211331 Ga0207706_102113312 209
140 3300025934 Ga0207686_10002720 Ga0207686_100027204 209
141 3300025935 Ga0207709_10003890 Ga0207709_100038902 209
142 3300025935 Ga0207709_10228406 Ga0207709_102284062 209
143 3300025936 Ga0207670_10002408 Ga0207670_100024089 209
144 3300025936 Ga0207670_10003744 Ga0207670_100037443 209
145 3300025938 Ga0207704_10001044 Ga0207704_100010448 209
146 3300025939 Ga0207665_10071496 Ga0207665_100714962 209
147 3300025941 Ga0207711_10058867 Ga0207711_100588672 209
148 3300025942 Ga0207689_10000007 Ga0207689_1000000720 209
149 3300025949 Ga0207667_10012993 Ga0207667_100129934 209
150 3300025960 Ga0207651_10009087 Ga0207651_100090877 209
151 3300025961 Ga0207712_10032651 Ga0207712_100326512 209
152 3300025981 Ga0207640_10010129 Ga0207640_100101293 209
153 3300025986 Ga0207658_10567291 Ga0207658_105672912 209
154 3300026023 Ga0207677_10002194 Ga0207677_100021945 209
155 3300026035 Ga0207703_10004921 Ga0207703_1000492111 209
156 3300026041 Ga0207639_10029407 Ga0207639_100294076 209
157 3300026075 Ga0207708_10001220 Ga0207708_1000122010 209
158 3300026075 Ga0207708_10192164 Ga0207708_101921642 209
159 3300026089 Ga0207648_10000135 Ga0207648_1000013563 209
160 3300026095 Ga0207676_10008772 Ga0207676_100087724 209
161 3300026118 Ga0207675_100000825 Ga0207675_10000082511 209
162 3300026118 Ga0207675_100177632 Ga0207675_1001776322 209
163 3300026121 Ga0207683_10022789 Ga0207683_100227893 209
164 3300027907 Ga0207428_10000265 Ga0207428_1000026545 209
165 3300027907 Ga0207428_10010533 Ga0207428_100105336 209
166 3300028380 Ga0268265_10003652 Ga0268265_1000365211 209
167 3300028380 Ga0268265_10272914 Ga0268265_102729143 209
168 3300028381 Ga0268264_10001495 Ga0268264_100014953 209
169 3300028381 Ga0268264_10305250 Ga0268264_103052502 209
170 3300034957 Ga0373938_0011679 Ga0373938_0011679_349_1134 209
171 3300035083 Ga0373926_0029879 Ga0373926_0029879_197_868 209
172 3300035084 Ga0373928_0006247 Ga0373928_0006247_877_1536 209
173 3300035085 Ga0373929_0006633 Ga0373929_0006633_1386_2045 209
174 3300035085 Ga0373929_0011649 Ga0373929_0011649_721_1506 209
175 3300035086 Ga0373934_0000044 Ga0373934_0000044_38873_39532 209
176 3300035089 Ga0373944_0003470 Ga0373944_0003470_611_1282 209
177 3300035089 Ga0373944_0020545 Ga0373944_0020545_55_714 209
178 3300035111 Ga0373923_0046930 Ga0373923_0046930_751_1410 209
179 3300035112 Ga0373932_0019906 Ga0373932_0019906_988_1647 209
180 3300035113 Ga0373936_0000601 Ga0373936_0000601_9815_10474 209
181 3300035113 Ga0373936_0019200 Ga0373936_0019200_153_824 209
182 3300035114 Ga0373939_0023657 Ga0373939_0023657_931_1590 209
183 3300035116 Ga0373945_0000490 Ga0373945_0000490_684_1355 209
184 3300035116 Ga0373945_0035109 Ga0373945_0035109_1033_1692 209
185 3300035117 Ga0373953_0003011 Ga0373953_0003011_3995_4654 209
186 3300035118 Ga0373954_0018088 Ga0373954_0018088_391_1050 209
187 3300035118 Ga0373954_0143501 Ga0373954_0143501_413_1072 209
188 3300035119 Ga0373956_0002849 Ga0373956_0002849_2716_3375 209
189 3300035120 Ga0373957_0001310 Ga0373957_0001310_2673_3332 209
190 3300035120 Ga0373957_0004446 Ga0373957_0004446_3344_4003 209
191 3300035121 Ga0373960_0003931 Ga0373960_0003931_625_1410 209
192 3300035170 Ga0373943_0186463 Ga0373943_0186463_120_791 209
193 3300035171 Ga0373946_0007524 Ga0373946_0007524_941_1612 209
194 3300035171 Ga0373946_0157178 Ga0373946_0157178_340_999 209
195 3300035172 Ga0373955_0000470 Ga0373955_0000470_3538_4197 209
196 3300035207 Ga0373942_0053737 Ga0373942_0053737_146_805 209
197 3300035241 Ga0373961_0043058 Ga0373961_0043058_300_959 209
198 3300035242 Ga0373962_0003002 Ga0373962_0003002_550_1209 209
199 3300035410 Ga0373924_0000643 Ga0373924_0000643_3314_3973 209
200 3300035691 Ga0373931_0001393 Ga0373931_0001393_2285_3070 209
201 3300035691 Ga0373931_0005783 Ga0373931_0005783_3654_4439 209
202 3300035691 Ga0373931_0026800 Ga0373931_0026800_1775_2434 209
203 3300035691 Ga0373931_0148187 Ga0373931_0148187_489_1148 209
204 3300035692 Ga0373935_0004736 Ga0373935_0004736_948_1607 209
205 3300035692 Ga0373935_0018543 Ga0373935_0018543_1780_2565 209
206 3300035692 Ga0373935_0058785 Ga0373935_0058785_1511_2182 209
207 3300035695 Ga0373927_0025024 Ga0373927_0025024_1429_2088 209
208 3300035695 Ga0373927_0297247 Ga0373927_0297247_78_749 209
209 3300035724 Ga0373933_0000107 Ga0373933_0000107_42140_42799 209
210 3300035725 Ga0373947_0026360 Ga0373947_0026360_2061_2732 209
211 3300035725 Ga0373947_0101274 Ga0373947_0101274_1054_1725 209
212 3300035725 Ga0373947_0496790 Ga0373947_0496790_183_815 209
213 3300036401 Ga0373937_0000810 Ga0373937_0000810_11167_11826 209
214 3300036401 Ga0373937_0008090 Ga0373937_0008090_5530_6189 209
215 3300036401 Ga0373937_0031763 Ga0373937_0031763_3848_4507 209
216 3300037068 Ga0373925_0019590 Ga0373925_0019590_2245_2916 209
217 3300037068 Ga0373925_0050873 Ga0373925_0050873_951_1610 209
218 3300042436 Ga0439435_0115465 Ga0439435_0115465_29_817 209
219 3300042876 Ga0451577_0102038 Ga0451577_0102038_426_1085 209
220 3300044712 Ga0453684_0150383 Ga0453684_0150383_656_1315 209
221 3300045051 Ga0451576_0006018 Ga0451576_0006018_1759_2418 209
222 3300045051 Ga0451576_0022710 Ga0451576_0022710_2983_3642 209
223 3300046454 Ga0495592_0071528 Ga0495592_0071528_1124_1783 209
224 3300046455 Ga0495603_0003474 Ga0495603_0003474_7830_8501 209
225 3300046459 Ga0495629_0269151 Ga0495629_0269151_410_1069 209
226 3300046461 Ga0495641_0003233 Ga0495641_0003233_10424_11083 209
227 3300046462 Ga0495651_0000105 Ga0495651_0000105_430_1089 209
228 3300046462 Ga0495651_0003319 Ga0495651_0003319_2083_2742 209
229 3300046463 Ga0495653_0012885 Ga0495653_0012885_511_1170 209
230 3300046472 Ga0495580_0003325 Ga0495580_0003325_12901_13572 209
231 3300046472 Ga0495580_0026172 Ga0495580_0026172_2076_2735 209
232 3300046473 Ga0495582_0067044 Ga0495582_0067044_1277_1948 209
233 3300046473 Ga0495582_0073525 Ga0495582_0073525_1018_1677 209
234 3300046475 Ga0495639_0018448 Ga0495639_0018448_1732_2391 209
235 3300046475 Ga0495639_0018888 Ga0495639_0018888_2072_2743 209
236 3300046476 Ga0495662_0023260 Ga0495662_0023260_423_1082 209
237 3300046511 Ga0495608_0053894 Ga0495608_0053894_1578_2237 209
238 3300046511 Ga0495608_0326134 Ga0495608_0326134_53_712 209
239 3300046516 Ga0495628_0011511 Ga0495628_0011511_677_1336 209
240 3300046516 Ga0495628_0015785 Ga0495628_0015785_2504_3163 209
241 3300046516 Ga0495628_0052061 Ga0495628_0052061_406_1191 209
242 3300046517 Ga0495630_0008055 Ga0495630_0008055_478_1137 209
243 3300046526 Ga0495666_0026179 Ga0495666_0026179_2060_2731 209
244 3300046526 Ga0495666_0028857 Ga0495666_0028857_366_1025 209
245 3300046529 Ga0495652_0040846 Ga0495652_0040846_365_1024 209
246 3300046531 Ga0495665_0065227 Ga0495665_0065227_177_848 209
247 3300046533 Ga0495640_0022913 Ga0495640_0022913_341_1000 209
248 3300046535 Ga0495586_0003781 Ga0495586_0003781_7255_7926 209
249 3300046535 Ga0495586_0015739 Ga0495586_0015739_746_1405 209
250 3300046535 Ga0495586_0041096 Ga0495586_0041096_167_826 209
251 3300046536 Ga0495587_0002310 Ga0495587_0002310_10128_10787 209
252 3300046543 Ga0495645_0452795 Ga0495645_0452795_112_765 209
253 3300046557 Ga0495622_0172375 Ga0495622_0172375_12_671 209
254 3300046559 Ga0495667_0004692 Ga0495667_0004692_1706_2365 209
255 3300046559 Ga0495667_0219862 Ga0495667_0219862_159_818 209
256 3300046559 Ga0495667_0472739 Ga0495667_0472739_69_728 209
257 3300046642 Ga0495634_0012863 Ga0495634_0012863_1837_2496 209
258 3300046674 Ga0495588_0035553 Ga0495588_0035553_803_1474 209
259 3300046675 Ga0495657_0002627 Ga0495657_0002627_3052_3711 209
260 3300046675 Ga0495657_0160678 Ga0495657_0160678_141_800 209
261 3300046678 Ga0495599_0081236 Ga0495599_0081236_603_1262 209
262 3300046681 Ga0495647_0000588 Ga0495647_0000588_8802_9461 209
263 3300046681 Ga0495647_0001106 Ga0495647_0001106_7394_8065 209
264 3300046683 Ga0495658_0002559 Ga0495658_0002559_2965_3636 209
265 3300046683 Ga0495658_0047992 Ga0495658_0047992_1237_1896 209
266 3300046683 Ga0495658_0283913 Ga0495658_0283913_242_1030 209
267 3300046684 Ga0495669_0132397 Ga0495669_0132397_514_1164 209
268 3300046689 Ga0495613_0006955 Ga0495613_0006955_6875_7534 209
269 3300046809 Ga0495600_0000689 Ga0495600_0000689_3195_3854 209
270 3300047315 Ga0495581_0135214 Ga0495581_0135214_422_1081 209
271 3300047317 Ga0495604_0130574 Ga0495604_0130574_746_1405 209
272 3300047319 Ga0495674_0000463 Ga0495674_0000463_23090_23749 209
273 3300047321 Ga0495676_0056302 Ga0495676_0056302_2387_3058 209
274 3300047322 Ga0495680_0027640 Ga0495680_0027640_3568_4227 209
275 3300047322 Ga0495680_0228162 Ga0495680_0228162_518_1300 209
276 3300047322 Ga0495680_0352169 Ga0495680_0352169_147_806 209
277 3300047471 Ga0495684_0001586 Ga0495684_0001586_1001_1660 209
278 3300048903 Ga0496100_0039048 Ga0496100_0039048_1951_2736 209
279 3300048904 Ga0496101_0054297 Ga0496101_0054297_92_877 209
280 3300048907 Ga0496104_0002475 Ga0496104_0002475_12998_13780 209
281 3300048907 Ga0496104_0015427 Ga0496104_0015427_440_1225 209
282 3300048908 Ga0496105_0011725 Ga0496105_0011725_4871_5653 209
283 3300048909 Ga0496106_0019897 Ga0496106_0019897_349_1131 209
284 3300048909 Ga0496106_0039984 Ga0496106_0039984_545_1330 209
285 3300048910 Ga0496107_0168039 Ga0496107_0168039_555_1337 209
286 3300048911 Ga0496108_0431193 Ga0496108_0431193_70_855 209
287 3300048913 Ga0496110_0039992 Ga0496110_0039992_1439_2221 209
288 3300048913 Ga0496110_0052896 Ga0496110_0052896_266_1051 209
289 3300048914 Ga0496111_0024775 Ga0496111_0024775_1380_2165 209
290 3300048915 Ga0496112_0039691 Ga0496112_0039691_1285_2070 209
291 3300048916 Ga0496113_0025103 Ga0496113_0025103_1310_2095 209
292 3300048917 Ga0496114_0011772 Ga0496114_0011772_2919_3704 209
293 3300048918 Ga0496115_0063377 Ga0496115_0063377_1787_2572 209
294 3300049824 Ga0501045_0028707 Ga0501045_0028707_224_976 209
295 3300050507 nmdc:mga05p37_202939_c1 nmdc:mga05p37_202939_c1_1341_2129 209
296 3300050507 nmdc:mga05p37_2836_c1 nmdc:mga05p37_2836_c1_3092_3751 209
297 3300050507 nmdc:mga05p37_376862_c1 nmdc:mga05p37_376862_c1_56_838 209
298 3300050508 nmdc:mga09592_20267_c1 nmdc:mga09592_20267_c1_3093_3752 209
299 3300050510 nmdc:mga06r32_64989_c1 nmdc:mga06r32_64989_c1_2650_3309 209
300 3300050511 nmdc:mga08y16_134231_c1 nmdc:mga08y16_134231_c1_1316_2104 209
301 3300050511 nmdc:mga08y16_393340_c1 nmdc:mga08y16_393340_c1_349_1131 209
302 3300050511 nmdc:mga08y16_5446_c1 nmdc:mga08y16_5446_c1_88_747 209
303 3300050511 nmdc:mga08y16_66966_c1 nmdc:mga08y16_66966_c1_1547_2191 209
304 3300050511 nmdc:mga08y16_71427_c1 nmdc:mga08y16_71427_c1_1930_2718 209
305 3300050512 nmdc:mga0n895_598346_c1 nmdc:mga0n895_598346_c1_20_679 209
306 3300050513 nmdc:mga0rr50_63304_c1 nmdc:mga0rr50_63304_c1_532_1314 209
307 3300050514 nmdc:mga08x19_150217_c1 nmdc:mga08x19_150217_c1_371_1030 209
308 3300050515 nmdc:mga0a205_343573_c1 nmdc:mga0a205_343573_c1_598_1347 209
309 3300053077 Ga0495601_0030790 Ga0495601_0030790_341_1126 209
310 3300053077 Ga0495601_0031662 Ga0495601_0031662_1825_2484 209
311 3300053077 Ga0495601_0298229 Ga0495601_0298229_166_819 209
312 3300053084 Ga0495595_0008104 Ga0495595_0008104_1459_2118 209
313 3300053085 Ga0495619_0054003 Ga0495619_0054003_1578_2237 209
314 3300053085 Ga0495619_0072995 Ga0495619_0072995_167_952 209
315 3300053094 Ga0500566_0296010 Ga0500566_0296010_50_709 209
316 3300005437 Ga0070710_10060017 Ga0070710_100600172 210
317 3300005458 Ga0070681_10101280 Ga0070681_101012802 210
318 3300005544 Ga0070686_100593523 Ga0070686_1005935232 210
319 3300005548 Ga0070665_100014355 Ga0070665_1000143554 210
320 3300005615 Ga0070702_100093597 Ga0070702_1000935972 210
321 3300005842 Ga0068858_100077059 Ga0068858_1000770593 210
322 3300006847 Ga0075431_100055871 Ga0075431_1000558715 210
323 3300006852 Ga0075433_10020868 Ga0075433_100208686 210
324 3300006852 Ga0075433_10146101 Ga0075433_101461013 210
325 3300006852 Ga0075433_10442513 Ga0075433_104425132 210
326 3300006871 Ga0075434_100000018 Ga0075434_10000001854 210
327 3300006880 Ga0075429_100057163 Ga0075429_1000571635 210
328 3300007076 Ga0075435_100001709 Ga0075435_1000017092 210
329 3300007076 Ga0075435_100097126 Ga0075435_1000971263 210
330 3300007265 Ga0099794_10036918 Ga0099794_100369182 210
331 3300009147 Ga0114129_10539249 Ga0114129_105392492 210
332 3300021384 Ga0213876_10224120 Ga0213876_102241201 210
333 3300021388 Ga0213875_10005102 Ga0213875_100051022 210
334 3300021441 Ga0213871_10078997 Ga0213871_100789972 210
335 3300025898 Ga0207692_10036807 Ga0207692_100368073 210
336 3300025905 Ga0207685_10097946 Ga0207685_100979461 210
337 3300025939 Ga0207665_10783916 Ga0207665_107839161 210
338 3300026035 Ga0207703_10071140 Ga0207703_100711403 210
339 3300026095 Ga0207676_10179642 Ga0207676_101796423 210
340 3300028379 Ga0268266_10058329 Ga0268266_100583292 210
341 3300033180 Ga0307510_10000002 Ga0307510_1000000257 210
342 3300034820 Ga0373959_0034008 Ga0373959_0034008_176_838 210
343 3300035092 Ga0373952_0020693 Ga0373952_0020693_143_805 210
344 3300035111 Ga0373923_0023030 Ga0373923_0023030_1453_2130 210
345 3300035118 Ga0373954_0000012 Ga0373954_0000012_26827_27504 210
346 3300035172 Ga0373955_0010226 Ga0373955_0010226_2789_3466 210
347 3300035172 Ga0373955_0087656 Ga0373955_0087656_769_1431 210
348 3300035410 Ga0373924_0001386 Ga0373924_0001386_1947_2609 210
349 3300035410 Ga0373924_0110164 Ga0373924_0110164_283_960 210
350 3300035724 Ga0373933_0001549 Ga0373933_0001549_4676_5353 210
351 3300035724 Ga0373933_0049886 Ga0373933_0049886_218_880 210
352 3300036401 Ga0373937_0002420 Ga0373937_0002420_6751_7428 210
353 3300039438 Ga0436360_0512522 Ga0436360_0512522_1139_1924 210
354 3300039447 Ga0436361_0295678 Ga0436361_0295678_723_1508 210
355 3300042436 Ga0439435_0066788 Ga0439435_0066788_215_1009 210
356 3300045051 Ga0451576_0287673 Ga0451576_0287673_25_687 210
357 3300045051 Ga0451576_0679266 Ga0451576_0679266_277_951 210
358 3300046535 Ga0495586_0082594 Ga0495586_0082594_919_1587 210
359 3300046675 Ga0495657_0122590 Ga0495657_0122590_600_1262 210
360 3300046690 Ga0495624_0098587 Ga0495624_0098587_49_717 210
361 3300047315 Ga0495581_0077946 Ga0495581_0077946_619_1287 210
362 3300047322 Ga0495680_0037275 Ga0495680_0037275_1319_1981 210
363 3300048929 Ga0496126_0263616 Ga0496126_0263616_535_1320 210
364 3300049571 Ga0501034_0185291 Ga0501034_0185291_54_839 210
365 3300049574 Ga0501038_0000994 Ga0501038_0000994_20872_21660 210
366 3300049575 Ga0501039_0012378 Ga0501039_0012378_3137_3925 210
367 3300049577 Ga0501041_0003756 Ga0501041_0003756_7763_8551 210
368 3300049578 Ga0501042_0029632 Ga0501042_0029632_1047_1835 210
369 3300049580 Ga0501046_0004336 Ga0501046_0004336_722_1510 210
370 3300049581 Ga0501047_0135821 Ga0501047_0135821_251_1039 210
371 3300049582 Ga0501048_0000293 Ga0501048_0000293_21878_22666 210
372 3300049584 Ga0501068_0033695 Ga0501068_0033695_2114_2902 210
373 3300049586 Ga0501070_0047758 Ga0501070_0047758_2613_3401 210
374 3300049587 Ga0501071_0018669 Ga0501071_0018669_3093_3881 210
375 3300049588 Ga0501072_0008621 Ga0501072_0008621_4955_5743 210
376 3300049590 Ga0501074_0112907 Ga0501074_0112907_958_1746 210
377 3300049593 Ga0501077_0012170 Ga0501077_0012170_1463_2251 210
378 3300049741 Ga0501079_0004238 Ga0501079_0004238_4396_5184 210
379 3300049741 Ga0501079_0116300 Ga0501079_0116300_838_1623 210
380 3300049743 Ga0501081_0023597 Ga0501081_0023597_2465_3253 210
381 3300049823 Ga0501044_0409718 Ga0501044_0409718_150_938 210
382 3300049824 Ga0501045_0004598 Ga0501045_0004598_8677_9465 210
383 3300050512 nmdc:mga0n895_42155_c1 nmdc:mga0n895_42155_c1_445_1230 210
384 3300050512 nmdc:mga0n895_44924_c1 nmdc:mga0n895_44924_c1_1107_1769 210
385 3300050512 nmdc:mga0n895_67805_c1 nmdc:mga0n895_67805_c1_2019_2687 210
386 3300050513 nmdc:mga0rr50_154_c1 nmdc:mga0rr50_154_c1_25758_26420 210
387 3300050513 nmdc:mga0rr50_31682_c1 nmdc:mga0rr50_31682_c1_1657_2442 210
388 3300050513 nmdc:mga0rr50_570391_c1 nmdc:mga0rr50_570391_c1_258_926 210
389 3300050514 nmdc:mga08x19_2283_c1 nmdc:mga08x19_2283_c1_1076_1738 210
390 3300050515 nmdc:mga0a205_242_c1 nmdc:mga0a205_242_c1_10206_10868 210
391 3300054114 Ga0501084_0117467 Ga0501084_0117467_727_1515 210
392 3300061734 Ga0530510_0002046 Ga0530510_0002046_5334_6122 210
393 3300005289 Ga0065704_10384339 Ga0065704_103843391 211
394 3300005290 Ga0065712_10077951 Ga0065712_100779513 211
395 3300005295 Ga0065707_10227721 Ga0065707_102277211 211
396 3300005328 Ga0070676_10046768 Ga0070676_100467682 211
397 3300005328 Ga0070676_10050513 Ga0070676_100505132 211
398 3300005329 Ga0070683_100001483 Ga0070683_10000148317 211
399 3300005330 Ga0070690_100359312 Ga0070690_1003593122 211
400 3300005331 Ga0070670_100039308 Ga0070670_1000393081 211
401 3300005331 Ga0070670_100053843 Ga0070670_1000538432 211
402 3300005331 Ga0070670_100223753 Ga0070670_1002237532 211
403 3300005334 Ga0068869_100000766 Ga0068869_1000007665 211
404 3300005335 Ga0070666_10244038 Ga0070666_102440381 211
405 3300005336 Ga0070680_100201961 Ga0070680_1002019612 211
406 3300005336 Ga0070680_100252193 Ga0070680_1002521931 211
407 3300005338 Ga0068868_100013652 Ga0068868_1000136524 211
408 3300005338 Ga0068868_100020533 Ga0068868_1000205333 211
409 3300005340 Ga0070689_100065686 Ga0070689_1000656863 211
410 3300005340 Ga0070689_100078877 Ga0070689_1000788772 211
411 3300005344 Ga0070661_100008287 Ga0070661_1000082875 211
412 3300005345 Ga0070692_10111567 Ga0070692_101115672 211
413 3300005347 Ga0070668_100029893 Ga0070668_1000298933 211
414 3300005353 Ga0070669_100008399 Ga0070669_1000083998 211
415 3300005354 Ga0070675_100002980 Ga0070675_1000029806 211
416 3300005354 Ga0070675_100045202 Ga0070675_1000452022 211
417 3300005354 Ga0070675_100110141 Ga0070675_1001101412 211
418 3300005355 Ga0070671_100004931 Ga0070671_1000049315 211
419 3300005355 Ga0070671_100180001 Ga0070671_1001800012 211
420 3300005356 Ga0070674_100046248 Ga0070674_1000462485 211
421 3300005356 Ga0070674_100059454 Ga0070674_1000594542 211
422 3300005364 Ga0070673_100004828 Ga0070673_1000048287 211
423 3300005364 Ga0070673_100039188 Ga0070673_1000391883 211
424 3300005364 Ga0070673_100088996 Ga0070673_1000889962 211
425 3300005364 Ga0070673_100154931 Ga0070673_1001549312 211
426 3300005365 Ga0070688_100271769 Ga0070688_1002717692 211
427 3300005367 Ga0070667_100005133 Ga0070667_1000051336 211
428 3300005441 Ga0070700_100004515 Ga0070700_1000045157 211
429 3300005444 Ga0070694_100042550 Ga0070694_1000425503 211
430 3300005444 Ga0070694_100531996 Ga0070694_1005319961 211
431 3300005455 Ga0070663_100082456 Ga0070663_1000824563 211
432 3300005456 Ga0070678_100013046 Ga0070678_1000130463 211
433 3300005457 Ga0070662_100040483 Ga0070662_1000404833 211
434 3300005458 Ga0070681_10437682 Ga0070681_104376822 211
435 3300005459 Ga0068867_100000933 Ga0068867_10000093318 211
436 3300005459 Ga0068867_100032581 Ga0068867_1000325814 211
437 3300005459 Ga0068867_100047763 Ga0068867_1000477633 211
438 3300005459 Ga0068867_100946011 Ga0068867_1009460111 211
439 3300005468 Ga0070707_100471161 Ga0070707_1004711612 211
440 3300005535 Ga0070684_100027121 Ga0070684_1000271214 211
441 3300005536 Ga0070697_100004993 Ga0070697_1000049935 211
442 3300005539 Ga0068853_100321106 Ga0068853_1003211062 211
443 3300005543 Ga0070672_100018753 Ga0070672_1000187534 211
444 3300005543 Ga0070672_100117048 Ga0070672_1001170482 211
445 3300005547 Ga0070693_100245616 Ga0070693_1002456162 211
446 3300005563 Ga0068855_100103065 Ga0068855_1001030652 211
447 3300005564 Ga0070664_100032286 Ga0070664_1000322861 211
448 3300005564 Ga0070664_100101414 Ga0070664_1001014142 211
449 3300005577 Ga0068857_100005938 Ga0068857_1000059382 211
450 3300005578 Ga0068854_100027072 Ga0068854_1000270722 211
451 3300005616 Ga0068852_100004249 Ga0068852_1000042497 211
452 3300005617 Ga0068859_100042548 Ga0068859_1000425483 211
453 3300005617 Ga0068859_100303364 Ga0068859_1003033642 211
454 3300005618 Ga0068864_100007594 Ga0068864_1000075943 211
455 3300005618 Ga0068864_100013279 Ga0068864_1000132794 211
456 3300005618 Ga0068864_100172212 Ga0068864_1001722122 211
457 3300005718 Ga0068866_10050302 Ga0068866_100503022 211
458 3300005718 Ga0068866_10051532 Ga0068866_100515323 211
459 3300005719 Ga0068861_100002773 Ga0068861_1000027735 211
460 3300005719 Ga0068861_100010443 Ga0068861_1000104433 211
461 3300005834 Ga0068851_10009210 Ga0068851_100092101 211
462 3300005840 Ga0068870_10015905 Ga0068870_100159053 211
463 3300005841 Ga0068863_100080391 Ga0068863_1000803913 211
464 3300005841 Ga0068863_100103506 Ga0068863_1001035062 211
465 3300005842 Ga0068858_100007174 Ga0068858_10000717411 211
466 3300005843 Ga0068860_100034055 Ga0068860_1000340553 211
467 3300005844 Ga0068862_100011831 Ga0068862_1000118314 211
468 3300005844 Ga0068862_100020835 Ga0068862_1000208354 211
469 3300006237 Ga0097621_100039421 Ga0097621_1000394214 211
470 3300006237 Ga0097621_100208450 Ga0097621_1002084502 211
471 3300006358 Ga0068871_100025039 Ga0068871_1000250392 211
472 3300006844 Ga0075428_100925434 Ga0075428_1009254341 211
473 3300006846 Ga0075430_100067598 Ga0075430_1000675984 211
474 3300006846 Ga0075430_100075920 Ga0075430_1000759203 211
475 3300006847 Ga0075431_100003369 Ga0075431_10000336911 211
476 3300006880 Ga0075429_100012874 Ga0075429_1000128744 211
477 3300006881 Ga0068865_100006240 Ga0068865_1000062407 211
478 3300006881 Ga0068865_100084014 Ga0068865_1000840143 211
479 3300006881 Ga0068865_100146278 Ga0068865_1001462782 211
480 3300006881 Ga0068865_100313452 Ga0068865_1003134522 211
481 3300006931 Ga0097620_100042551 Ga0097620_1000425513 211
482 3300006931 Ga0097620_100135675 Ga0097620_1001356752 211
483 3300006931 Ga0097620_100303354 Ga0097620_1003033542 211
484 3300009011 Ga0105251_10051926 Ga0105251_100519262 211
485 3300009094 Ga0111539_10055424 Ga0111539_100554245 211
486 3300009094 Ga0111539_10074774 Ga0111539_100747742 211
487 3300009094 Ga0111539_10258370 Ga0111539_102583702 211
488 3300009094 Ga0111539_10307426 Ga0111539_103074262 211
489 3300009098 Ga0105245_10082640 Ga0105245_100826403 211
490 3300009098 Ga0105245_10102208 Ga0105245_101022082 211
491 3300009101 Ga0105247_10146606 Ga0105247_101466062 211
492 3300009148 Ga0105243_10043914 Ga0105243_100439142 211
493 3300009176 Ga0105242_10597170 Ga0105242_105971702 211
494 3300009177 Ga0105248_10028790 Ga0105248_100287904 211
495 3300009177 Ga0105248_10060761 Ga0105248_100607614 211
496 3300009553 Ga0105249_10004574 Ga0105249_100045745 211
497 3300009553 Ga0105249_10092777 Ga0105249_100927772 211
498 3300009553 Ga0105249_10221190 Ga0105249_102211901 211
499 3300013104 Ga0157370_10176374 Ga0157370_101763742 211
500 3300013105 Ga0157369_10207902 Ga0157369_102079022 211
501 3300013296 Ga0157374_10019315 Ga0157374_100193156 211
502 3300013297 Ga0157378_10033107 Ga0157378_100331071 211
503 3300013297 Ga0157378_10038691 Ga0157378_100386913 211
504 3300013297 Ga0157378_10039028 Ga0157378_100390284 211
505 3300013306 Ga0163162_10030171 Ga0163162_100301715 211
506 3300013306 Ga0163162_10076028 Ga0163162_100760282 211
507 3300013308 Ga0157375_10015951 Ga0157375_100159517 211
508 3300013308 Ga0157375_10056999 Ga0157375_100569993 211
509 3300013308 Ga0157375_10259599 Ga0157375_102595992 211
510 3300013308 Ga0157375_10332824 Ga0157375_103328242 211
511 3300014326 Ga0157380_10014049 Ga0157380_100140497 211
512 3300014326 Ga0157380_10268051 Ga0157380_102680512 211
513 3300014968 Ga0157379_10005009 Ga0157379_100050092 211
514 3300014969 Ga0157376_10003398 Ga0157376_100033984 211
515 3300014969 Ga0157376_10005968 Ga0157376_100059688 211
516 3300025315 Ga0207697_10055368 Ga0207697_100553682 211
517 3300025893 Ga0207682_10074392 Ga0207682_100743922 211
518 3300025899 Ga0207642_10049559 Ga0207642_100495593 211
519 3300025899 Ga0207642_10078436 Ga0207642_100784362 211
520 3300025899 Ga0207642_10188381 Ga0207642_101883812 211
521 3300025907 Ga0207645_10062708 Ga0207645_100627082 211
522 3300025907 Ga0207645_10207559 Ga0207645_102075592 211
523 3300025908 Ga0207643_10006986 Ga0207643_100069867 211
524 3300025912 Ga0207707_10268490 Ga0207707_102684902 211
525 3300025918 Ga0207662_10065002 Ga0207662_100650023 211
526 3300025920 Ga0207649_10014627 Ga0207649_100146272 211
527 3300025920 Ga0207649_10380099 Ga0207649_103800991 211
528 3300025922 Ga0207646_10393884 Ga0207646_103938842 211
529 3300025922 Ga0207646_10488270 Ga0207646_104882702 211
530 3300025923 Ga0207681_10002427 Ga0207681_100024279 211
531 3300025923 Ga0207681_10126276 Ga0207681_101262762 211
532 3300025925 Ga0207650_10009035 Ga0207650_100090351 211
533 3300025925 Ga0207650_10038898 Ga0207650_100388983 211
534 3300025926 Ga0207659_10064900 Ga0207659_100649002 211
535 3300025927 Ga0207687_10042502 Ga0207687_100425023 211
536 3300025933 Ga0207706_10112282 Ga0207706_101122822 211
537 3300025934 Ga0207686_10425358 Ga0207686_104253582 211
538 3300025935 Ga0207709_10003995 Ga0207709_100039952 211
539 3300025936 Ga0207670_10019339 Ga0207670_100193395 211
540 3300025936 Ga0207670_10059051 Ga0207670_100590513 211
541 3300025936 Ga0207670_10410352 Ga0207670_104103522 211
542 3300025937 Ga0207669_10039565 Ga0207669_100395654 211
543 3300025937 Ga0207669_10068717 Ga0207669_100687172 211
544 3300025938 Ga0207704_10001267 Ga0207704_100012677 211
545 3300025938 Ga0207704_10118319 Ga0207704_101183192 211
546 3300025938 Ga0207704_10151695 Ga0207704_101516952 211
547 3300025940 Ga0207691_10004344 Ga0207691_100043448 211
548 3300025940 Ga0207691_10068861 Ga0207691_100688614 211
549 3300025940 Ga0207691_10141828 Ga0207691_101418282 211
550 3300025941 Ga0207711_10283498 Ga0207711_102834982 211
551 3300025942 Ga0207689_10001267 Ga0207689_1000126710 211
552 3300025944 Ga0207661_10002250 Ga0207661_100022506 211
553 3300025945 Ga0207679_10011613 Ga0207679_100116133 211
554 3300025945 Ga0207679_10133432 Ga0207679_101334322 211
555 3300025960 Ga0207651_10011744 Ga0207651_100117443 211
556 3300025960 Ga0207651_10056867 Ga0207651_100568673 211
557 3300025960 Ga0207651_10074117 Ga0207651_100741172 211
558 3300025961 Ga0207712_10006352 Ga0207712_100063527 211
559 3300025961 Ga0207712_10041924 Ga0207712_100419243 211
560 3300025981 Ga0207640_10025271 Ga0207640_100252713 211
561 3300026023 Ga0207677_10008899 Ga0207677_100088992 211
562 3300026035 Ga0207703_10005035 Ga0207703_100050359 211
563 3300026041 Ga0207639_10292976 Ga0207639_102929762 211
564 3300026075 Ga0207708_10014298 Ga0207708_100142983 211
565 3300026075 Ga0207708_10039912 Ga0207708_100399122 211
566 3300026088 Ga0207641_10029278 Ga0207641_100292786 211
567 3300026088 Ga0207641_10087012 Ga0207641_100870122 211
568 3300026089 Ga0207648_10002758 Ga0207648_1000275819 211
569 3300026089 Ga0207648_10007543 Ga0207648_100075432 211
570 3300026089 Ga0207648_10063238 Ga0207648_100632382 211
571 3300026089 Ga0207648_10928445 Ga0207648_109284452 211
572 3300026095 Ga0207676_10157379 Ga0207676_101573792 211
573 3300026095 Ga0207676_10158790 Ga0207676_101587902 211
574 3300026116 Ga0207674_10036389 Ga0207674_100363896 211
575 3300026118 Ga0207675_100002436 Ga0207675_10000243615 211
576 3300026118 Ga0207675_100019002 Ga0207675_1000190025 211
577 3300026121 Ga0207683_10001605 Ga0207683_1000160516 211
578 3300026142 Ga0207698_10009224 Ga0207698_100092244 211
579 3300027462 Ga0210000_1006284 Ga0210000_10062842 211
580 3300027471 Ga0209995_1003052 Ga0209995_10030524 211
581 3300027665 Ga0209983_1004825 Ga0209983_10048252 211
582 3300027876 Ga0209974_10020791 Ga0209974_100207913 211
583 3300027907 Ga0207428_10216925 Ga0207428_102169252 211
584 3300028379 Ga0268266_10212260 Ga0268266_102122602 211
585 3300028380 Ga0268265_10001812 Ga0268265_100018125 211
586 3300028380 Ga0268265_10081646 Ga0268265_100816462 211
587 3300028380 Ga0268265_10092160 Ga0268265_100921603 211
588 3300028381 Ga0268264_10018097 Ga0268264_100180972 211
589 3300028577 Ga0265318_10007463 Ga0265318_100074633 211
590 3300031235 Ga0265330_10005907 Ga0265330_100059073 211
591 3300031238 Ga0265332_10012748 Ga0265332_100127484 211
592 3300031240 Ga0265320_10045606 Ga0265320_100456062 211
593 3300031344 Ga0265316_10029413 Ga0265316_100294132 211
594 3300031711 Ga0265314_10003722 Ga0265314_1000372212 211
595 3300031911 Ga0307412_10280111 Ga0307412_102801111 211
596 3300032002 Ga0307416_100108630 Ga0307416_1001086302 211
597 3300035092 Ga0373952_0063544 Ga0373952_0063544_178_852 211
598 3300046528 Ga0495642_0253927 Ga0495642_0253927_14_754 211
599 3300046684 Ga0495669_0074223 Ga0495669_0074223_898_1533 211
600 3300048905 Ga0496102_0165138 Ga0496102_0165138_943_1776 211
601 3300048906 Ga0496103_0152173 Ga0496103_0152173_378_1187 211
602 3300048911 Ga0496108_0009808 Ga0496108_0009808_1625_2413 211
603 3300048911 Ga0496108_0134102 Ga0496108_0134102_744_1577 211
604 3300048917 Ga0496114_0200860 Ga0496114_0200860_257_1045 211
605 3300049514 Ga0501291_043531 Ga0501291_043531_112_762 211
606 3300049572 Ga0501036_0229446 Ga0501036_0229446_382_1170 211
607 3300049573 Ga0501037_0003806 Ga0501037_0003806_8333_9121 211
608 3300049575 Ga0501039_0003932 Ga0501039_0003932_2799_3587 211
609 3300049576 Ga0501040_0030971 Ga0501040_0030971_2060_2848 211
610 3300049577 Ga0501041_0004135 Ga0501041_0004135_5661_6449 211
611 3300049578 Ga0501042_0006414 Ga0501042_0006414_5494_6282 211
612 3300049579 Ga0501043_0010120 Ga0501043_0010120_2391_3179 211
613 3300049584 Ga0501068_0244525 Ga0501068_0244525_264_1052 211
614 3300049587 Ga0501071_0024763 Ga0501071_0024763_2888_3676 211
615 3300049588 Ga0501072_0067258 Ga0501072_0067258_1727_2515 211
616 3300049588 Ga0501072_0302661 Ga0501072_0302661_464_1249 211
617 3300049591 Ga0501075_0002497 Ga0501075_0002497_9256_10044 211
618 3300049592 Ga0501076_0002131 Ga0501076_0002131_1126_1914 211
619 3300049741 Ga0501079_0008832 Ga0501079_0008832_2580_3368 211
620 3300049742 Ga0501080_0018160 Ga0501080_0018160_244_1032 211
621 3300049743 Ga0501081_0000696 Ga0501081_0000696_2750_3538 211
622 3300049824 Ga0501045_0012797 Ga0501045_0012797_4027_4815 211
623 3300050508 nmdc:mga09592_12321_c1 nmdc:mga09592_12321_c1_1175_1963 211
624 3300050509 nmdc:mga0qj67_161179_c1 nmdc:mga0qj67_161179_c1_156_944 211
625 3300050511 nmdc:mga08y16_124999_c1 nmdc:mga08y16_124999_c1_1339_2013 211
626 3300050511 nmdc:mga08y16_141826_c1 nmdc:mga08y16_141826_c1_410_1060 211
627 3300050511 nmdc:mga08y16_35981_c1 nmdc:mga08y16_35981_c1_1738_2526 211
628 3300054114 Ga0501084_0018451 Ga0501084_0018451_329_1117 211
629 3300059421 Ga0590071_026700 Ga0590071_026700_164_952 211
630 3300060353 Ga0501082_0000754 Ga0501082_0000754_2645_3433 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10370

Rv2993c-like_N

Rv2993c-like, N-terminal

9

58

1

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

63

267

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pfz-assembly1.cif.gz_A x-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis 0.9459 2 209
3qdf-assembly1.cif.gz_A crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum 0.9454 2 211
1wzo-assembly1.cif.gz_A crystal structure of the hpce from thermus thermophilus hb8 0.9438 2 210
6jvv-assembly1.cif.gz_A crystal structure of maleylpyruvate hydrolase from sphingobium.sp syk-6 0.9376 2 209
1wzo-assembly1.cif.gz_C crystal structure of the hpce from thermus thermophilus hb8 0.9308 2 209
ID Description Score Start End Superfamily
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9382 2 209 3.90.850.10
6jvvA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9376 2 209 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9243 2 209 3.90.850.10
6jvvA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9182 2 209 3.90.850.10
af_Q54BF3_56_305_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9066 2 206 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A2E2V841-F1-model_v4 2-keto-4-pentenoate hydratase 0.9851 29 210 GO:0003824
GO:0044281
AF-A0A2D9STH8-F1-model_v4 2-keto-4-pentenoate hydratase 0.984 2 211 GO:0003824
GO:0044281
AF-A0A7C7P346-F1-model_v4 DUF2437 domain-containing protein 0.982 2 177 GO:0003824
GO:0044281
AF-A0A2E2V841-F1-model_v4 2-keto-4-pentenoate hydratase 0.9797 29 210 GO:0003824
GO:0044281
AF-A0A536WUQ4-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9761 2 211 GO:0016787
GO:0044281

Feature Viewer

pLDDT pTM Quality
94.86 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map