F470817
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 630 | 312 | 630 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10082640|Ga0105245_100826403 |
| Length | 277 |
| Sequence | MVREGTEAMKWCRVEAPDGASYAELDGEHVELLDAAPFADCRRTGRRYRLDEMKLLPPVIPANFYAAGLNFGSHVEWAKQYHGMTHLKIPDQADIGYRSPSALIGSGADIVVPLDSSGPVEYEGELVAIIGRRAKYLAENDALECVAGYTLGNDLSERAWQKSDRTLWRAKNCDTFKPMGPVVVSGIDPMAQTIGVRINGKTVSEYSTSAMLFSVAHWVSRISRYTTLYPGDVLWLGCDGVTIPALQPGDLVEVVNDAIGVLANRVVRETEQREQLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 173 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 174 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 175 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 176 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 178 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 254 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 255 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 256 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 257 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.79 |
| Nodule | 0 |
| Rhizoplane | 3.33 |
| Rhizosphere | 94.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10384339 | 3300005289 | Bacteria | 762 |
| 2 | Ga0065712_10077951 | 3300005290 | Bacteria | 3421 |
| 3 | Ga0065707_10087312 | 3300005295 | Bacteria | 5069 |
| 4 | Ga0065707_10227721 | 3300005295 | Bacteria | 1200 |
| 5 | Ga0070676_10046768 | 3300005328 | Bacteria | 2525 |
| 6 | Ga0070676_10050513 | 3300005328 | Unclassified | 2438 |
| 7 | Ga0070676_10382023 | 3300005328 | Bacteria | 975 |
| 8 | Ga0070683_100001483 | 3300005329 | Bacteria | 18089 |
| 9 | Ga0070683_100492067 | 3300005329 | Unclassified | 1171 |
| 10 | Ga0070690_100002963 | 3300005330 | Bacteria | 9182 |
| 11 | Ga0070690_100359312 | 3300005330 | Unclassified | 1059 |
| 12 | Ga0070670_100039308 | 3300005331 | Bacteria | 4068 |
| 13 | Ga0070670_100053843 | 3300005331 | Bacteria | 3455 |
| 14 | Ga0070670_100223753 | 3300005331 | Bacteria | 1637 |
| 15 | Ga0070670_100241606 | 3300005331 | Bacteria | 1572 |
| 16 | Ga0068869_100000766 | 3300005334 | Bacteria | 18276 |
| 17 | Ga0068869_100009133 | 3300005334 | Bacteria | 6424 |
| 18 | Ga0070666_10244038 | 3300005335 | Bacteria | 1270 |
| 19 | Ga0070680_100000089 | 3300005336 | Bacteria | 51222 |
| 20 | Ga0070680_100201961 | 3300005336 | Bacteria | 1677 |
| 21 | Ga0070680_100252193 | 3300005336 | Bacteria | 1492 |
| 22 | Ga0070682_100007516 | 3300005337 | Bacteria | 6143 |
| 23 | Ga0068868_100003541 | 3300005338 | Bacteria | 10883 |
| 24 | Ga0068868_100013652 | 3300005338 | Bacteria | 5965 |
| 25 | Ga0068868_100020533 | 3300005338 | Bacteria | 4966 |
| 26 | Ga0070689_100010938 | 3300005340 | Bacteria | 6485 |
| 27 | Ga0070689_100064273 | 3300005340 | Bacteria | 2856 |
| 28 | Ga0070689_100065686 | 3300005340 | Bacteria | 2826 |
| 29 | Ga0070689_100078877 | 3300005340 | Bacteria | 2582 |
| 30 | Ga0070691_10009666 | 3300005341 | Bacteria | 4401 |
| 31 | Ga0070687_100002470 | 3300005343 | Bacteria | 6949 |
| 32 | Ga0070661_100008287 | 3300005344 | Bacteria | 7176 |
| 33 | Ga0070692_10017000 | 3300005345 | Bacteria | 3470 |
| 34 | Ga0070692_10111567 | 3300005345 | Bacteria | 1513 |
| 35 | Ga0070668_100029893 | 3300005347 | Bacteria | 4139 |
| 36 | Ga0070669_100008399 | 3300005353 | Bacteria | 7369 |
| 37 | Ga0070675_100002980 | 3300005354 | Bacteria | 12787 |
| 38 | Ga0070675_100045202 | 3300005354 | Bacteria | 3603 |
| 39 | Ga0070675_100110141 | 3300005354 | Bacteria | 2328 |
| 40 | Ga0070675_100221278 | 3300005354 | Bacteria | 1648 |
| 41 | Ga0070675_100280223 | 3300005354 | Bacteria | 1465 |
| 42 | Ga0070671_100004931 | 3300005355 | Bacteria | 10616 |
| 43 | Ga0070671_100180001 | 3300005355 | Bacteria | 1789 |
| 44 | Ga0070671_100226140 | 3300005355 | Bacteria | 1588 |
| 45 | Ga0070674_100046248 | 3300005356 | Bacteria | 2976 |
| 46 | Ga0070674_100059454 | 3300005356 | Bacteria | 2661 |
| 47 | Ga0070673_100004828 | 3300005364 | Bacteria | 8572 |
| 48 | Ga0070673_100016593 | 3300005364 | Bacteria | 5212 |
| 49 | Ga0070673_100039188 | 3300005364 | Bacteria | 3624 |
| 50 | Ga0070673_100088996 | 3300005364 | Bacteria | 2519 |
| 51 | Ga0070673_100154931 | 3300005364 | Bacteria | 1944 |
| 52 | Ga0070688_100147901 | 3300005365 | Bacteria | 1603 |
| 53 | Ga0070688_100271769 | 3300005365 | Bacteria | 1214 |
| 54 | Ga0070667_100005133 | 3300005367 | Bacteria | 10962 |
| 55 | Ga0070667_100200527 | 3300005367 | Bacteria | 1770 |
| 56 | Ga0070709_10012617 | 3300005434 | Bacteria | 4733 |
| 57 | Ga0070710_10060017 | 3300005437 | Bacteria | 2162 |
| 58 | Ga0070701_10000224 | 3300005438 | Bacteria | 17823 |
| 59 | Ga0070705_100002532 | 3300005440 | Bacteria | 9182 |
| 60 | Ga0070700_100001299 | 3300005441 | Bacteria | 12426 |
| 61 | Ga0070700_100004515 | 3300005441 | Bacteria | 7277 |
| 62 | Ga0070694_100001971 | 3300005444 | Bacteria | 12174 |
| 63 | Ga0070694_100042550 | 3300005444 | Bacteria | 3035 |
| 64 | Ga0070694_100531996 | 3300005444 | Bacteria | 939 |
| 65 | Ga0070708_100009280 | 3300005445 | Bacteria | 7928 |
| 66 | Ga0070708_100139945 | 3300005445 | Bacteria | 2244 |
| 67 | Ga0070708_100500183 | 3300005445 | Bacteria | 1147 |
| 68 | Ga0070663_100082456 | 3300005455 | Bacteria | 2366 |
| 69 | Ga0070678_100013046 | 3300005456 | Bacteria | 5193 |
| 70 | Ga0070678_100069427 | 3300005456 | Bacteria | 2631 |
| 71 | Ga0070678_100236880 | 3300005456 | Bacteria | 1524 |
| 72 | Ga0070678_100623804 | 3300005456 | Bacteria | 965 |
| 73 | Ga0070662_100040483 | 3300005457 | Unclassified | 3318 |
| 74 | Ga0070681_10047645 | 3300005458 | Bacteria | 4285 |
| 75 | Ga0070681_10101280 | 3300005458 | Bacteria | 2826 |
| 76 | Ga0070681_10437682 | 3300005458 | Unclassified | 1219 |
| 77 | Ga0068867_100000933 | 3300005459 | Bacteria | 19900 |
| 78 | Ga0068867_100005200 | 3300005459 | Bacteria | 9182 |
| 79 | Ga0068867_100032581 | 3300005459 | Unclassified | 3770 |
| 80 | Ga0068867_100047763 | 3300005459 | Bacteria | 3147 |
| 81 | Ga0068867_100946011 | 3300005459 | Bacteria | 778 |
| 82 | Ga0070707_100471161 | 3300005468 | Bacteria | 1217 |
| 83 | Ga0070679_100068668 | 3300005530 | Bacteria | 3535 |
| 84 | Ga0070679_100268660 | 3300005530 | Bacteria | 1660 |
| 85 | Ga0070684_100027121 | 3300005535 | Bacteria | 4832 |
| 86 | Ga0070697_100004993 | 3300005536 | Bacteria | 10186 |
| 87 | Ga0070697_100006211 | 3300005536 | Bacteria | 9246 |
| 88 | Ga0068853_100321106 | 3300005539 | Bacteria | 1435 |
| 89 | Ga0070672_100018753 | 3300005543 | Bacteria | 5010 |
| 90 | Ga0070672_100117048 | 3300005543 | Bacteria | 2178 |
| 91 | Ga0070686_100002771 | 3300005544 | Bacteria | 9649 |
| 92 | Ga0070686_100593523 | 3300005544 | Bacteria | 872 |
| 93 | Ga0070695_100000207 | 3300005545 | Bacteria | 28678 |
| 94 | Ga0070696_100000958 | 3300005546 | Bacteria | 18702 |
| 95 | Ga0070696_100016842 | 3300005546 | Bacteria | 4930 |
| 96 | Ga0070693_100001070 | 3300005547 | Bacteria | 12237 |
| 97 | Ga0070693_100245616 | 3300005547 | Unclassified | 1184 |
| 98 | Ga0070665_100014355 | 3300005548 | Bacteria | 7952 |
| 99 | Ga0070704_100008889 | 3300005549 | Bacteria | 6047 |
| 100 | Ga0070704_100623268 | 3300005549 | Bacteria | 950 |
| 101 | Ga0068855_100014749 | 3300005563 | Bacteria | 9416 |
| 102 | Ga0068855_100103065 | 3300005563 | Bacteria | 3284 |
| 103 | Ga0070664_100032286 | 3300005564 | Bacteria | 4379 |
| 104 | Ga0070664_100101414 | 3300005564 | Bacteria | 2503 |
| 105 | Ga0068857_100005938 | 3300005577 | Bacteria | 10426 |
| 106 | Ga0068854_100027072 | 3300005578 | Unclassified | 3948 |
| 107 | Ga0070702_100000051 | 3300005615 | Bacteria | 32802 |
| 108 | Ga0070702_100012703 | 3300005615 | Bacteria | 4232 |
| 109 | Ga0070702_100093597 | 3300005615 | Bacteria | 1828 |
| 110 | Ga0068852_100004249 | 3300005616 | Bacteria | 10115 |
| 111 | Ga0068859_100008140 | 3300005617 | Bacteria | 10631 |
| 112 | Ga0068859_100042548 | 3300005617 | Bacteria | 4563 |
| 113 | Ga0068859_100303364 | 3300005617 | Bacteria | 1690 |
| 114 | Ga0068864_100007594 | 3300005618 | Bacteria | 8932 |
| 115 | Ga0068864_100008022 | 3300005618 | Bacteria | 8711 |
| 116 | Ga0068864_100013279 | 3300005618 | Bacteria | 6822 |
| 117 | Ga0068864_100172212 | 3300005618 | Bacteria | 1974 |
| 118 | Ga0068866_10000950 | 3300005718 | Bacteria | 12744 |
| 119 | Ga0068866_10050302 | 3300005718 | Bacteria | 2116 |
| 120 | Ga0068866_10051532 | 3300005718 | Bacteria | 2096 |
| 121 | Ga0068861_100002773 | 3300005719 | Bacteria | 11497 |
| 122 | Ga0068861_100010391 | 3300005719 | Bacteria | 6458 |
| 123 | Ga0068861_100010443 | 3300005719 | Bacteria | 6445 |
| 124 | Ga0068861_100139266 | 3300005719 | Bacteria | 1979 |
| 125 | Ga0068851_10009210 | 3300005834 | Bacteria | 4583 |
| 126 | Ga0068870_10015905 | 3300005840 | Bacteria | 3582 |
| 127 | Ga0068863_100080391 | 3300005841 | Bacteria | 3087 |
| 128 | Ga0068863_100103506 | 3300005841 | Bacteria | 2708 |
| 129 | Ga0068863_100218008 | 3300005841 | Bacteria | 1838 |
| 130 | Ga0068858_100007174 | 3300005842 | Bacteria | 10810 |
| 131 | Ga0068858_100009709 | 3300005842 | Bacteria | 9166 |
| 132 | Ga0068858_100077059 | 3300005842 | Bacteria | 3097 |
| 133 | Ga0068860_100007869 | 3300005843 | Bacteria | 10641 |
| 134 | Ga0068860_100034055 | 3300005843 | Bacteria | 4885 |
| 135 | Ga0068862_100007285 | 3300005844 | Bacteria | 9182 |
| 136 | Ga0068862_100011831 | 3300005844 | Bacteria | 7206 |
| 137 | Ga0068862_100020835 | 3300005844 | Bacteria | 5477 |
| 138 | Ga0068862_100186786 | 3300005844 | Bacteria | 1863 |
| 139 | Ga0081540_1001281 | 3300005983 | Bacteria | 21930 |
| 140 | Ga0070717_10317727 | 3300006028 | Bacteria | 1387 |
| 141 | Ga0075362_10190436 | 3300006177 | Bacteria | 996 |
| 142 | Ga0097621_100002764 | 3300006237 | Bacteria | 12002 |
| 143 | Ga0097621_100039421 | 3300006237 | Bacteria | 3794 |
| 144 | Ga0097621_100208450 | 3300006237 | Bacteria | 1699 |
| 145 | Ga0075370_10315244 | 3300006353 | Bacteria | 931 |
| 146 | Ga0068871_100007784 | 3300006358 | Bacteria | 7671 |
| 147 | Ga0068871_100025039 | 3300006358 | Bacteria | 4637 |
| 148 | Ga0075428_100000581 | 3300006844 | Bacteria | 37409 |
| 149 | Ga0075428_100005195 | 3300006844 | Bacteria | 14462 |
| 150 | Ga0075428_100925434 | 3300006844 | Unclassified | 924 |
| 151 | Ga0075430_100067598 | 3300006846 | Bacteria | 3000 |
| 152 | Ga0075430_100075920 | 3300006846 | Bacteria | 2817 |
| 153 | Ga0075431_100003369 | 3300006847 | Bacteria | 15494 |
| 154 | Ga0075431_100055871 | 3300006847 | Bacteria | 4073 |
| 155 | Ga0075431_100305373 | 3300006847 | Bacteria | 1607 |
| 156 | Ga0075433_10020868 | 3300006852 | Bacteria | 5484 |
| 157 | Ga0075433_10146101 | 3300006852 | Bacteria | 2102 |
| 158 | Ga0075433_10442513 | 3300006852 | Bacteria | 1146 |
| 159 | Ga0075434_100000018 | 3300006871 | Bacteria | 73715 |
| 160 | Ga0075434_100367675 | 3300006871 | Bacteria | 1459 |
| 161 | Ga0075429_100000103 | 3300006880 | Bacteria | 47421 |
| 162 | Ga0075429_100011647 | 3300006880 | Bacteria | 7627 |
| 163 | Ga0075429_100012874 | 3300006880 | Bacteria | 7257 |
| 164 | Ga0075429_100057163 | 3300006880 | Bacteria | 3396 |
| 165 | Ga0068865_100000447 | 3300006881 | Bacteria | 22945 |
| 166 | Ga0068865_100006240 | 3300006881 | Bacteria | 7258 |
| 167 | Ga0068865_100084014 | 3300006881 | Bacteria | 2293 |
| 168 | Ga0068865_100146278 | 3300006881 | Bacteria | 1788 |
| 169 | Ga0068865_100313452 | 3300006881 | Unclassified | 1259 |
| 170 | Ga0075436_100129106 | 3300006914 | Bacteria | 1772 |
| 171 | Ga0097620_100008140 | 3300006931 | Bacteria | 10631 |
| 172 | Ga0097620_100042551 | 3300006931 | Bacteria | 4563 |
| 173 | Ga0097620_100135675 | 3300006931 | Bacteria | 2534 |
| 174 | Ga0097620_100303354 | 3300006931 | Bacteria | 1690 |
| 175 | Ga0075435_100001709 | 3300007076 | Bacteria | 14257 |
| 176 | Ga0075435_100097126 | 3300007076 | Bacteria | 2437 |
| 177 | Ga0099794_10036918 | 3300007265 | Bacteria | 2312 |
| 178 | Ga0099794_10125540 | 3300007265 | Bacteria | 1294 |
| 179 | Ga0105251_10051926 | 3300009011 | Unclassified | 1954 |
| 180 | Ga0111539_10007241 | 3300009094 | Bacteria | 14214 |
| 181 | Ga0111539_10031496 | 3300009094 | Bacteria | 6442 |
| 182 | Ga0111539_10049570 | 3300009094 | Bacteria | 5006 |
| 183 | Ga0111539_10055424 | 3300009094 | Bacteria | 4712 |
| 184 | Ga0111539_10057719 | 3300009094 | Bacteria | 4608 |
| 185 | Ga0111539_10074774 | 3300009094 | Bacteria | 3992 |
| 186 | Ga0111539_10258370 | 3300009094 | Bacteria | 2028 |
| 187 | Ga0111539_10263739 | 3300009094 | Bacteria | 2005 |
| 188 | Ga0111539_10307426 | 3300009094 | Bacteria | 1845 |
| 189 | Ga0111539_11129526 | 3300009094 | Bacteria | 910 |
| 190 | Ga0105245_10004425 | 3300009098 | Bacteria | 12431 |
| 191 | Ga0105245_10082640 | 3300009098 | Bacteria | 2939 |
| 192 | Ga0105245_10102208 | 3300009098 | Bacteria | 2654 |
| 193 | Ga0105247_10146606 | 3300009101 | Bacteria | 1552 |
| 194 | Ga0114129_10001184 | 3300009147 | Bacteria | 34627 |
| 195 | Ga0114129_10246446 | 3300009147 | Bacteria | 2400 |
| 196 | Ga0114129_10539249 | 3300009147 | Bacteria | 1519 |
| 197 | Ga0105243_10003720 | 3300009148 | Bacteria | 12240 |
| 198 | Ga0105243_10043914 | 3300009148 | Bacteria | 3504 |
| 199 | Ga0105243_10339070 | 3300009148 | Bacteria | 1376 |
| 200 | Ga0105243_10699493 | 3300009148 | Bacteria | 988 |
| 201 | Ga0105241_10013741 | 3300009174 | Bacteria | 5931 |
| 202 | Ga0105242_10003302 | 3300009176 | Bacteria | 12562 |
| 203 | Ga0105242_10597170 | 3300009176 | Bacteria | 1066 |
| 204 | Ga0105242_10754276 | 3300009176 | Bacteria | 958 |
| 205 | Ga0105248_10019941 | 3300009177 | Bacteria | 7423 |
| 206 | Ga0105248_10028790 | 3300009177 | Bacteria | 6192 |
| 207 | Ga0105248_10060761 | 3300009177 | Bacteria | 4242 |
| 208 | Ga0105248_10663870 | 3300009177 | Bacteria | 1176 |
| 209 | Ga0105248_10663882 | 3300009177 | Bacteria | 1176 |
| 210 | Ga0105249_10000917 | 3300009553 | Bacteria | 26070 |
| 211 | Ga0105249_10004574 | 3300009553 | Bacteria | 11954 |
| 212 | Ga0105249_10092777 | 3300009553 | Bacteria | 2827 |
| 213 | Ga0105249_10221190 | 3300009553 | Bacteria | 1863 |
| 214 | Ga0105239_10008582 | 3300010375 | Bacteria | 11592 |
| 215 | Ga0157370_10176374 | 3300013104 | Unclassified | 1986 |
| 216 | Ga0157369_10207902 | 3300013105 | Unclassified | 2052 |
| 217 | Ga0157374_10019315 | 3300013296 | Bacteria | 6030 |
| 218 | Ga0157374_10439171 | 3300013296 | Bacteria | 1305 |
| 219 | Ga0157378_10004581 | 3300013297 | Bacteria | 12120 |
| 220 | Ga0157378_10033107 | 3300013297 | Bacteria | 4568 |
| 221 | Ga0157378_10038691 | 3300013297 | Unclassified | 4228 |
| 222 | Ga0157378_10039028 | 3300013297 | Bacteria | 4210 |
| 223 | Ga0157378_10522476 | 3300013297 | Bacteria | 1189 |
| 224 | Ga0163162_10030171 | 3300013306 | Bacteria | 5372 |
| 225 | Ga0163162_10076028 | 3300013306 | Bacteria | 3419 |
| 226 | Ga0163162_10184892 | 3300013306 | Bacteria | 2211 |
| 227 | Ga0157372_10501884 | 3300013307 | Bacteria | 1415 |
| 228 | Ga0157375_10015951 | 3300013308 | Bacteria | 6738 |
| 229 | Ga0157375_10056999 | 3300013308 | Bacteria | 3860 |
| 230 | Ga0157375_10259599 | 3300013308 | Bacteria | 1899 |
| 231 | Ga0157375_10332824 | 3300013308 | Bacteria | 1683 |
| 232 | Ga0157375_10419339 | 3300013308 | Bacteria | 1504 |
| 233 | Ga0157375_10590573 | 3300013308 | Bacteria | 1270 |
| 234 | Ga0157375_10639620 | 3300013308 | Bacteria | 1220 |
| 235 | Ga0157380_10014049 | 3300014326 | Bacteria | 5850 |
| 236 | Ga0157380_10208628 | 3300014326 | Bacteria | 1739 |
| 237 | Ga0157380_10268051 | 3300014326 | Bacteria | 1555 |
| 238 | Ga0157380_10355097 | 3300014326 | Bacteria | 1373 |
| 239 | Ga0157379_10005009 | 3300014968 | Bacteria | 11367 |
| 240 | Ga0157379_10544827 | 3300014968 | Bacteria | 1079 |
| 241 | Ga0157376_10003398 | 3300014969 | Bacteria | 10956 |
| 242 | Ga0157376_10004392 | 3300014969 | Bacteria | 9818 |
| 243 | Ga0157376_10005968 | 3300014969 | Bacteria | 8558 |
| 244 | Ga0163161_10118584 | 3300017792 | Bacteria | 1986 |
| 245 | Ga0213876_10224120 | 3300021384 | Bacteria | 999 |
| 246 | Ga0213875_10005102 | 3300021388 | Bacteria | 7106 |
| 247 | Ga0213871_10078997 | 3300021441 | Bacteria | 940 |
| 248 | Ga0209758_1000362 | 3300025297 | Bacteria | 80796 |
| 249 | Ga0207697_10019263 | 3300025315 | Bacteria | 2795 |
| 250 | Ga0207697_10055368 | 3300025315 | Bacteria | 1644 |
| 251 | Ga0207682_10003021 | 3300025893 | Bacteria | 7377 |
| 252 | Ga0207682_10074392 | 3300025893 | Bacteria | 1444 |
| 253 | Ga0207692_10036807 | 3300025898 | Bacteria | 2389 |
| 254 | Ga0207642_10001134 | 3300025899 | Bacteria | 8234 |
| 255 | Ga0207642_10049559 | 3300025899 | Bacteria | 1889 |
| 256 | Ga0207642_10078436 | 3300025899 | Bacteria | 1596 |
| 257 | Ga0207642_10188381 | 3300025899 | Bacteria | 1130 |
| 258 | Ga0207685_10097946 | 3300025905 | Bacteria | 1248 |
| 259 | Ga0207645_10062708 | 3300025907 | Unclassified | 2375 |
| 260 | Ga0207645_10083705 | 3300025907 | Bacteria | 2046 |
| 261 | Ga0207645_10207559 | 3300025907 | Bacteria | 1290 |
| 262 | Ga0207643_10006986 | 3300025908 | Bacteria | 6052 |
| 263 | Ga0207643_10427155 | 3300025908 | Bacteria | 840 |
| 264 | Ga0207654_10013963 | 3300025911 | Bacteria | 4140 |
| 265 | Ga0207707_10268490 | 3300025912 | Unclassified | 1479 |
| 266 | Ga0207660_10008341 | 3300025917 | Bacteria | 6699 |
| 267 | Ga0207662_10000215 | 3300025918 | Bacteria | 26901 |
| 268 | Ga0207662_10039341 | 3300025918 | Bacteria | 2774 |
| 269 | Ga0207662_10065002 | 3300025918 | Bacteria | 2196 |
| 270 | Ga0207662_10377583 | 3300025918 | Bacteria | 957 |
| 271 | Ga0207649_10014627 | 3300025920 | Bacteria | 4397 |
| 272 | Ga0207649_10380099 | 3300025920 | Bacteria | 1052 |
| 273 | Ga0207646_10393884 | 3300025922 | Bacteria | 1251 |
| 274 | Ga0207646_10488270 | 3300025922 | Bacteria | 1110 |
| 275 | Ga0207681_10002427 | 3300025923 | Bacteria | 11816 |
| 276 | Ga0207681_10126276 | 3300025923 | Bacteria | 1884 |
| 277 | Ga0207681_10525245 | 3300025923 | Bacteria | 972 |
| 278 | Ga0207694_10408266 | 3300025924 | Bacteria | 1130 |
| 279 | Ga0207650_10009035 | 3300025925 | Bacteria | 6813 |
| 280 | Ga0207650_10038898 | 3300025925 | Bacteria | 3476 |
| 281 | Ga0207650_10287506 | 3300025925 | Bacteria | 1340 |
| 282 | Ga0207659_10064900 | 3300025926 | Bacteria | 2644 |
| 283 | Ga0207687_10001049 | 3300025927 | Bacteria | 18747 |
| 284 | Ga0207687_10042502 | 3300025927 | Bacteria | 3127 |
| 285 | Ga0207700_10199934 | 3300025928 | Bacteria | 1684 |
| 286 | Ga0207706_10112282 | 3300025933 | Unclassified | 2398 |
| 287 | Ga0207706_10211331 | 3300025933 | Bacteria | 1701 |
| 288 | Ga0207686_10002720 | 3300025934 | Bacteria | 9588 |
| 289 | Ga0207686_10425358 | 3300025934 | Bacteria | 1017 |
| 290 | Ga0207709_10003890 | 3300025935 | Bacteria | 8729 |
| 291 | Ga0207709_10003995 | 3300025935 | Bacteria | 8600 |
| 292 | Ga0207709_10228406 | 3300025935 | Bacteria | 1347 |
| 293 | Ga0207670_10002408 | 3300025936 | Bacteria | 9804 |
| 294 | Ga0207670_10003744 | 3300025936 | Bacteria | 8077 |
| 295 | Ga0207670_10019339 | 3300025936 | Bacteria | 4159 |
| 296 | Ga0207670_10059051 | 3300025936 | Bacteria | 2608 |
| 297 | Ga0207670_10410352 | 3300025936 | Bacteria | 1085 |
| 298 | Ga0207669_10039565 | 3300025937 | Bacteria | 2726 |
| 299 | Ga0207669_10068717 | 3300025937 | Bacteria | 2214 |
| 300 | Ga0207704_10001044 | 3300025938 | Bacteria | 12293 |
| 301 | Ga0207704_10001267 | 3300025938 | Bacteria | 11301 |
| 302 | Ga0207704_10118319 | 3300025938 | Bacteria | 1807 |
| 303 | Ga0207704_10151695 | 3300025938 | Bacteria | 1636 |
| 304 | Ga0207665_10071496 | 3300025939 | Bacteria | 2369 |
| 305 | Ga0207665_10783916 | 3300025939 | Bacteria | 752 |
| 306 | Ga0207691_10004344 | 3300025940 | Bacteria | 13749 |
| 307 | Ga0207691_10068861 | 3300025940 | Bacteria | 3197 |
| 308 | Ga0207691_10141828 | 3300025940 | Bacteria | 2117 |
| 309 | Ga0207711_10058867 | 3300025941 | Bacteria | 3307 |
| 310 | Ga0207711_10283498 | 3300025941 | Bacteria | 1526 |
| 311 | Ga0207711_10504937 | 3300025941 | Bacteria | 1127 |
| 312 | Ga0207689_10000007 | 3300025942 | Bacteria | 132362 |
| 313 | Ga0207689_10001267 | 3300025942 | Bacteria | 24358 |
| 314 | Ga0207661_10002250 | 3300025944 | Bacteria | 13306 |
| 315 | Ga0207679_10011613 | 3300025945 | Bacteria | 5715 |
| 316 | Ga0207679_10133432 | 3300025945 | Bacteria | 1995 |
| 317 | Ga0207667_10012993 | 3300025949 | Bacteria | 9558 |
| 318 | Ga0207651_10009087 | 3300025960 | Bacteria | 5411 |
| 319 | Ga0207651_10011744 | 3300025960 | Bacteria | 4916 |
| 320 | Ga0207651_10040441 | 3300025960 | Bacteria | 3085 |
| 321 | Ga0207651_10056867 | 3300025960 | Bacteria | 2695 |
| 322 | Ga0207651_10074117 | 3300025960 | Bacteria | 2423 |
| 323 | Ga0207712_10006352 | 3300025961 | Bacteria | 7456 |
| 324 | Ga0207712_10032651 | 3300025961 | Bacteria | 3514 |
| 325 | Ga0207712_10041924 | 3300025961 | Bacteria | 3149 |
| 326 | Ga0207640_10010129 | 3300025981 | Bacteria | 5301 |
| 327 | Ga0207640_10025271 | 3300025981 | Unclassified | 3593 |
| 328 | Ga0207658_10567291 | 3300025986 | Bacteria | 1017 |
| 329 | Ga0207677_10002194 | 3300026023 | Bacteria | 10259 |
| 330 | Ga0207677_10008899 | 3300026023 | Bacteria | 5629 |
| 331 | Ga0207703_10004921 | 3300026035 | Bacteria | 10839 |
| 332 | Ga0207703_10005035 | 3300026035 | Bacteria | 10715 |
| 333 | Ga0207703_10071140 | 3300026035 | Bacteria | 2873 |
| 334 | Ga0207639_10029407 | 3300026041 | Bacteria | 4022 |
| 335 | Ga0207639_10292976 | 3300026041 | Bacteria | 1436 |
| 336 | Ga0207708_10001220 | 3300026075 | Bacteria | 19421 |
| 337 | Ga0207708_10014298 | 3300026075 | Bacteria | 5937 |
| 338 | Ga0207708_10039912 | 3300026075 | Bacteria | 3578 |
| 339 | Ga0207708_10192164 | 3300026075 | Bacteria | 1625 |
| 340 | Ga0207641_10029278 | 3300026088 | Bacteria | 4552 |
| 341 | Ga0207641_10087012 | 3300026088 | Bacteria | 2726 |
| 342 | Ga0207648_10000135 | 3300026089 | Bacteria | 73544 |
| 343 | Ga0207648_10002758 | 3300026089 | Bacteria | 18666 |
| 344 | Ga0207648_10007543 | 3300026089 | Bacteria | 10674 |
| 345 | Ga0207648_10063238 | 3300026089 | Unclassified | 3226 |
| 346 | Ga0207648_10097650 | 3300026089 | Bacteria | 2571 |
| 347 | Ga0207648_10928445 | 3300026089 | Bacteria | 814 |
| 348 | Ga0207676_10008772 | 3300026095 | Bacteria | 7196 |
| 349 | Ga0207676_10157379 | 3300026095 | Bacteria | 1964 |
| 350 | Ga0207676_10158790 | 3300026095 | Bacteria | 1956 |
| 351 | Ga0207676_10179642 | 3300026095 | Bacteria | 1852 |
| 352 | Ga0207676_10635180 | 3300026095 | Bacteria | 1029 |
| 353 | Ga0207674_10036389 | 3300026116 | Bacteria | 5131 |
| 354 | Ga0207675_100000825 | 3300026118 | Bacteria | 30861 |
| 355 | Ga0207675_100002436 | 3300026118 | Bacteria | 18434 |
| 356 | Ga0207675_100019002 | 3300026118 | Bacteria | 6416 |
| 357 | Ga0207675_100177632 | 3300026118 | Bacteria | 2037 |
| 358 | Ga0207683_10001605 | 3300026121 | Bacteria | 20325 |
| 359 | Ga0207683_10022789 | 3300026121 | Bacteria | 5379 |
| 360 | Ga0207683_10640644 | 3300026121 | Bacteria | 984 |
| 361 | Ga0207698_10009224 | 3300026142 | Bacteria | 6277 |
| 362 | Ga0210000_1006284 | 3300027462 | Bacteria | 1729 |
| 363 | Ga0209995_1003052 | 3300027471 | Bacteria | 2657 |
| 364 | Ga0209983_1004825 | 3300027665 | Bacteria | 2815 |
| 365 | Ga0209974_10020791 | 3300027876 | Bacteria | 2175 |
| 366 | Ga0207428_10000265 | 3300027907 | Bacteria | 70984 |
| 367 | Ga0207428_10010533 | 3300027907 | Bacteria | 8255 |
| 368 | Ga0207428_10216925 | 3300027907 | Bacteria | 1435 |
| 369 | Ga0268266_10058329 | 3300028379 | Bacteria | 3324 |
| 370 | Ga0268266_10212260 | 3300028379 | Bacteria | 1776 |
| 371 | Ga0268265_10001812 | 3300028380 | Bacteria | 17085 |
| 372 | Ga0268265_10003652 | 3300028380 | Bacteria | 10970 |
| 373 | Ga0268265_10081646 | 3300028380 | Bacteria | 2553 |
| 374 | Ga0268265_10092160 | 3300028380 | Bacteria | 2425 |
| 375 | Ga0268265_10115036 | 3300028380 | Bacteria | 2204 |
| 376 | Ga0268265_10272914 | 3300028380 | Bacteria | 1509 |
| 377 | Ga0268264_10001495 | 3300028381 | Bacteria | 21802 |
| 378 | Ga0268264_10018097 | 3300028381 | Bacteria | 5763 |
| 379 | Ga0268264_10305250 | 3300028381 | Bacteria | 1500 |
| 380 | Ga0265318_10007463 | 3300028577 | Bacteria | 4943 |
| 381 | Ga0265330_10005907 | 3300031235 | Bacteria | 6064 |
| 382 | Ga0265332_10012748 | 3300031238 | Bacteria | 3729 |
| 383 | Ga0265320_10045606 | 3300031240 | Bacteria | 2153 |
| 384 | Ga0265316_10029413 | 3300031344 | Bacteria | 4518 |
| 385 | Ga0265314_10003722 | 3300031711 | Bacteria | 14592 |
| 386 | Ga0307412_10280111 | 3300031911 | Bacteria | 1309 |
| 387 | Ga0307416_100108630 | 3300032002 | Bacteria | 2438 |
| 388 | Ga0307510_10000002 | 3300033180 | Bacteria | 801565 |
| 389 | Ga0373959_0034008 | 3300034820 | Bacteria | 1042 |
| 390 | Ga0373938_0011679 | 3300034957 | Bacteria | 1637 |
| 391 | Ga0373926_0029879 | 3300035083 | Bacteria | 1916 |
| 392 | Ga0373928_0006247 | 3300035084 | Bacteria | 2288 |
| 393 | Ga0373929_0006633 | 3300035085 | Bacteria | 2095 |
| 394 | Ga0373929_0011649 | 3300035085 | Bacteria | 1660 |
| 395 | Ga0373934_0000044 | 3300035086 | Bacteria | 41857 |
| 396 | Ga0373944_0003470 | 3300035089 | Bacteria | 4073 |
| 397 | Ga0373944_0020545 | 3300035089 | Bacteria | 1904 |
| 398 | Ga0373952_0020693 | 3300035092 | Bacteria | 1381 |
| 399 | Ga0373952_0063544 | 3300035092 | Bacteria | 908 |
| 400 | Ga0373923_0023030 | 3300035111 | Bacteria | 2447 |
| 401 | Ga0373923_0046930 | 3300035111 | Bacteria | 1798 |
| 402 | Ga0373932_0019906 | 3300035112 | Bacteria | 1754 |
| 403 | Ga0373936_0000601 | 3300035113 | Bacteria | 12463 |
| 404 | Ga0373936_0019200 | 3300035113 | Bacteria | 2648 |
| 405 | Ga0373939_0023657 | 3300035114 | Bacteria | 1704 |
| 406 | Ga0373945_0000490 | 3300035116 | Bacteria | 11249 |
| 407 | Ga0373945_0035109 | 3300035116 | Bacteria | 1791 |
| 408 | Ga0373953_0003011 | 3300035117 | Bacteria | 5160 |
| 409 | Ga0373954_0000012 | 3300035118 | Bacteria | 73616 |
| 410 | Ga0373954_0018088 | 3300035118 | Bacteria | 3170 |
| 411 | Ga0373954_0143501 | 3300035118 | Bacteria | 1165 |
| 412 | Ga0373956_0002849 | 3300035119 | Bacteria | 6998 |
| 413 | Ga0373957_0001310 | 3300035120 | Bacteria | 6684 |
| 414 | Ga0373957_0004446 | 3300035120 | Bacteria | 4265 |
| 415 | Ga0373960_0003931 | 3300035121 | Bacteria | 3388 |
| 416 | Ga0373943_0186463 | 3300035170 | Bacteria | 1142 |
| 417 | Ga0373946_0007524 | 3300035171 | Bacteria | 3983 |
| 418 | Ga0373946_0157178 | 3300035171 | Bacteria | 1065 |
| 419 | Ga0373955_0000470 | 3300035172 | Bacteria | 16971 |
| 420 | Ga0373955_0010226 | 3300035172 | Bacteria | 4424 |
| 421 | Ga0373955_0087656 | 3300035172 | Bacteria | 1769 |
| 422 | Ga0373942_0053737 | 3300035207 | Bacteria | 1136 |
| 423 | Ga0373961_0043058 | 3300035241 | Bacteria | 1311 |
| 424 | Ga0373962_0003002 | 3300035242 | Bacteria | 4046 |
| 425 | Ga0373924_0000643 | 3300035410 | Bacteria | 10842 |
| 426 | Ga0373924_0001386 | 3300035410 | Bacteria | 7846 |
| 427 | Ga0373924_0110164 | 3300035410 | Bacteria | 1189 |
| 428 | Ga0373931_0001393 | 3300035691 | Bacteria | 10357 |
| 429 | Ga0373931_0005783 | 3300035691 | Bacteria | 5748 |
| 430 | Ga0373931_0026800 | 3300035691 | Bacteria | 2937 |
| 431 | Ga0373931_0148187 | 3300035691 | Bacteria | 1365 |
| 432 | Ga0373935_0004736 | 3300035692 | Bacteria | 8002 |
| 433 | Ga0373935_0018543 | 3300035692 | Bacteria | 4235 |
| 434 | Ga0373935_0058785 | 3300035692 | Bacteria | 2456 |
| 435 | Ga0373927_0025024 | 3300035695 | Bacteria | 3903 |
| 436 | Ga0373927_0297247 | 3300035695 | Bacteria | 1062 |
| 437 | Ga0373933_0000107 | 3300035724 | Bacteria | 53134 |
| 438 | Ga0373933_0001549 | 3300035724 | Bacteria | 13464 |
| 439 | Ga0373933_0049886 | 3300035724 | Bacteria | 2496 |
| 440 | Ga0373947_0026360 | 3300035725 | Bacteria | 3396 |
| 441 | Ga0373947_0101274 | 3300035725 | Bacteria | 1810 |
| 442 | Ga0373947_0496790 | 3300035725 | Bacteria | 829 |
| 443 | Ga0373937_0000810 | 3300036401 | Bacteria | 26724 |
| 444 | Ga0373937_0002420 | 3300036401 | Bacteria | 15516 |
| 445 | Ga0373937_0008090 | 3300036401 | Bacteria | 9128 |
| 446 | Ga0373937_0031763 | 3300036401 | Bacteria | 4786 |
| 447 | Ga0373925_0019590 | 3300037068 | Bacteria | 4923 |
| 448 | Ga0373925_0050873 | 3300037068 | Bacteria | 3091 |
| 449 | Ga0436360_0512522 | 3300039438 | Bacteria | 2827 |
| 450 | Ga0436361_0295678 | 3300039447 | Bacteria | 1667 |
| 451 | Ga0439435_0066788 | 3300042436 | Bacteria | 1058 |
| 452 | Ga0439435_0115465 | 3300042436 | Bacteria | 837 |
| 453 | Ga0451577_0102038 | 3300042876 | Bacteria | 2563 |
| 454 | Ga0453684_0150383 | 3300044712 | Bacteria | 2768 |
| 455 | Ga0451576_0006018 | 3300045051 | Bacteria | 14993 |
| 456 | Ga0451576_0022710 | 3300045051 | Bacteria | 6796 |
| 457 | Ga0451576_0287673 | 3300045051 | Bacteria | 1718 |
| 458 | Ga0451576_0679266 | 3300045051 | Bacteria | 1082 |
| 459 | Ga0495592_0071528 | 3300046454 | Bacteria | 2525 |
| 460 | Ga0495603_0003474 | 3300046455 | Bacteria | 9373 |
| 461 | Ga0495629_0269151 | 3300046459 | Bacteria | 1171 |
| 462 | Ga0495641_0003233 | 3300046461 | Bacteria | 12354 |
| 463 | Ga0495651_0000105 | 3300046462 | Bacteria | 61688 |
| 464 | Ga0495651_0003319 | 3300046462 | Bacteria | 12355 |
| 465 | Ga0495653_0012885 | 3300046463 | Bacteria | 6827 |
| 466 | Ga0495580_0003325 | 3300046472 | Bacteria | 13747 |
| 467 | Ga0495580_0026172 | 3300046472 | Bacteria | 4256 |
| 468 | Ga0495582_0067044 | 3300046473 | Bacteria | 1983 |
| 469 | Ga0495582_0073525 | 3300046473 | Bacteria | 1892 |
| 470 | Ga0495639_0018448 | 3300046475 | Bacteria | 3038 |
| 471 | Ga0495639_0018888 | 3300046475 | Bacteria | 3005 |
| 472 | Ga0495662_0023260 | 3300046476 | Bacteria | 2992 |
| 473 | Ga0495608_0053894 | 3300046511 | Bacteria | 2659 |
| 474 | Ga0495608_0326134 | 3300046511 | Bacteria | 948 |
| 475 | Ga0495628_0011511 | 3300046516 | Bacteria | 7478 |
| 476 | Ga0495628_0015785 | 3300046516 | Bacteria | 6303 |
| 477 | Ga0495628_0052061 | 3300046516 | Bacteria | 3235 |
| 478 | Ga0495630_0008055 | 3300046517 | Bacteria | 7575 |
| 479 | Ga0495666_0026179 | 3300046526 | Bacteria | 2878 |
| 480 | Ga0495666_0028857 | 3300046526 | Bacteria | 2729 |
| 481 | Ga0495642_0253927 | 3300046528 | Bacteria | 769 |
| 482 | Ga0495652_0040846 | 3300046529 | Bacteria | 4009 |
| 483 | Ga0495665_0065227 | 3300046531 | Bacteria | 1922 |
| 484 | Ga0495640_0022913 | 3300046533 | Bacteria | 4561 |
| 485 | Ga0495586_0003781 | 3300046535 | Bacteria | 8111 |
| 486 | Ga0495586_0015739 | 3300046535 | Bacteria | 4023 |
| 487 | Ga0495586_0041096 | 3300046535 | Bacteria | 2490 |
| 488 | Ga0495586_0082594 | 3300046535 | Bacteria | 1767 |
| 489 | Ga0495587_0002310 | 3300046536 | Bacteria | 12764 |
| 490 | Ga0495645_0452795 | 3300046543 | Bacteria | 809 |
| 491 | Ga0495622_0172375 | 3300046557 | Bacteria | 972 |
| 492 | Ga0495667_0004692 | 3300046559 | Bacteria | 9239 |
| 493 | Ga0495667_0219862 | 3300046559 | Bacteria | 1212 |
| 494 | Ga0495667_0472739 | 3300046559 | Bacteria | 786 |
| 495 | Ga0495634_0012863 | 3300046642 | Bacteria | 6057 |
| 496 | Ga0495588_0035553 | 3300046674 | Bacteria | 2525 |
| 497 | Ga0495657_0002627 | 3300046675 | Bacteria | 15037 |
| 498 | Ga0495657_0122590 | 3300046675 | Bacteria | 1636 |
| 499 | Ga0495657_0160678 | 3300046675 | Bacteria | 1390 |
| 500 | Ga0495599_0081236 | 3300046678 | Bacteria | 2024 |
| 501 | Ga0495647_0000588 | 3300046681 | Bacteria | 10771 |
| 502 | Ga0495647_0001106 | 3300046681 | Bacteria | 8240 |
| 503 | Ga0495658_0002559 | 3300046683 | Bacteria | 9145 |
| 504 | Ga0495658_0047992 | 3300046683 | Bacteria | 2406 |
| 505 | Ga0495658_0106956 | 3300046683 | Bacteria | 1677 |
| 506 | Ga0495658_0283913 | 3300046683 | Bacteria | 1045 |
| 507 | Ga0495669_0074223 | 3300046684 | Bacteria | 1555 |
| 508 | Ga0495669_0132397 | 3300046684 | Bacteria | 1174 |
| 509 | Ga0495613_0006955 | 3300046689 | Bacteria | 8437 |
| 510 | Ga0495624_0098587 | 3300046690 | Bacteria | 1800 |
| 511 | Ga0495600_0000689 | 3300046809 | Bacteria | 17658 |
| 512 | Ga0495581_0077946 | 3300047315 | Bacteria | 1918 |
| 513 | Ga0495581_0135214 | 3300047315 | Bacteria | 1437 |
| 514 | Ga0495604_0130574 | 3300047317 | Bacteria | 1806 |
| 515 | Ga0495674_0000463 | 3300047319 | Bacteria | 36736 |
| 516 | Ga0495676_0056302 | 3300047321 | Bacteria | 3110 |
| 517 | Ga0495680_0027640 | 3300047322 | Bacteria | 4657 |
| 518 | Ga0495680_0037275 | 3300047322 | Bacteria | 3895 |
| 519 | Ga0495680_0228162 | 3300047322 | Bacteria | 1327 |
| 520 | Ga0495680_0352169 | 3300047322 | Bacteria | 1025 |
| 521 | Ga0495684_0001586 | 3300047471 | Bacteria | 18214 |
| 522 | Ga0496100_0039048 | 3300048903 | Bacteria | 3012 |
| 523 | Ga0496101_0054297 | 3300048904 | Bacteria | 2892 |
| 524 | Ga0496102_0165138 | 3300048905 | Bacteria | 2083 |
| 525 | Ga0496103_0152173 | 3300048906 | Bacteria | 1482 |
| 526 | Ga0496104_0002475 | 3300048907 | Bacteria | 15914 |
| 527 | Ga0496104_0015427 | 3300048907 | Bacteria | 6919 |
| 528 | Ga0496105_0011725 | 3300048908 | Bacteria | 6937 |
| 529 | Ga0496106_0019897 | 3300048909 | Bacteria | 4978 |
| 530 | Ga0496106_0039984 | 3300048909 | Bacteria | 3511 |
| 531 | Ga0496107_0168039 | 3300048910 | Bacteria | 1627 |
| 532 | Ga0496108_0009808 | 3300048911 | Bacteria | 7757 |
| 533 | Ga0496108_0134102 | 3300048911 | Bacteria | 2129 |
| 534 | Ga0496108_0431193 | 3300048911 | Bacteria | 1151 |
| 535 | Ga0496110_0039992 | 3300048913 | Bacteria | 4086 |
| 536 | Ga0496110_0052896 | 3300048913 | Bacteria | 3568 |
| 537 | Ga0496111_0024775 | 3300048914 | Bacteria | 4232 |
| 538 | Ga0496112_0039691 | 3300048915 | Bacteria | 4601 |
| 539 | Ga0496113_0025103 | 3300048916 | Bacteria | 4245 |
| 540 | Ga0496114_0011772 | 3300048917 | Bacteria | 6999 |
| 541 | Ga0496114_0200860 | 3300048917 | Bacteria | 1746 |
| 542 | Ga0496115_0063377 | 3300048918 | Bacteria | 2982 |
| 543 | Ga0496121_0000795 | 3300048924 | Bacteria | 57731 |
| 544 | Ga0496126_0008797 | 3300048929 | Bacteria | 10831 |
| 545 | Ga0496126_0093971 | 3300048929 | Bacteria | 2632 |
| 546 | Ga0496126_0263616 | 3300048929 | Bacteria | 1432 |
| 547 | Ga0496126_0307144 | 3300048929 | Bacteria | 1307 |
| 548 | Ga0501291_043531 | 3300049514 | Bacteria | 797 |
| 549 | Ga0501033_0036268 | 3300049570 | Bacteria | 3695 |
| 550 | Ga0501034_0185291 | 3300049571 | Bacteria | 2045 |
| 551 | Ga0501036_0229446 | 3300049572 | Bacteria | 1558 |
| 552 | Ga0501037_0003806 | 3300049573 | Bacteria | 10947 |
| 553 | Ga0501037_0094303 | 3300049573 | Bacteria | 2164 |
| 554 | Ga0501038_0000994 | 3300049574 | Bacteria | 25505 |
| 555 | Ga0501039_0003932 | 3300049575 | Bacteria | 11168 |
| 556 | Ga0501039_0012378 | 3300049575 | Bacteria | 6511 |
| 557 | Ga0501040_0030971 | 3300049576 | Bacteria | 3615 |
| 558 | Ga0501041_0003756 | 3300049577 | Bacteria | 8737 |
| 559 | Ga0501041_0004135 | 3300049577 | Bacteria | 8394 |
| 560 | Ga0501042_0006414 | 3300049578 | Bacteria | 7630 |
| 561 | Ga0501042_0029632 | 3300049578 | Bacteria | 3860 |
| 562 | Ga0501043_0010120 | 3300049579 | Bacteria | 7394 |
| 563 | Ga0501046_0004336 | 3300049580 | Bacteria | 12915 |
| 564 | Ga0501047_0135821 | 3300049581 | Bacteria | 2340 |
| 565 | Ga0501048_0000293 | 3300049582 | Bacteria | 34000 |
| 566 | Ga0501068_0033695 | 3300049584 | Bacteria | 3051 |
| 567 | Ga0501068_0244525 | 3300049584 | Bacteria | 1142 |
| 568 | Ga0501070_0047758 | 3300049586 | Bacteria | 3557 |
| 569 | Ga0501071_0018669 | 3300049587 | Bacteria | 4807 |
| 570 | Ga0501071_0024763 | 3300049587 | Bacteria | 4198 |
| 571 | Ga0501072_0008621 | 3300049588 | Bacteria | 7739 |
| 572 | Ga0501072_0067258 | 3300049588 | Bacteria | 2827 |
| 573 | Ga0501072_0302661 | 3300049588 | Bacteria | 1271 |
| 574 | Ga0501074_0112907 | 3300049590 | Bacteria | 1944 |
| 575 | Ga0501075_0002497 | 3300049591 | Bacteria | 12252 |
| 576 | Ga0501076_0002131 | 3300049592 | Bacteria | 13585 |
| 577 | Ga0501076_0484992 | 3300049592 | Bacteria | 1019 |
| 578 | Ga0501077_0012170 | 3300049593 | Bacteria | 5385 |
| 579 | Ga0501079_0004238 | 3300049741 | Bacteria | 10636 |
| 580 | Ga0501079_0008832 | 3300049741 | Bacteria | 7630 |
| 581 | Ga0501079_0116300 | 3300049741 | Bacteria | 2079 |
| 582 | Ga0501080_0018160 | 3300049742 | Bacteria | 6510 |
| 583 | Ga0501081_0000696 | 3300049743 | Bacteria | 19414 |
| 584 | Ga0501081_0023597 | 3300049743 | Bacteria | 4123 |
| 585 | Ga0501035_0063920 | 3300049822 | Bacteria | 3272 |
| 586 | Ga0501044_0409718 | 3300049823 | Bacteria | 1267 |
| 587 | Ga0501045_0004598 | 3300049824 | Bacteria | 9528 |
| 588 | Ga0501045_0012797 | 3300049824 | Bacteria | 5911 |
| 589 | Ga0501045_0028707 | 3300049824 | Bacteria | 4015 |
| 590 | nmdc:mga05p37_202939_c1 | 3300050507 | Bacteria | 2400 |
| 591 | nmdc:mga05p37_2836_c1 | 3300050507 | Bacteria | 20144 |
| 592 | nmdc:mga05p37_376862_c1 | 3300050507 | Bacteria | 1664 |
| 593 | nmdc:mga09592_12321_c1 | 3300050508 | Bacteria | 6963 |
| 594 | nmdc:mga09592_20267_c1 | 3300050508 | Bacteria | 5466 |
| 595 | nmdc:mga0qj67_161179_c1 | 3300050509 | Bacteria | 1821 |
| 596 | nmdc:mga06r32_64989_c1 | 3300050510 | Bacteria | 3518 |
| 597 | nmdc:mga08y16_124999_c1 | 3300050511 | Bacteria | 2676 |
| 598 | nmdc:mga08y16_134231_c1 | 3300050511 | Bacteria | 2573 |
| 599 | nmdc:mga08y16_141826_c1 | 3300050511 | Bacteria | 2498 |
| 600 | nmdc:mga08y16_35981_c1 | 3300050511 | Bacteria | 5199 |
| 601 | nmdc:mga08y16_393340_c1 | 3300050511 | Bacteria | 1420 |
| 602 | nmdc:mga08y16_5446_c1 | 3300050511 | Bacteria | 13305 |
| 603 | nmdc:mga08y16_66966_c1 | 3300050511 | Bacteria | 3747 |
| 604 | nmdc:mga08y16_71427_c1 | 3300050511 | Bacteria | 3617 |
| 605 | nmdc:mga0n895_42155_c1 | 3300050512 | Bacteria | 4440 |
| 606 | nmdc:mga0n895_44924_c1 | 3300050512 | Bacteria | 4309 |
| 607 | nmdc:mga0n895_598346_c1 | 3300050512 | Bacteria | 1105 |
| 608 | nmdc:mga0n895_67805_c1 | 3300050512 | Bacteria | 3534 |
| 609 | nmdc:mga0n895_764076_c1 | 3300050512 | Bacteria | 959 |
| 610 | nmdc:mga0rr50_154_c1 | 3300050513 | Bacteria | 37500 |
| 611 | nmdc:mga0rr50_31682_c1 | 3300050513 | Bacteria | 3759 |
| 612 | nmdc:mga0rr50_570391_c1 | 3300050513 | Bacteria | 964 |
| 613 | nmdc:mga0rr50_63304_c1 | 3300050513 | Bacteria | 2793 |
| 614 | nmdc:mga08x19_150217_c1 | 3300050514 | Bacteria | 1577 |
| 615 | nmdc:mga08x19_2283_c1 | 3300050514 | Bacteria | 11642 |
| 616 | nmdc:mga0a205_242_c1 | 3300050515 | Bacteria | 22520 |
| 617 | nmdc:mga0a205_343573_c1 | 3300050515 | Bacteria | 1361 |
| 618 | Ga0495601_0030790 | 3300053077 | Bacteria | 3333 |
| 619 | Ga0495601_0031662 | 3300053077 | Bacteria | 3288 |
| 620 | Ga0495601_0298229 | 3300053077 | Bacteria | 1050 |
| 621 | Ga0495595_0008104 | 3300053084 | Bacteria | 4308 |
| 622 | Ga0495619_0054003 | 3300053085 | Bacteria | 2658 |
| 623 | Ga0495619_0072995 | 3300053085 | Bacteria | 2299 |
| 624 | Ga0500566_0296010 | 3300053094 | Bacteria | 764 |
| 625 | Ga0500618_001640 | 3300053125 | Bacteria | 9634 |
| 626 | Ga0501084_0018451 | 3300054114 | Bacteria | 5808 |
| 627 | Ga0501084_0117467 | 3300054114 | Bacteria | 2236 |
| 628 | Ga0590071_026700 | 3300059421 | Bacteria | 1370 |
| 629 | Ga0501082_0000754 | 3300060353 | Bacteria | 28420 |
| 630 | Ga0530510_0002046 | 3300061734 | Bacteria | 13863 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_0484992 | Ga0501076_0484992_228_929 | 182 |
| 2 | 3300009094 | Ga0111539_11129526 | Ga0111539_111295261 | 190 |
| 3 | 3300049570 | Ga0501033_0036268 | Ga0501033_0036268_1238_2023 | 200 |
| 4 | 3300049573 | Ga0501037_0094303 | Ga0501037_0094303_196_981 | 200 |
| 5 | 3300049822 | Ga0501035_0063920 | Ga0501035_0063920_1002_1787 | 200 |
| 6 | 3300005615 | Ga0070702_100012703 | Ga0070702_1000127031 | 201 |
| 7 | 3300025893 | Ga0207682_10003021 | Ga0207682_100030216 | 201 |
| 8 | 3300005328 | Ga0070676_10382023 | Ga0070676_103820231 | 208 |
| 9 | 3300005354 | Ga0070675_100221278 | Ga0070675_1002212782 | 208 |
| 10 | 3300005354 | Ga0070675_100280223 | Ga0070675_1002802232 | 208 |
| 11 | 3300005456 | Ga0070678_100623804 | Ga0070678_1006238041 | 208 |
| 12 | 3300005549 | Ga0070704_100623268 | Ga0070704_1006232681 | 208 |
| 13 | 3300005841 | Ga0068863_100218008 | Ga0068863_1002180082 | 208 |
| 14 | 3300006353 | Ga0075370_10315244 | Ga0075370_103152441 | 208 |
| 15 | 3300006871 | Ga0075434_100367675 | Ga0075434_1003676752 | 208 |
| 16 | 3300009148 | Ga0105243_10699493 | Ga0105243_106994931 | 208 |
| 17 | 3300009176 | Ga0105242_10754276 | Ga0105242_107542762 | 208 |
| 18 | 3300009177 | Ga0105248_10663882 | Ga0105248_106638821 | 208 |
| 19 | 3300013296 | Ga0157374_10439171 | Ga0157374_104391712 | 208 |
| 20 | 3300013297 | Ga0157378_10522476 | Ga0157378_105224762 | 208 |
| 21 | 3300013307 | Ga0157372_10501884 | Ga0157372_105018842 | 208 |
| 22 | 3300013308 | Ga0157375_10590573 | Ga0157375_105905732 | 208 |
| 23 | 3300017792 | Ga0163161_10118584 | Ga0163161_101185842 | 208 |
| 24 | 3300025907 | Ga0207645_10083705 | Ga0207645_100837052 | 208 |
| 25 | 3300025925 | Ga0207650_10287506 | Ga0207650_102875062 | 208 |
| 26 | 3300025941 | Ga0207711_10504937 | Ga0207711_105049371 | 208 |
| 27 | 3300025960 | Ga0207651_10040441 | Ga0207651_100404412 | 208 |
| 28 | 3300026089 | Ga0207648_10097650 | Ga0207648_100976503 | 208 |
| 29 | 3300026095 | Ga0207676_10635180 | Ga0207676_106351801 | 208 |
| 30 | 3300026121 | Ga0207683_10640644 | Ga0207683_106406441 | 208 |
| 31 | 3300028380 | Ga0268265_10115036 | Ga0268265_101150362 | 208 |
| 32 | 3300046683 | Ga0495658_0106956 | Ga0495658_0106956_745_1530 | 208 |
| 33 | 3300048924 | Ga0496121_0000795 | Ga0496121_0000795_11031_11816 | 208 |
| 34 | 3300048929 | Ga0496126_0008797 | Ga0496126_0008797_2278_3063 | 208 |
| 35 | 3300048929 | Ga0496126_0093971 | Ga0496126_0093971_1228_2004 | 208 |
| 36 | 3300048929 | Ga0496126_0307144 | Ga0496126_0307144_229_1008 | 208 |
| 37 | 3300050512 | nmdc:mga0n895_764076_c1 | nmdc:mga0n895_764076_c1_89_871 | 208 |
| 38 | 3300053125 | Ga0500618_001640 | Ga0500618_001640_7021_7827 | 208 |
| 39 | 3300005295 | Ga0065707_10087312 | Ga0065707_100873126 | 209 |
| 40 | 3300005329 | Ga0070683_100492067 | Ga0070683_1004920672 | 209 |
| 41 | 3300005330 | Ga0070690_100002963 | Ga0070690_1000029636 | 209 |
| 42 | 3300005331 | Ga0070670_100241606 | Ga0070670_1002416061 | 209 |
| 43 | 3300005334 | Ga0068869_100009133 | Ga0068869_1000091339 | 209 |
| 44 | 3300005336 | Ga0070680_100000089 | Ga0070680_10000008914 | 209 |
| 45 | 3300005337 | Ga0070682_100007516 | Ga0070682_1000075163 | 209 |
| 46 | 3300005338 | Ga0068868_100003541 | Ga0068868_10000354111 | 209 |
| 47 | 3300005340 | Ga0070689_100010938 | Ga0070689_1000109382 | 209 |
| 48 | 3300005340 | Ga0070689_100064273 | Ga0070689_1000642733 | 209 |
| 49 | 3300005341 | Ga0070691_10009666 | Ga0070691_100096664 | 209 |
| 50 | 3300005343 | Ga0070687_100002470 | Ga0070687_1000024703 | 209 |
| 51 | 3300005345 | Ga0070692_10017000 | Ga0070692_100170006 | 209 |
| 52 | 3300005355 | Ga0070671_100226140 | Ga0070671_1002261402 | 209 |
| 53 | 3300005364 | Ga0070673_100016593 | Ga0070673_1000165937 | 209 |
| 54 | 3300005365 | Ga0070688_100147901 | Ga0070688_1001479012 | 209 |
| 55 | 3300005367 | Ga0070667_100200527 | Ga0070667_1002005272 | 209 |
| 56 | 3300005434 | Ga0070709_10012617 | Ga0070709_100126175 | 209 |
| 57 | 3300005438 | Ga0070701_10000224 | Ga0070701_1000022415 | 209 |
| 58 | 3300005440 | Ga0070705_100002532 | Ga0070705_1000025329 | 209 |
| 59 | 3300005441 | Ga0070700_100001299 | Ga0070700_1000012998 | 209 |
| 60 | 3300005444 | Ga0070694_100001971 | Ga0070694_1000019718 | 209 |
| 61 | 3300005445 | Ga0070708_100009280 | Ga0070708_1000092806 | 209 |
| 62 | 3300005445 | Ga0070708_100139945 | Ga0070708_1001399452 | 209 |
| 63 | 3300005445 | Ga0070708_100500183 | Ga0070708_1005001832 | 209 |
| 64 | 3300005456 | Ga0070678_100069427 | Ga0070678_1000694273 | 209 |
| 65 | 3300005456 | Ga0070678_100236880 | Ga0070678_1002368802 | 209 |
| 66 | 3300005458 | Ga0070681_10047645 | Ga0070681_100476453 | 209 |
| 67 | 3300005459 | Ga0068867_100005200 | Ga0068867_1000052006 | 209 |
| 68 | 3300005530 | Ga0070679_100068668 | Ga0070679_1000686683 | 209 |
| 69 | 3300005530 | Ga0070679_100268660 | Ga0070679_1002686601 | 209 |
| 70 | 3300005536 | Ga0070697_100006211 | Ga0070697_10000621111 | 209 |
| 71 | 3300005544 | Ga0070686_100002771 | Ga0070686_1000027716 | 209 |
| 72 | 3300005545 | Ga0070695_100000207 | Ga0070695_1000002078 | 209 |
| 73 | 3300005546 | Ga0070696_100000958 | Ga0070696_1000009586 | 209 |
| 74 | 3300005546 | Ga0070696_100016842 | Ga0070696_1000168424 | 209 |
| 75 | 3300005547 | Ga0070693_100001070 | Ga0070693_1000010708 | 209 |
| 76 | 3300005549 | Ga0070704_100008889 | Ga0070704_1000088892 | 209 |
| 77 | 3300005563 | Ga0068855_100014749 | Ga0068855_1000147496 | 209 |
| 78 | 3300005615 | Ga0070702_100000051 | Ga0070702_1000000518 | 209 |
| 79 | 3300005617 | Ga0068859_100008140 | Ga0068859_1000081407 | 209 |
| 80 | 3300005618 | Ga0068864_100008022 | Ga0068864_1000080225 | 209 |
| 81 | 3300005718 | Ga0068866_10000950 | Ga0068866_100009509 | 209 |
| 82 | 3300005719 | Ga0068861_100010391 | Ga0068861_1000103912 | 209 |
| 83 | 3300005719 | Ga0068861_100139266 | Ga0068861_1001392662 | 209 |
| 84 | 3300005842 | Ga0068858_100009709 | Ga0068858_1000097094 | 209 |
| 85 | 3300005843 | Ga0068860_100007869 | Ga0068860_1000078699 | 209 |
| 86 | 3300005844 | Ga0068862_100007285 | Ga0068862_1000072856 | 209 |
| 87 | 3300005844 | Ga0068862_100186786 | Ga0068862_1001867862 | 209 |
| 88 | 3300005983 | Ga0081540_1001281 | Ga0081540_100128119 | 209 |
| 89 | 3300006028 | Ga0070717_10317727 | Ga0070717_103177272 | 209 |
| 90 | 3300006177 | Ga0075362_10190436 | Ga0075362_101904361 | 209 |
| 91 | 3300006237 | Ga0097621_100002764 | Ga0097621_1000027648 | 209 |
| 92 | 3300006358 | Ga0068871_100007784 | Ga0068871_1000077843 | 209 |
| 93 | 3300006844 | Ga0075428_100000581 | Ga0075428_10000058125 | 209 |
| 94 | 3300006844 | Ga0075428_100005195 | Ga0075428_1000051956 | 209 |
| 95 | 3300006847 | Ga0075431_100305373 | Ga0075431_1003053733 | 209 |
| 96 | 3300006880 | Ga0075429_100000103 | Ga0075429_10000010331 | 209 |
| 97 | 3300006880 | Ga0075429_100011647 | Ga0075429_1000116473 | 209 |
| 98 | 3300006881 | Ga0068865_100000447 | Ga0068865_10000044719 | 209 |
| 99 | 3300006914 | Ga0075436_100129106 | Ga0075436_1001291062 | 209 |
| 100 | 3300006931 | Ga0097620_100008140 | Ga0097620_1000081407 | 209 |
| 101 | 3300007265 | Ga0099794_10125540 | Ga0099794_101255402 | 209 |
| 102 | 3300009094 | Ga0111539_10007241 | Ga0111539_100072418 | 209 |
| 103 | 3300009094 | Ga0111539_10031496 | Ga0111539_100314968 | 209 |
| 104 | 3300009094 | Ga0111539_10049570 | Ga0111539_100495702 | 209 |
| 105 | 3300009094 | Ga0111539_10057719 | Ga0111539_100577192 | 209 |
| 106 | 3300009094 | Ga0111539_10263739 | Ga0111539_102637392 | 209 |
| 107 | 3300009098 | Ga0105245_10004425 | Ga0105245_100044259 | 209 |
| 108 | 3300009147 | Ga0114129_10001184 | Ga0114129_1000118415 | 209 |
| 109 | 3300009147 | Ga0114129_10246446 | Ga0114129_102464463 | 209 |
| 110 | 3300009148 | Ga0105243_10003720 | Ga0105243_100037208 | 209 |
| 111 | 3300009148 | Ga0105243_10339070 | Ga0105243_103390702 | 209 |
| 112 | 3300009174 | Ga0105241_10013741 | Ga0105241_100137413 | 209 |
| 113 | 3300009176 | Ga0105242_10003302 | Ga0105242_100033028 | 209 |
| 114 | 3300009177 | Ga0105248_10019941 | Ga0105248_100199412 | 209 |
| 115 | 3300009177 | Ga0105248_10663870 | Ga0105248_106638702 | 209 |
| 116 | 3300009553 | Ga0105249_10000917 | Ga0105249_1000091727 | 209 |
| 117 | 3300010375 | Ga0105239_10008582 | Ga0105239_100085828 | 209 |
| 118 | 3300013297 | Ga0157378_10004581 | Ga0157378_100045818 | 209 |
| 119 | 3300013306 | Ga0163162_10184892 | Ga0163162_101848923 | 209 |
| 120 | 3300013308 | Ga0157375_10419339 | Ga0157375_104193392 | 209 |
| 121 | 3300013308 | Ga0157375_10639620 | Ga0157375_106396202 | 209 |
| 122 | 3300014326 | Ga0157380_10208628 | Ga0157380_102086282 | 209 |
| 123 | 3300014326 | Ga0157380_10355097 | Ga0157380_103550972 | 209 |
| 124 | 3300014968 | Ga0157379_10544827 | Ga0157379_105448272 | 209 |
| 125 | 3300014969 | Ga0157376_10004392 | Ga0157376_100043928 | 209 |
| 126 | 3300025297 | Ga0209758_1000362 | Ga0209758_100036246 | 209 |
| 127 | 3300025315 | Ga0207697_10019263 | Ga0207697_100192633 | 209 |
| 128 | 3300025899 | Ga0207642_10001134 | Ga0207642_100011344 | 209 |
| 129 | 3300025908 | Ga0207643_10427155 | Ga0207643_104271551 | 209 |
| 130 | 3300025911 | Ga0207654_10013963 | Ga0207654_100139636 | 209 |
| 131 | 3300025917 | Ga0207660_10008341 | Ga0207660_100083416 | 209 |
| 132 | 3300025918 | Ga0207662_10000215 | Ga0207662_1000021514 | 209 |
| 133 | 3300025918 | Ga0207662_10039341 | Ga0207662_100393412 | 209 |
| 134 | 3300025918 | Ga0207662_10377583 | Ga0207662_103775831 | 209 |
| 135 | 3300025923 | Ga0207681_10525245 | Ga0207681_105252452 | 209 |
| 136 | 3300025924 | Ga0207694_10408266 | Ga0207694_104082662 | 209 |
| 137 | 3300025927 | Ga0207687_10001049 | Ga0207687_1000104914 | 209 |
| 138 | 3300025928 | Ga0207700_10199934 | Ga0207700_101999342 | 209 |
| 139 | 3300025933 | Ga0207706_10211331 | Ga0207706_102113312 | 209 |
| 140 | 3300025934 | Ga0207686_10002720 | Ga0207686_100027204 | 209 |
| 141 | 3300025935 | Ga0207709_10003890 | Ga0207709_100038902 | 209 |
| 142 | 3300025935 | Ga0207709_10228406 | Ga0207709_102284062 | 209 |
| 143 | 3300025936 | Ga0207670_10002408 | Ga0207670_100024089 | 209 |
| 144 | 3300025936 | Ga0207670_10003744 | Ga0207670_100037443 | 209 |
| 145 | 3300025938 | Ga0207704_10001044 | Ga0207704_100010448 | 209 |
| 146 | 3300025939 | Ga0207665_10071496 | Ga0207665_100714962 | 209 |
| 147 | 3300025941 | Ga0207711_10058867 | Ga0207711_100588672 | 209 |
| 148 | 3300025942 | Ga0207689_10000007 | Ga0207689_1000000720 | 209 |
| 149 | 3300025949 | Ga0207667_10012993 | Ga0207667_100129934 | 209 |
| 150 | 3300025960 | Ga0207651_10009087 | Ga0207651_100090877 | 209 |
| 151 | 3300025961 | Ga0207712_10032651 | Ga0207712_100326512 | 209 |
| 152 | 3300025981 | Ga0207640_10010129 | Ga0207640_100101293 | 209 |
| 153 | 3300025986 | Ga0207658_10567291 | Ga0207658_105672912 | 209 |
| 154 | 3300026023 | Ga0207677_10002194 | Ga0207677_100021945 | 209 |
| 155 | 3300026035 | Ga0207703_10004921 | Ga0207703_1000492111 | 209 |
| 156 | 3300026041 | Ga0207639_10029407 | Ga0207639_100294076 | 209 |
| 157 | 3300026075 | Ga0207708_10001220 | Ga0207708_1000122010 | 209 |
| 158 | 3300026075 | Ga0207708_10192164 | Ga0207708_101921642 | 209 |
| 159 | 3300026089 | Ga0207648_10000135 | Ga0207648_1000013563 | 209 |
| 160 | 3300026095 | Ga0207676_10008772 | Ga0207676_100087724 | 209 |
| 161 | 3300026118 | Ga0207675_100000825 | Ga0207675_10000082511 | 209 |
| 162 | 3300026118 | Ga0207675_100177632 | Ga0207675_1001776322 | 209 |
| 163 | 3300026121 | Ga0207683_10022789 | Ga0207683_100227893 | 209 |
| 164 | 3300027907 | Ga0207428_10000265 | Ga0207428_1000026545 | 209 |
| 165 | 3300027907 | Ga0207428_10010533 | Ga0207428_100105336 | 209 |
| 166 | 3300028380 | Ga0268265_10003652 | Ga0268265_1000365211 | 209 |
| 167 | 3300028380 | Ga0268265_10272914 | Ga0268265_102729143 | 209 |
| 168 | 3300028381 | Ga0268264_10001495 | Ga0268264_100014953 | 209 |
| 169 | 3300028381 | Ga0268264_10305250 | Ga0268264_103052502 | 209 |
| 170 | 3300034957 | Ga0373938_0011679 | Ga0373938_0011679_349_1134 | 209 |
| 171 | 3300035083 | Ga0373926_0029879 | Ga0373926_0029879_197_868 | 209 |
| 172 | 3300035084 | Ga0373928_0006247 | Ga0373928_0006247_877_1536 | 209 |
| 173 | 3300035085 | Ga0373929_0006633 | Ga0373929_0006633_1386_2045 | 209 |
| 174 | 3300035085 | Ga0373929_0011649 | Ga0373929_0011649_721_1506 | 209 |
| 175 | 3300035086 | Ga0373934_0000044 | Ga0373934_0000044_38873_39532 | 209 |
| 176 | 3300035089 | Ga0373944_0003470 | Ga0373944_0003470_611_1282 | 209 |
| 177 | 3300035089 | Ga0373944_0020545 | Ga0373944_0020545_55_714 | 209 |
| 178 | 3300035111 | Ga0373923_0046930 | Ga0373923_0046930_751_1410 | 209 |
| 179 | 3300035112 | Ga0373932_0019906 | Ga0373932_0019906_988_1647 | 209 |
| 180 | 3300035113 | Ga0373936_0000601 | Ga0373936_0000601_9815_10474 | 209 |
| 181 | 3300035113 | Ga0373936_0019200 | Ga0373936_0019200_153_824 | 209 |
| 182 | 3300035114 | Ga0373939_0023657 | Ga0373939_0023657_931_1590 | 209 |
| 183 | 3300035116 | Ga0373945_0000490 | Ga0373945_0000490_684_1355 | 209 |
| 184 | 3300035116 | Ga0373945_0035109 | Ga0373945_0035109_1033_1692 | 209 |
| 185 | 3300035117 | Ga0373953_0003011 | Ga0373953_0003011_3995_4654 | 209 |
| 186 | 3300035118 | Ga0373954_0018088 | Ga0373954_0018088_391_1050 | 209 |
| 187 | 3300035118 | Ga0373954_0143501 | Ga0373954_0143501_413_1072 | 209 |
| 188 | 3300035119 | Ga0373956_0002849 | Ga0373956_0002849_2716_3375 | 209 |
| 189 | 3300035120 | Ga0373957_0001310 | Ga0373957_0001310_2673_3332 | 209 |
| 190 | 3300035120 | Ga0373957_0004446 | Ga0373957_0004446_3344_4003 | 209 |
| 191 | 3300035121 | Ga0373960_0003931 | Ga0373960_0003931_625_1410 | 209 |
| 192 | 3300035170 | Ga0373943_0186463 | Ga0373943_0186463_120_791 | 209 |
| 193 | 3300035171 | Ga0373946_0007524 | Ga0373946_0007524_941_1612 | 209 |
| 194 | 3300035171 | Ga0373946_0157178 | Ga0373946_0157178_340_999 | 209 |
| 195 | 3300035172 | Ga0373955_0000470 | Ga0373955_0000470_3538_4197 | 209 |
| 196 | 3300035207 | Ga0373942_0053737 | Ga0373942_0053737_146_805 | 209 |
| 197 | 3300035241 | Ga0373961_0043058 | Ga0373961_0043058_300_959 | 209 |
| 198 | 3300035242 | Ga0373962_0003002 | Ga0373962_0003002_550_1209 | 209 |
| 199 | 3300035410 | Ga0373924_0000643 | Ga0373924_0000643_3314_3973 | 209 |
| 200 | 3300035691 | Ga0373931_0001393 | Ga0373931_0001393_2285_3070 | 209 |
| 201 | 3300035691 | Ga0373931_0005783 | Ga0373931_0005783_3654_4439 | 209 |
| 202 | 3300035691 | Ga0373931_0026800 | Ga0373931_0026800_1775_2434 | 209 |
| 203 | 3300035691 | Ga0373931_0148187 | Ga0373931_0148187_489_1148 | 209 |
| 204 | 3300035692 | Ga0373935_0004736 | Ga0373935_0004736_948_1607 | 209 |
| 205 | 3300035692 | Ga0373935_0018543 | Ga0373935_0018543_1780_2565 | 209 |
| 206 | 3300035692 | Ga0373935_0058785 | Ga0373935_0058785_1511_2182 | 209 |
| 207 | 3300035695 | Ga0373927_0025024 | Ga0373927_0025024_1429_2088 | 209 |
| 208 | 3300035695 | Ga0373927_0297247 | Ga0373927_0297247_78_749 | 209 |
| 209 | 3300035724 | Ga0373933_0000107 | Ga0373933_0000107_42140_42799 | 209 |
| 210 | 3300035725 | Ga0373947_0026360 | Ga0373947_0026360_2061_2732 | 209 |
| 211 | 3300035725 | Ga0373947_0101274 | Ga0373947_0101274_1054_1725 | 209 |
| 212 | 3300035725 | Ga0373947_0496790 | Ga0373947_0496790_183_815 | 209 |
| 213 | 3300036401 | Ga0373937_0000810 | Ga0373937_0000810_11167_11826 | 209 |
| 214 | 3300036401 | Ga0373937_0008090 | Ga0373937_0008090_5530_6189 | 209 |
| 215 | 3300036401 | Ga0373937_0031763 | Ga0373937_0031763_3848_4507 | 209 |
| 216 | 3300037068 | Ga0373925_0019590 | Ga0373925_0019590_2245_2916 | 209 |
| 217 | 3300037068 | Ga0373925_0050873 | Ga0373925_0050873_951_1610 | 209 |
| 218 | 3300042436 | Ga0439435_0115465 | Ga0439435_0115465_29_817 | 209 |
| 219 | 3300042876 | Ga0451577_0102038 | Ga0451577_0102038_426_1085 | 209 |
| 220 | 3300044712 | Ga0453684_0150383 | Ga0453684_0150383_656_1315 | 209 |
| 221 | 3300045051 | Ga0451576_0006018 | Ga0451576_0006018_1759_2418 | 209 |
| 222 | 3300045051 | Ga0451576_0022710 | Ga0451576_0022710_2983_3642 | 209 |
| 223 | 3300046454 | Ga0495592_0071528 | Ga0495592_0071528_1124_1783 | 209 |
| 224 | 3300046455 | Ga0495603_0003474 | Ga0495603_0003474_7830_8501 | 209 |
| 225 | 3300046459 | Ga0495629_0269151 | Ga0495629_0269151_410_1069 | 209 |
| 226 | 3300046461 | Ga0495641_0003233 | Ga0495641_0003233_10424_11083 | 209 |
| 227 | 3300046462 | Ga0495651_0000105 | Ga0495651_0000105_430_1089 | 209 |
| 228 | 3300046462 | Ga0495651_0003319 | Ga0495651_0003319_2083_2742 | 209 |
| 229 | 3300046463 | Ga0495653_0012885 | Ga0495653_0012885_511_1170 | 209 |
| 230 | 3300046472 | Ga0495580_0003325 | Ga0495580_0003325_12901_13572 | 209 |
| 231 | 3300046472 | Ga0495580_0026172 | Ga0495580_0026172_2076_2735 | 209 |
| 232 | 3300046473 | Ga0495582_0067044 | Ga0495582_0067044_1277_1948 | 209 |
| 233 | 3300046473 | Ga0495582_0073525 | Ga0495582_0073525_1018_1677 | 209 |
| 234 | 3300046475 | Ga0495639_0018448 | Ga0495639_0018448_1732_2391 | 209 |
| 235 | 3300046475 | Ga0495639_0018888 | Ga0495639_0018888_2072_2743 | 209 |
| 236 | 3300046476 | Ga0495662_0023260 | Ga0495662_0023260_423_1082 | 209 |
| 237 | 3300046511 | Ga0495608_0053894 | Ga0495608_0053894_1578_2237 | 209 |
| 238 | 3300046511 | Ga0495608_0326134 | Ga0495608_0326134_53_712 | 209 |
| 239 | 3300046516 | Ga0495628_0011511 | Ga0495628_0011511_677_1336 | 209 |
| 240 | 3300046516 | Ga0495628_0015785 | Ga0495628_0015785_2504_3163 | 209 |
| 241 | 3300046516 | Ga0495628_0052061 | Ga0495628_0052061_406_1191 | 209 |
| 242 | 3300046517 | Ga0495630_0008055 | Ga0495630_0008055_478_1137 | 209 |
| 243 | 3300046526 | Ga0495666_0026179 | Ga0495666_0026179_2060_2731 | 209 |
| 244 | 3300046526 | Ga0495666_0028857 | Ga0495666_0028857_366_1025 | 209 |
| 245 | 3300046529 | Ga0495652_0040846 | Ga0495652_0040846_365_1024 | 209 |
| 246 | 3300046531 | Ga0495665_0065227 | Ga0495665_0065227_177_848 | 209 |
| 247 | 3300046533 | Ga0495640_0022913 | Ga0495640_0022913_341_1000 | 209 |
| 248 | 3300046535 | Ga0495586_0003781 | Ga0495586_0003781_7255_7926 | 209 |
| 249 | 3300046535 | Ga0495586_0015739 | Ga0495586_0015739_746_1405 | 209 |
| 250 | 3300046535 | Ga0495586_0041096 | Ga0495586_0041096_167_826 | 209 |
| 251 | 3300046536 | Ga0495587_0002310 | Ga0495587_0002310_10128_10787 | 209 |
| 252 | 3300046543 | Ga0495645_0452795 | Ga0495645_0452795_112_765 | 209 |
| 253 | 3300046557 | Ga0495622_0172375 | Ga0495622_0172375_12_671 | 209 |
| 254 | 3300046559 | Ga0495667_0004692 | Ga0495667_0004692_1706_2365 | 209 |
| 255 | 3300046559 | Ga0495667_0219862 | Ga0495667_0219862_159_818 | 209 |
| 256 | 3300046559 | Ga0495667_0472739 | Ga0495667_0472739_69_728 | 209 |
| 257 | 3300046642 | Ga0495634_0012863 | Ga0495634_0012863_1837_2496 | 209 |
| 258 | 3300046674 | Ga0495588_0035553 | Ga0495588_0035553_803_1474 | 209 |
| 259 | 3300046675 | Ga0495657_0002627 | Ga0495657_0002627_3052_3711 | 209 |
| 260 | 3300046675 | Ga0495657_0160678 | Ga0495657_0160678_141_800 | 209 |
| 261 | 3300046678 | Ga0495599_0081236 | Ga0495599_0081236_603_1262 | 209 |
| 262 | 3300046681 | Ga0495647_0000588 | Ga0495647_0000588_8802_9461 | 209 |
| 263 | 3300046681 | Ga0495647_0001106 | Ga0495647_0001106_7394_8065 | 209 |
| 264 | 3300046683 | Ga0495658_0002559 | Ga0495658_0002559_2965_3636 | 209 |
| 265 | 3300046683 | Ga0495658_0047992 | Ga0495658_0047992_1237_1896 | 209 |
| 266 | 3300046683 | Ga0495658_0283913 | Ga0495658_0283913_242_1030 | 209 |
| 267 | 3300046684 | Ga0495669_0132397 | Ga0495669_0132397_514_1164 | 209 |
| 268 | 3300046689 | Ga0495613_0006955 | Ga0495613_0006955_6875_7534 | 209 |
| 269 | 3300046809 | Ga0495600_0000689 | Ga0495600_0000689_3195_3854 | 209 |
| 270 | 3300047315 | Ga0495581_0135214 | Ga0495581_0135214_422_1081 | 209 |
| 271 | 3300047317 | Ga0495604_0130574 | Ga0495604_0130574_746_1405 | 209 |
| 272 | 3300047319 | Ga0495674_0000463 | Ga0495674_0000463_23090_23749 | 209 |
| 273 | 3300047321 | Ga0495676_0056302 | Ga0495676_0056302_2387_3058 | 209 |
| 274 | 3300047322 | Ga0495680_0027640 | Ga0495680_0027640_3568_4227 | 209 |
| 275 | 3300047322 | Ga0495680_0228162 | Ga0495680_0228162_518_1300 | 209 |
| 276 | 3300047322 | Ga0495680_0352169 | Ga0495680_0352169_147_806 | 209 |
| 277 | 3300047471 | Ga0495684_0001586 | Ga0495684_0001586_1001_1660 | 209 |
| 278 | 3300048903 | Ga0496100_0039048 | Ga0496100_0039048_1951_2736 | 209 |
| 279 | 3300048904 | Ga0496101_0054297 | Ga0496101_0054297_92_877 | 209 |
| 280 | 3300048907 | Ga0496104_0002475 | Ga0496104_0002475_12998_13780 | 209 |
| 281 | 3300048907 | Ga0496104_0015427 | Ga0496104_0015427_440_1225 | 209 |
| 282 | 3300048908 | Ga0496105_0011725 | Ga0496105_0011725_4871_5653 | 209 |
| 283 | 3300048909 | Ga0496106_0019897 | Ga0496106_0019897_349_1131 | 209 |
| 284 | 3300048909 | Ga0496106_0039984 | Ga0496106_0039984_545_1330 | 209 |
| 285 | 3300048910 | Ga0496107_0168039 | Ga0496107_0168039_555_1337 | 209 |
| 286 | 3300048911 | Ga0496108_0431193 | Ga0496108_0431193_70_855 | 209 |
| 287 | 3300048913 | Ga0496110_0039992 | Ga0496110_0039992_1439_2221 | 209 |
| 288 | 3300048913 | Ga0496110_0052896 | Ga0496110_0052896_266_1051 | 209 |
| 289 | 3300048914 | Ga0496111_0024775 | Ga0496111_0024775_1380_2165 | 209 |
| 290 | 3300048915 | Ga0496112_0039691 | Ga0496112_0039691_1285_2070 | 209 |
| 291 | 3300048916 | Ga0496113_0025103 | Ga0496113_0025103_1310_2095 | 209 |
| 292 | 3300048917 | Ga0496114_0011772 | Ga0496114_0011772_2919_3704 | 209 |
| 293 | 3300048918 | Ga0496115_0063377 | Ga0496115_0063377_1787_2572 | 209 |
| 294 | 3300049824 | Ga0501045_0028707 | Ga0501045_0028707_224_976 | 209 |
| 295 | 3300050507 | nmdc:mga05p37_202939_c1 | nmdc:mga05p37_202939_c1_1341_2129 | 209 |
| 296 | 3300050507 | nmdc:mga05p37_2836_c1 | nmdc:mga05p37_2836_c1_3092_3751 | 209 |
| 297 | 3300050507 | nmdc:mga05p37_376862_c1 | nmdc:mga05p37_376862_c1_56_838 | 209 |
| 298 | 3300050508 | nmdc:mga09592_20267_c1 | nmdc:mga09592_20267_c1_3093_3752 | 209 |
| 299 | 3300050510 | nmdc:mga06r32_64989_c1 | nmdc:mga06r32_64989_c1_2650_3309 | 209 |
| 300 | 3300050511 | nmdc:mga08y16_134231_c1 | nmdc:mga08y16_134231_c1_1316_2104 | 209 |
| 301 | 3300050511 | nmdc:mga08y16_393340_c1 | nmdc:mga08y16_393340_c1_349_1131 | 209 |
| 302 | 3300050511 | nmdc:mga08y16_5446_c1 | nmdc:mga08y16_5446_c1_88_747 | 209 |
| 303 | 3300050511 | nmdc:mga08y16_66966_c1 | nmdc:mga08y16_66966_c1_1547_2191 | 209 |
| 304 | 3300050511 | nmdc:mga08y16_71427_c1 | nmdc:mga08y16_71427_c1_1930_2718 | 209 |
| 305 | 3300050512 | nmdc:mga0n895_598346_c1 | nmdc:mga0n895_598346_c1_20_679 | 209 |
| 306 | 3300050513 | nmdc:mga0rr50_63304_c1 | nmdc:mga0rr50_63304_c1_532_1314 | 209 |
| 307 | 3300050514 | nmdc:mga08x19_150217_c1 | nmdc:mga08x19_150217_c1_371_1030 | 209 |
| 308 | 3300050515 | nmdc:mga0a205_343573_c1 | nmdc:mga0a205_343573_c1_598_1347 | 209 |
| 309 | 3300053077 | Ga0495601_0030790 | Ga0495601_0030790_341_1126 | 209 |
| 310 | 3300053077 | Ga0495601_0031662 | Ga0495601_0031662_1825_2484 | 209 |
| 311 | 3300053077 | Ga0495601_0298229 | Ga0495601_0298229_166_819 | 209 |
| 312 | 3300053084 | Ga0495595_0008104 | Ga0495595_0008104_1459_2118 | 209 |
| 313 | 3300053085 | Ga0495619_0054003 | Ga0495619_0054003_1578_2237 | 209 |
| 314 | 3300053085 | Ga0495619_0072995 | Ga0495619_0072995_167_952 | 209 |
| 315 | 3300053094 | Ga0500566_0296010 | Ga0500566_0296010_50_709 | 209 |
| 316 | 3300005437 | Ga0070710_10060017 | Ga0070710_100600172 | 210 |
| 317 | 3300005458 | Ga0070681_10101280 | Ga0070681_101012802 | 210 |
| 318 | 3300005544 | Ga0070686_100593523 | Ga0070686_1005935232 | 210 |
| 319 | 3300005548 | Ga0070665_100014355 | Ga0070665_1000143554 | 210 |
| 320 | 3300005615 | Ga0070702_100093597 | Ga0070702_1000935972 | 210 |
| 321 | 3300005842 | Ga0068858_100077059 | Ga0068858_1000770593 | 210 |
| 322 | 3300006847 | Ga0075431_100055871 | Ga0075431_1000558715 | 210 |
| 323 | 3300006852 | Ga0075433_10020868 | Ga0075433_100208686 | 210 |
| 324 | 3300006852 | Ga0075433_10146101 | Ga0075433_101461013 | 210 |
| 325 | 3300006852 | Ga0075433_10442513 | Ga0075433_104425132 | 210 |
| 326 | 3300006871 | Ga0075434_100000018 | Ga0075434_10000001854 | 210 |
| 327 | 3300006880 | Ga0075429_100057163 | Ga0075429_1000571635 | 210 |
| 328 | 3300007076 | Ga0075435_100001709 | Ga0075435_1000017092 | 210 |
| 329 | 3300007076 | Ga0075435_100097126 | Ga0075435_1000971263 | 210 |
| 330 | 3300007265 | Ga0099794_10036918 | Ga0099794_100369182 | 210 |
| 331 | 3300009147 | Ga0114129_10539249 | Ga0114129_105392492 | 210 |
| 332 | 3300021384 | Ga0213876_10224120 | Ga0213876_102241201 | 210 |
| 333 | 3300021388 | Ga0213875_10005102 | Ga0213875_100051022 | 210 |
| 334 | 3300021441 | Ga0213871_10078997 | Ga0213871_100789972 | 210 |
| 335 | 3300025898 | Ga0207692_10036807 | Ga0207692_100368073 | 210 |
| 336 | 3300025905 | Ga0207685_10097946 | Ga0207685_100979461 | 210 |
| 337 | 3300025939 | Ga0207665_10783916 | Ga0207665_107839161 | 210 |
| 338 | 3300026035 | Ga0207703_10071140 | Ga0207703_100711403 | 210 |
| 339 | 3300026095 | Ga0207676_10179642 | Ga0207676_101796423 | 210 |
| 340 | 3300028379 | Ga0268266_10058329 | Ga0268266_100583292 | 210 |
| 341 | 3300033180 | Ga0307510_10000002 | Ga0307510_1000000257 | 210 |
| 342 | 3300034820 | Ga0373959_0034008 | Ga0373959_0034008_176_838 | 210 |
| 343 | 3300035092 | Ga0373952_0020693 | Ga0373952_0020693_143_805 | 210 |
| 344 | 3300035111 | Ga0373923_0023030 | Ga0373923_0023030_1453_2130 | 210 |
| 345 | 3300035118 | Ga0373954_0000012 | Ga0373954_0000012_26827_27504 | 210 |
| 346 | 3300035172 | Ga0373955_0010226 | Ga0373955_0010226_2789_3466 | 210 |
| 347 | 3300035172 | Ga0373955_0087656 | Ga0373955_0087656_769_1431 | 210 |
| 348 | 3300035410 | Ga0373924_0001386 | Ga0373924_0001386_1947_2609 | 210 |
| 349 | 3300035410 | Ga0373924_0110164 | Ga0373924_0110164_283_960 | 210 |
| 350 | 3300035724 | Ga0373933_0001549 | Ga0373933_0001549_4676_5353 | 210 |
| 351 | 3300035724 | Ga0373933_0049886 | Ga0373933_0049886_218_880 | 210 |
| 352 | 3300036401 | Ga0373937_0002420 | Ga0373937_0002420_6751_7428 | 210 |
| 353 | 3300039438 | Ga0436360_0512522 | Ga0436360_0512522_1139_1924 | 210 |
| 354 | 3300039447 | Ga0436361_0295678 | Ga0436361_0295678_723_1508 | 210 |
| 355 | 3300042436 | Ga0439435_0066788 | Ga0439435_0066788_215_1009 | 210 |
| 356 | 3300045051 | Ga0451576_0287673 | Ga0451576_0287673_25_687 | 210 |
| 357 | 3300045051 | Ga0451576_0679266 | Ga0451576_0679266_277_951 | 210 |
| 358 | 3300046535 | Ga0495586_0082594 | Ga0495586_0082594_919_1587 | 210 |
| 359 | 3300046675 | Ga0495657_0122590 | Ga0495657_0122590_600_1262 | 210 |
| 360 | 3300046690 | Ga0495624_0098587 | Ga0495624_0098587_49_717 | 210 |
| 361 | 3300047315 | Ga0495581_0077946 | Ga0495581_0077946_619_1287 | 210 |
| 362 | 3300047322 | Ga0495680_0037275 | Ga0495680_0037275_1319_1981 | 210 |
| 363 | 3300048929 | Ga0496126_0263616 | Ga0496126_0263616_535_1320 | 210 |
| 364 | 3300049571 | Ga0501034_0185291 | Ga0501034_0185291_54_839 | 210 |
| 365 | 3300049574 | Ga0501038_0000994 | Ga0501038_0000994_20872_21660 | 210 |
| 366 | 3300049575 | Ga0501039_0012378 | Ga0501039_0012378_3137_3925 | 210 |
| 367 | 3300049577 | Ga0501041_0003756 | Ga0501041_0003756_7763_8551 | 210 |
| 368 | 3300049578 | Ga0501042_0029632 | Ga0501042_0029632_1047_1835 | 210 |
| 369 | 3300049580 | Ga0501046_0004336 | Ga0501046_0004336_722_1510 | 210 |
| 370 | 3300049581 | Ga0501047_0135821 | Ga0501047_0135821_251_1039 | 210 |
| 371 | 3300049582 | Ga0501048_0000293 | Ga0501048_0000293_21878_22666 | 210 |
| 372 | 3300049584 | Ga0501068_0033695 | Ga0501068_0033695_2114_2902 | 210 |
| 373 | 3300049586 | Ga0501070_0047758 | Ga0501070_0047758_2613_3401 | 210 |
| 374 | 3300049587 | Ga0501071_0018669 | Ga0501071_0018669_3093_3881 | 210 |
| 375 | 3300049588 | Ga0501072_0008621 | Ga0501072_0008621_4955_5743 | 210 |
| 376 | 3300049590 | Ga0501074_0112907 | Ga0501074_0112907_958_1746 | 210 |
| 377 | 3300049593 | Ga0501077_0012170 | Ga0501077_0012170_1463_2251 | 210 |
| 378 | 3300049741 | Ga0501079_0004238 | Ga0501079_0004238_4396_5184 | 210 |
| 379 | 3300049741 | Ga0501079_0116300 | Ga0501079_0116300_838_1623 | 210 |
| 380 | 3300049743 | Ga0501081_0023597 | Ga0501081_0023597_2465_3253 | 210 |
| 381 | 3300049823 | Ga0501044_0409718 | Ga0501044_0409718_150_938 | 210 |
| 382 | 3300049824 | Ga0501045_0004598 | Ga0501045_0004598_8677_9465 | 210 |
| 383 | 3300050512 | nmdc:mga0n895_42155_c1 | nmdc:mga0n895_42155_c1_445_1230 | 210 |
| 384 | 3300050512 | nmdc:mga0n895_44924_c1 | nmdc:mga0n895_44924_c1_1107_1769 | 210 |
| 385 | 3300050512 | nmdc:mga0n895_67805_c1 | nmdc:mga0n895_67805_c1_2019_2687 | 210 |
| 386 | 3300050513 | nmdc:mga0rr50_154_c1 | nmdc:mga0rr50_154_c1_25758_26420 | 210 |
| 387 | 3300050513 | nmdc:mga0rr50_31682_c1 | nmdc:mga0rr50_31682_c1_1657_2442 | 210 |
| 388 | 3300050513 | nmdc:mga0rr50_570391_c1 | nmdc:mga0rr50_570391_c1_258_926 | 210 |
| 389 | 3300050514 | nmdc:mga08x19_2283_c1 | nmdc:mga08x19_2283_c1_1076_1738 | 210 |
| 390 | 3300050515 | nmdc:mga0a205_242_c1 | nmdc:mga0a205_242_c1_10206_10868 | 210 |
| 391 | 3300054114 | Ga0501084_0117467 | Ga0501084_0117467_727_1515 | 210 |
| 392 | 3300061734 | Ga0530510_0002046 | Ga0530510_0002046_5334_6122 | 210 |
| 393 | 3300005289 | Ga0065704_10384339 | Ga0065704_103843391 | 211 |
| 394 | 3300005290 | Ga0065712_10077951 | Ga0065712_100779513 | 211 |
| 395 | 3300005295 | Ga0065707_10227721 | Ga0065707_102277211 | 211 |
| 396 | 3300005328 | Ga0070676_10046768 | Ga0070676_100467682 | 211 |
| 397 | 3300005328 | Ga0070676_10050513 | Ga0070676_100505132 | 211 |
| 398 | 3300005329 | Ga0070683_100001483 | Ga0070683_10000148317 | 211 |
| 399 | 3300005330 | Ga0070690_100359312 | Ga0070690_1003593122 | 211 |
| 400 | 3300005331 | Ga0070670_100039308 | Ga0070670_1000393081 | 211 |
| 401 | 3300005331 | Ga0070670_100053843 | Ga0070670_1000538432 | 211 |
| 402 | 3300005331 | Ga0070670_100223753 | Ga0070670_1002237532 | 211 |
| 403 | 3300005334 | Ga0068869_100000766 | Ga0068869_1000007665 | 211 |
| 404 | 3300005335 | Ga0070666_10244038 | Ga0070666_102440381 | 211 |
| 405 | 3300005336 | Ga0070680_100201961 | Ga0070680_1002019612 | 211 |
| 406 | 3300005336 | Ga0070680_100252193 | Ga0070680_1002521931 | 211 |
| 407 | 3300005338 | Ga0068868_100013652 | Ga0068868_1000136524 | 211 |
| 408 | 3300005338 | Ga0068868_100020533 | Ga0068868_1000205333 | 211 |
| 409 | 3300005340 | Ga0070689_100065686 | Ga0070689_1000656863 | 211 |
| 410 | 3300005340 | Ga0070689_100078877 | Ga0070689_1000788772 | 211 |
| 411 | 3300005344 | Ga0070661_100008287 | Ga0070661_1000082875 | 211 |
| 412 | 3300005345 | Ga0070692_10111567 | Ga0070692_101115672 | 211 |
| 413 | 3300005347 | Ga0070668_100029893 | Ga0070668_1000298933 | 211 |
| 414 | 3300005353 | Ga0070669_100008399 | Ga0070669_1000083998 | 211 |
| 415 | 3300005354 | Ga0070675_100002980 | Ga0070675_1000029806 | 211 |
| 416 | 3300005354 | Ga0070675_100045202 | Ga0070675_1000452022 | 211 |
| 417 | 3300005354 | Ga0070675_100110141 | Ga0070675_1001101412 | 211 |
| 418 | 3300005355 | Ga0070671_100004931 | Ga0070671_1000049315 | 211 |
| 419 | 3300005355 | Ga0070671_100180001 | Ga0070671_1001800012 | 211 |
| 420 | 3300005356 | Ga0070674_100046248 | Ga0070674_1000462485 | 211 |
| 421 | 3300005356 | Ga0070674_100059454 | Ga0070674_1000594542 | 211 |
| 422 | 3300005364 | Ga0070673_100004828 | Ga0070673_1000048287 | 211 |
| 423 | 3300005364 | Ga0070673_100039188 | Ga0070673_1000391883 | 211 |
| 424 | 3300005364 | Ga0070673_100088996 | Ga0070673_1000889962 | 211 |
| 425 | 3300005364 | Ga0070673_100154931 | Ga0070673_1001549312 | 211 |
| 426 | 3300005365 | Ga0070688_100271769 | Ga0070688_1002717692 | 211 |
| 427 | 3300005367 | Ga0070667_100005133 | Ga0070667_1000051336 | 211 |
| 428 | 3300005441 | Ga0070700_100004515 | Ga0070700_1000045157 | 211 |
| 429 | 3300005444 | Ga0070694_100042550 | Ga0070694_1000425503 | 211 |
| 430 | 3300005444 | Ga0070694_100531996 | Ga0070694_1005319961 | 211 |
| 431 | 3300005455 | Ga0070663_100082456 | Ga0070663_1000824563 | 211 |
| 432 | 3300005456 | Ga0070678_100013046 | Ga0070678_1000130463 | 211 |
| 433 | 3300005457 | Ga0070662_100040483 | Ga0070662_1000404833 | 211 |
| 434 | 3300005458 | Ga0070681_10437682 | Ga0070681_104376822 | 211 |
| 435 | 3300005459 | Ga0068867_100000933 | Ga0068867_10000093318 | 211 |
| 436 | 3300005459 | Ga0068867_100032581 | Ga0068867_1000325814 | 211 |
| 437 | 3300005459 | Ga0068867_100047763 | Ga0068867_1000477633 | 211 |
| 438 | 3300005459 | Ga0068867_100946011 | Ga0068867_1009460111 | 211 |
| 439 | 3300005468 | Ga0070707_100471161 | Ga0070707_1004711612 | 211 |
| 440 | 3300005535 | Ga0070684_100027121 | Ga0070684_1000271214 | 211 |
| 441 | 3300005536 | Ga0070697_100004993 | Ga0070697_1000049935 | 211 |
| 442 | 3300005539 | Ga0068853_100321106 | Ga0068853_1003211062 | 211 |
| 443 | 3300005543 | Ga0070672_100018753 | Ga0070672_1000187534 | 211 |
| 444 | 3300005543 | Ga0070672_100117048 | Ga0070672_1001170482 | 211 |
| 445 | 3300005547 | Ga0070693_100245616 | Ga0070693_1002456162 | 211 |
| 446 | 3300005563 | Ga0068855_100103065 | Ga0068855_1001030652 | 211 |
| 447 | 3300005564 | Ga0070664_100032286 | Ga0070664_1000322861 | 211 |
| 448 | 3300005564 | Ga0070664_100101414 | Ga0070664_1001014142 | 211 |
| 449 | 3300005577 | Ga0068857_100005938 | Ga0068857_1000059382 | 211 |
| 450 | 3300005578 | Ga0068854_100027072 | Ga0068854_1000270722 | 211 |
| 451 | 3300005616 | Ga0068852_100004249 | Ga0068852_1000042497 | 211 |
| 452 | 3300005617 | Ga0068859_100042548 | Ga0068859_1000425483 | 211 |
| 453 | 3300005617 | Ga0068859_100303364 | Ga0068859_1003033642 | 211 |
| 454 | 3300005618 | Ga0068864_100007594 | Ga0068864_1000075943 | 211 |
| 455 | 3300005618 | Ga0068864_100013279 | Ga0068864_1000132794 | 211 |
| 456 | 3300005618 | Ga0068864_100172212 | Ga0068864_1001722122 | 211 |
| 457 | 3300005718 | Ga0068866_10050302 | Ga0068866_100503022 | 211 |
| 458 | 3300005718 | Ga0068866_10051532 | Ga0068866_100515323 | 211 |
| 459 | 3300005719 | Ga0068861_100002773 | Ga0068861_1000027735 | 211 |
| 460 | 3300005719 | Ga0068861_100010443 | Ga0068861_1000104433 | 211 |
| 461 | 3300005834 | Ga0068851_10009210 | Ga0068851_100092101 | 211 |
| 462 | 3300005840 | Ga0068870_10015905 | Ga0068870_100159053 | 211 |
| 463 | 3300005841 | Ga0068863_100080391 | Ga0068863_1000803913 | 211 |
| 464 | 3300005841 | Ga0068863_100103506 | Ga0068863_1001035062 | 211 |
| 465 | 3300005842 | Ga0068858_100007174 | Ga0068858_10000717411 | 211 |
| 466 | 3300005843 | Ga0068860_100034055 | Ga0068860_1000340553 | 211 |
| 467 | 3300005844 | Ga0068862_100011831 | Ga0068862_1000118314 | 211 |
| 468 | 3300005844 | Ga0068862_100020835 | Ga0068862_1000208354 | 211 |
| 469 | 3300006237 | Ga0097621_100039421 | Ga0097621_1000394214 | 211 |
| 470 | 3300006237 | Ga0097621_100208450 | Ga0097621_1002084502 | 211 |
| 471 | 3300006358 | Ga0068871_100025039 | Ga0068871_1000250392 | 211 |
| 472 | 3300006844 | Ga0075428_100925434 | Ga0075428_1009254341 | 211 |
| 473 | 3300006846 | Ga0075430_100067598 | Ga0075430_1000675984 | 211 |
| 474 | 3300006846 | Ga0075430_100075920 | Ga0075430_1000759203 | 211 |
| 475 | 3300006847 | Ga0075431_100003369 | Ga0075431_10000336911 | 211 |
| 476 | 3300006880 | Ga0075429_100012874 | Ga0075429_1000128744 | 211 |
| 477 | 3300006881 | Ga0068865_100006240 | Ga0068865_1000062407 | 211 |
| 478 | 3300006881 | Ga0068865_100084014 | Ga0068865_1000840143 | 211 |
| 479 | 3300006881 | Ga0068865_100146278 | Ga0068865_1001462782 | 211 |
| 480 | 3300006881 | Ga0068865_100313452 | Ga0068865_1003134522 | 211 |
| 481 | 3300006931 | Ga0097620_100042551 | Ga0097620_1000425513 | 211 |
| 482 | 3300006931 | Ga0097620_100135675 | Ga0097620_1001356752 | 211 |
| 483 | 3300006931 | Ga0097620_100303354 | Ga0097620_1003033542 | 211 |
| 484 | 3300009011 | Ga0105251_10051926 | Ga0105251_100519262 | 211 |
| 485 | 3300009094 | Ga0111539_10055424 | Ga0111539_100554245 | 211 |
| 486 | 3300009094 | Ga0111539_10074774 | Ga0111539_100747742 | 211 |
| 487 | 3300009094 | Ga0111539_10258370 | Ga0111539_102583702 | 211 |
| 488 | 3300009094 | Ga0111539_10307426 | Ga0111539_103074262 | 211 |
| 489 | 3300009098 | Ga0105245_10082640 | Ga0105245_100826403 | 211 |
| 490 | 3300009098 | Ga0105245_10102208 | Ga0105245_101022082 | 211 |
| 491 | 3300009101 | Ga0105247_10146606 | Ga0105247_101466062 | 211 |
| 492 | 3300009148 | Ga0105243_10043914 | Ga0105243_100439142 | 211 |
| 493 | 3300009176 | Ga0105242_10597170 | Ga0105242_105971702 | 211 |
| 494 | 3300009177 | Ga0105248_10028790 | Ga0105248_100287904 | 211 |
| 495 | 3300009177 | Ga0105248_10060761 | Ga0105248_100607614 | 211 |
| 496 | 3300009553 | Ga0105249_10004574 | Ga0105249_100045745 | 211 |
| 497 | 3300009553 | Ga0105249_10092777 | Ga0105249_100927772 | 211 |
| 498 | 3300009553 | Ga0105249_10221190 | Ga0105249_102211901 | 211 |
| 499 | 3300013104 | Ga0157370_10176374 | Ga0157370_101763742 | 211 |
| 500 | 3300013105 | Ga0157369_10207902 | Ga0157369_102079022 | 211 |
| 501 | 3300013296 | Ga0157374_10019315 | Ga0157374_100193156 | 211 |
| 502 | 3300013297 | Ga0157378_10033107 | Ga0157378_100331071 | 211 |
| 503 | 3300013297 | Ga0157378_10038691 | Ga0157378_100386913 | 211 |
| 504 | 3300013297 | Ga0157378_10039028 | Ga0157378_100390284 | 211 |
| 505 | 3300013306 | Ga0163162_10030171 | Ga0163162_100301715 | 211 |
| 506 | 3300013306 | Ga0163162_10076028 | Ga0163162_100760282 | 211 |
| 507 | 3300013308 | Ga0157375_10015951 | Ga0157375_100159517 | 211 |
| 508 | 3300013308 | Ga0157375_10056999 | Ga0157375_100569993 | 211 |
| 509 | 3300013308 | Ga0157375_10259599 | Ga0157375_102595992 | 211 |
| 510 | 3300013308 | Ga0157375_10332824 | Ga0157375_103328242 | 211 |
| 511 | 3300014326 | Ga0157380_10014049 | Ga0157380_100140497 | 211 |
| 512 | 3300014326 | Ga0157380_10268051 | Ga0157380_102680512 | 211 |
| 513 | 3300014968 | Ga0157379_10005009 | Ga0157379_100050092 | 211 |
| 514 | 3300014969 | Ga0157376_10003398 | Ga0157376_100033984 | 211 |
| 515 | 3300014969 | Ga0157376_10005968 | Ga0157376_100059688 | 211 |
| 516 | 3300025315 | Ga0207697_10055368 | Ga0207697_100553682 | 211 |
| 517 | 3300025893 | Ga0207682_10074392 | Ga0207682_100743922 | 211 |
| 518 | 3300025899 | Ga0207642_10049559 | Ga0207642_100495593 | 211 |
| 519 | 3300025899 | Ga0207642_10078436 | Ga0207642_100784362 | 211 |
| 520 | 3300025899 | Ga0207642_10188381 | Ga0207642_101883812 | 211 |
| 521 | 3300025907 | Ga0207645_10062708 | Ga0207645_100627082 | 211 |
| 522 | 3300025907 | Ga0207645_10207559 | Ga0207645_102075592 | 211 |
| 523 | 3300025908 | Ga0207643_10006986 | Ga0207643_100069867 | 211 |
| 524 | 3300025912 | Ga0207707_10268490 | Ga0207707_102684902 | 211 |
| 525 | 3300025918 | Ga0207662_10065002 | Ga0207662_100650023 | 211 |
| 526 | 3300025920 | Ga0207649_10014627 | Ga0207649_100146272 | 211 |
| 527 | 3300025920 | Ga0207649_10380099 | Ga0207649_103800991 | 211 |
| 528 | 3300025922 | Ga0207646_10393884 | Ga0207646_103938842 | 211 |
| 529 | 3300025922 | Ga0207646_10488270 | Ga0207646_104882702 | 211 |
| 530 | 3300025923 | Ga0207681_10002427 | Ga0207681_100024279 | 211 |
| 531 | 3300025923 | Ga0207681_10126276 | Ga0207681_101262762 | 211 |
| 532 | 3300025925 | Ga0207650_10009035 | Ga0207650_100090351 | 211 |
| 533 | 3300025925 | Ga0207650_10038898 | Ga0207650_100388983 | 211 |
| 534 | 3300025926 | Ga0207659_10064900 | Ga0207659_100649002 | 211 |
| 535 | 3300025927 | Ga0207687_10042502 | Ga0207687_100425023 | 211 |
| 536 | 3300025933 | Ga0207706_10112282 | Ga0207706_101122822 | 211 |
| 537 | 3300025934 | Ga0207686_10425358 | Ga0207686_104253582 | 211 |
| 538 | 3300025935 | Ga0207709_10003995 | Ga0207709_100039952 | 211 |
| 539 | 3300025936 | Ga0207670_10019339 | Ga0207670_100193395 | 211 |
| 540 | 3300025936 | Ga0207670_10059051 | Ga0207670_100590513 | 211 |
| 541 | 3300025936 | Ga0207670_10410352 | Ga0207670_104103522 | 211 |
| 542 | 3300025937 | Ga0207669_10039565 | Ga0207669_100395654 | 211 |
| 543 | 3300025937 | Ga0207669_10068717 | Ga0207669_100687172 | 211 |
| 544 | 3300025938 | Ga0207704_10001267 | Ga0207704_100012677 | 211 |
| 545 | 3300025938 | Ga0207704_10118319 | Ga0207704_101183192 | 211 |
| 546 | 3300025938 | Ga0207704_10151695 | Ga0207704_101516952 | 211 |
| 547 | 3300025940 | Ga0207691_10004344 | Ga0207691_100043448 | 211 |
| 548 | 3300025940 | Ga0207691_10068861 | Ga0207691_100688614 | 211 |
| 549 | 3300025940 | Ga0207691_10141828 | Ga0207691_101418282 | 211 |
| 550 | 3300025941 | Ga0207711_10283498 | Ga0207711_102834982 | 211 |
| 551 | 3300025942 | Ga0207689_10001267 | Ga0207689_1000126710 | 211 |
| 552 | 3300025944 | Ga0207661_10002250 | Ga0207661_100022506 | 211 |
| 553 | 3300025945 | Ga0207679_10011613 | Ga0207679_100116133 | 211 |
| 554 | 3300025945 | Ga0207679_10133432 | Ga0207679_101334322 | 211 |
| 555 | 3300025960 | Ga0207651_10011744 | Ga0207651_100117443 | 211 |
| 556 | 3300025960 | Ga0207651_10056867 | Ga0207651_100568673 | 211 |
| 557 | 3300025960 | Ga0207651_10074117 | Ga0207651_100741172 | 211 |
| 558 | 3300025961 | Ga0207712_10006352 | Ga0207712_100063527 | 211 |
| 559 | 3300025961 | Ga0207712_10041924 | Ga0207712_100419243 | 211 |
| 560 | 3300025981 | Ga0207640_10025271 | Ga0207640_100252713 | 211 |
| 561 | 3300026023 | Ga0207677_10008899 | Ga0207677_100088992 | 211 |
| 562 | 3300026035 | Ga0207703_10005035 | Ga0207703_100050359 | 211 |
| 563 | 3300026041 | Ga0207639_10292976 | Ga0207639_102929762 | 211 |
| 564 | 3300026075 | Ga0207708_10014298 | Ga0207708_100142983 | 211 |
| 565 | 3300026075 | Ga0207708_10039912 | Ga0207708_100399122 | 211 |
| 566 | 3300026088 | Ga0207641_10029278 | Ga0207641_100292786 | 211 |
| 567 | 3300026088 | Ga0207641_10087012 | Ga0207641_100870122 | 211 |
| 568 | 3300026089 | Ga0207648_10002758 | Ga0207648_1000275819 | 211 |
| 569 | 3300026089 | Ga0207648_10007543 | Ga0207648_100075432 | 211 |
| 570 | 3300026089 | Ga0207648_10063238 | Ga0207648_100632382 | 211 |
| 571 | 3300026089 | Ga0207648_10928445 | Ga0207648_109284452 | 211 |
| 572 | 3300026095 | Ga0207676_10157379 | Ga0207676_101573792 | 211 |
| 573 | 3300026095 | Ga0207676_10158790 | Ga0207676_101587902 | 211 |
| 574 | 3300026116 | Ga0207674_10036389 | Ga0207674_100363896 | 211 |
| 575 | 3300026118 | Ga0207675_100002436 | Ga0207675_10000243615 | 211 |
| 576 | 3300026118 | Ga0207675_100019002 | Ga0207675_1000190025 | 211 |
| 577 | 3300026121 | Ga0207683_10001605 | Ga0207683_1000160516 | 211 |
| 578 | 3300026142 | Ga0207698_10009224 | Ga0207698_100092244 | 211 |
| 579 | 3300027462 | Ga0210000_1006284 | Ga0210000_10062842 | 211 |
| 580 | 3300027471 | Ga0209995_1003052 | Ga0209995_10030524 | 211 |
| 581 | 3300027665 | Ga0209983_1004825 | Ga0209983_10048252 | 211 |
| 582 | 3300027876 | Ga0209974_10020791 | Ga0209974_100207913 | 211 |
| 583 | 3300027907 | Ga0207428_10216925 | Ga0207428_102169252 | 211 |
| 584 | 3300028379 | Ga0268266_10212260 | Ga0268266_102122602 | 211 |
| 585 | 3300028380 | Ga0268265_10001812 | Ga0268265_100018125 | 211 |
| 586 | 3300028380 | Ga0268265_10081646 | Ga0268265_100816462 | 211 |
| 587 | 3300028380 | Ga0268265_10092160 | Ga0268265_100921603 | 211 |
| 588 | 3300028381 | Ga0268264_10018097 | Ga0268264_100180972 | 211 |
| 589 | 3300028577 | Ga0265318_10007463 | Ga0265318_100074633 | 211 |
| 590 | 3300031235 | Ga0265330_10005907 | Ga0265330_100059073 | 211 |
| 591 | 3300031238 | Ga0265332_10012748 | Ga0265332_100127484 | 211 |
| 592 | 3300031240 | Ga0265320_10045606 | Ga0265320_100456062 | 211 |
| 593 | 3300031344 | Ga0265316_10029413 | Ga0265316_100294132 | 211 |
| 594 | 3300031711 | Ga0265314_10003722 | Ga0265314_1000372212 | 211 |
| 595 | 3300031911 | Ga0307412_10280111 | Ga0307412_102801111 | 211 |
| 596 | 3300032002 | Ga0307416_100108630 | Ga0307416_1001086302 | 211 |
| 597 | 3300035092 | Ga0373952_0063544 | Ga0373952_0063544_178_852 | 211 |
| 598 | 3300046528 | Ga0495642_0253927 | Ga0495642_0253927_14_754 | 211 |
| 599 | 3300046684 | Ga0495669_0074223 | Ga0495669_0074223_898_1533 | 211 |
| 600 | 3300048905 | Ga0496102_0165138 | Ga0496102_0165138_943_1776 | 211 |
| 601 | 3300048906 | Ga0496103_0152173 | Ga0496103_0152173_378_1187 | 211 |
| 602 | 3300048911 | Ga0496108_0009808 | Ga0496108_0009808_1625_2413 | 211 |
| 603 | 3300048911 | Ga0496108_0134102 | Ga0496108_0134102_744_1577 | 211 |
| 604 | 3300048917 | Ga0496114_0200860 | Ga0496114_0200860_257_1045 | 211 |
| 605 | 3300049514 | Ga0501291_043531 | Ga0501291_043531_112_762 | 211 |
| 606 | 3300049572 | Ga0501036_0229446 | Ga0501036_0229446_382_1170 | 211 |
| 607 | 3300049573 | Ga0501037_0003806 | Ga0501037_0003806_8333_9121 | 211 |
| 608 | 3300049575 | Ga0501039_0003932 | Ga0501039_0003932_2799_3587 | 211 |
| 609 | 3300049576 | Ga0501040_0030971 | Ga0501040_0030971_2060_2848 | 211 |
| 610 | 3300049577 | Ga0501041_0004135 | Ga0501041_0004135_5661_6449 | 211 |
| 611 | 3300049578 | Ga0501042_0006414 | Ga0501042_0006414_5494_6282 | 211 |
| 612 | 3300049579 | Ga0501043_0010120 | Ga0501043_0010120_2391_3179 | 211 |
| 613 | 3300049584 | Ga0501068_0244525 | Ga0501068_0244525_264_1052 | 211 |
| 614 | 3300049587 | Ga0501071_0024763 | Ga0501071_0024763_2888_3676 | 211 |
| 615 | 3300049588 | Ga0501072_0067258 | Ga0501072_0067258_1727_2515 | 211 |
| 616 | 3300049588 | Ga0501072_0302661 | Ga0501072_0302661_464_1249 | 211 |
| 617 | 3300049591 | Ga0501075_0002497 | Ga0501075_0002497_9256_10044 | 211 |
| 618 | 3300049592 | Ga0501076_0002131 | Ga0501076_0002131_1126_1914 | 211 |
| 619 | 3300049741 | Ga0501079_0008832 | Ga0501079_0008832_2580_3368 | 211 |
| 620 | 3300049742 | Ga0501080_0018160 | Ga0501080_0018160_244_1032 | 211 |
| 621 | 3300049743 | Ga0501081_0000696 | Ga0501081_0000696_2750_3538 | 211 |
| 622 | 3300049824 | Ga0501045_0012797 | Ga0501045_0012797_4027_4815 | 211 |
| 623 | 3300050508 | nmdc:mga09592_12321_c1 | nmdc:mga09592_12321_c1_1175_1963 | 211 |
| 624 | 3300050509 | nmdc:mga0qj67_161179_c1 | nmdc:mga0qj67_161179_c1_156_944 | 211 |
| 625 | 3300050511 | nmdc:mga08y16_124999_c1 | nmdc:mga08y16_124999_c1_1339_2013 | 211 |
| 626 | 3300050511 | nmdc:mga08y16_141826_c1 | nmdc:mga08y16_141826_c1_410_1060 | 211 |
| 627 | 3300050511 | nmdc:mga08y16_35981_c1 | nmdc:mga08y16_35981_c1_1738_2526 | 211 |
| 628 | 3300054114 | Ga0501084_0018451 | Ga0501084_0018451_329_1117 | 211 |
| 629 | 3300059421 | Ga0590071_026700 | Ga0590071_026700_164_952 | 211 |
| 630 | 3300060353 | Ga0501082_0000754 | Ga0501082_0000754_2645_3433 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pfz-assembly1.cif.gz_A | x-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis | 0.9459 | 2 | 209 |
| 3qdf-assembly1.cif.gz_A | crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum | 0.9454 | 2 | 211 |
| 1wzo-assembly1.cif.gz_A | crystal structure of the hpce from thermus thermophilus hb8 | 0.9438 | 2 | 210 |
| 6jvv-assembly1.cif.gz_A | crystal structure of maleylpyruvate hydrolase from sphingobium.sp syk-6 | 0.9376 | 2 | 209 |
| 1wzo-assembly1.cif.gz_C | crystal structure of the hpce from thermus thermophilus hb8 | 0.9308 | 2 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wzoC02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9382 | 2 | 209 | 3.90.850.10 |
| 6jvvA02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9376 | 2 | 209 | 3.90.850.10 |
| 1wzoC02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9243 | 2 | 209 | 3.90.850.10 |
| 6jvvA02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9182 | 2 | 209 | 3.90.850.10 |
| af_Q54BF3_56_305_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9066 | 2 | 206 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E2V841-F1-model_v4 | 2-keto-4-pentenoate hydratase | 0.9851 | 29 | 210 |
GO:0003824
GO:0044281 |
| AF-A0A2D9STH8-F1-model_v4 | 2-keto-4-pentenoate hydratase | 0.984 | 2 | 211 |
GO:0003824
GO:0044281 |
| AF-A0A7C7P346-F1-model_v4 | DUF2437 domain-containing protein | 0.982 | 2 | 177 |
GO:0003824
GO:0044281 |
| AF-A0A2E2V841-F1-model_v4 | 2-keto-4-pentenoate hydratase | 0.9797 | 29 | 210 |
GO:0003824
GO:0044281 |
| AF-A0A536WUQ4-F1-model_v4 | Fumarylacetoacetate hydrolase family protein | 0.9761 | 2 | 211 |
GO:0016787
GO:0044281 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar