F470717

General Info

Members Datasets Scaffolds Average Seq Length
629 302 1258 67

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_102112399|Ga0070679_1021123991
Length 77
Sequence MRPRGGLFNIMATGIVKWFNDDKGFGFITPDEGGKDLFVHHTGINSNGFRTLAEGAKVSYDAEAGDKGPKAVNVTIL

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
98 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
99 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
118 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
181 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
182 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
183 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
211 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
212 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
217 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
218 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 6.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 7.47
Rhizosphere 89.83
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_102112399 3300005530 Bacteria 513
2 JGI24735J21928_10087958 3300002067 Bacteria 890
3 JGI24745J21846_1018138 3300002073 Bacteria 820
4 JGI24738J21930_10118652 3300002075 Bacteria 573
5 Ga0006778J45830_1037573 3300003162 Bacteria 541
6 JGI25407J50210_10010502 3300003373 Bacteria 2357
7 Ga0058859_11691900 3300004798 Bacteria 610
8 Ga0058863_10031804 3300004799 Bacteria 866
9 Ga0058863_10071273 3300004799 Bacteria 512
10 Ga0058861_11806899 3300004800 Bacteria 794
11 Ga0058861_11955149 3300004800 Bacteria 566
12 Ga0058862_10066726 3300004803 Bacteria 748
13 Ga0058862_12831607 3300004803 Bacteria 751
14 Ga0070658_10618680 3300005327 Bacteria 939
15 Ga0070658_11169785 3300005327 Bacteria 669
16 Ga0070683_100008794 3300005329 Bacteria 8587
17 Ga0070683_100095360 3300005329 Bacteria 2797
18 Ga0070683_100129069 3300005329 Bacteria 2391
19 Ga0070683_100225318 3300005329 Bacteria 1782
20 Ga0070683_100611139 3300005329 Bacteria 1043
21 Ga0070683_101057060 3300005329 Bacteria 780
22 Ga0068869_100434991 3300005334 Bacteria 1085
23 Ga0070680_100012714 3300005336 Bacteria 6542
24 Ga0070680_100184185 3300005336 Bacteria 1759
25 Ga0070680_100218387 3300005336 Bacteria 1609
26 Ga0070682_100014290 3300005337 Bacteria 4585
27 Ga0068868_100031766 3300005338 Bacteria 4059
28 Ga0068868_100113021 3300005338 Bacteria 2208
29 Ga0068868_101503088 3300005338 Bacteria 631
30 Ga0068868_101723696 3300005338 Bacteria 591
31 Ga0068868_101825744 3300005338 Bacteria 575
32 Ga0070660_100103558 3300005339 Bacteria 2257
33 Ga0070660_100171422 3300005339 Bacteria 1753
34 Ga0070687_100331386 3300005343 Bacteria 976
35 Ga0070661_100101982 3300005344 Bacteria 2136
36 Ga0070661_100174903 3300005344 Bacteria 1631
37 Ga0070661_100838831 3300005344 Bacteria 756
38 Ga0070692_10187065 3300005345 Bacteria 1204
39 Ga0070692_10397489 3300005345 Bacteria 869
40 Ga0070668_100094938 3300005347 Bacteria 2355
41 Ga0070668_100181229 3300005347 Bacteria 1721
42 Ga0070668_100532147 3300005347 Bacteria 1021
43 Ga0070668_100549933 3300005347 Bacteria 1005
44 Ga0070675_100072938 3300005354 Bacteria 2850
45 Ga0070671_100123083 3300005355 Bacteria 2183
46 Ga0070674_100180935 3300005356 Bacteria 1615
47 Ga0070673_102143726 3300005364 Bacteria 531
48 Ga0070659_100067879 3300005366 Bacteria 2828
49 Ga0070659_100203577 3300005366 Bacteria 1630
50 Ga0070659_100433332 3300005366 Bacteria 1113
51 Ga0070659_100770030 3300005366 Bacteria 836
52 Ga0070667_101864829 3300005367 Bacteria 566
53 Ga0070709_10176307 3300005434 Bacteria 1498
54 Ga0070709_10293188 3300005434 Bacteria 1186
55 Ga0070714_101110478 3300005435 Bacteria 771
56 Ga0070710_10505592 3300005437 Bacteria 828
57 Ga0070710_10854740 3300005437 Bacteria 654
58 Ga0070701_10317404 3300005438 Bacteria 963
59 Ga0070701_11393018 3300005438 Bacteria 504
60 Ga0070711_100160500 3300005439 Bacteria 1704
61 Ga0070700_100000915 3300005441 Bacteria 14574
62 Ga0070700_100185784 3300005441 Bacteria 1450
63 Ga0070694_101109721 3300005444 Bacteria 660
64 Ga0070663_100049078 3300005455 Bacteria 2995
65 Ga0070663_100128170 3300005455 Bacteria 1924
66 Ga0070663_100424686 3300005455 Bacteria 1091
67 Ga0070663_100858131 3300005455 Bacteria 782
68 Ga0070663_101202929 3300005455 Bacteria 666
69 Ga0070663_102022997 3300005455 Bacteria 519
70 Ga0070662_100074505 3300005457 Bacteria 2511
71 Ga0070662_101602059 3300005457 Bacteria 562
72 Ga0070662_102007647 3300005457 Bacteria 500
73 Ga0070681_10142461 3300005458 Bacteria 2326
74 Ga0070681_10430328 3300005458 Bacteria 1232
75 Ga0068867_100674086 3300005459 Unclassified 910
76 Ga0070685_10128836 3300005466 Bacteria 1580
77 Ga0070679_100028040 3300005530 Bacteria 5548
78 Ga0070679_100030829 3300005530 Bacteria 5298
79 Ga0070679_100105129 3300005530 Bacteria 2809
80 Ga0070679_100628203 3300005530 Bacteria 1017
81 Ga0070679_100906905 3300005530 Bacteria 825
82 Ga0070684_100022597 3300005535 Bacteria 5249
83 Ga0070684_100174540 3300005535 Bacteria 1953
84 Ga0070684_100941312 3300005535 Bacteria 810
85 Ga0068853_100047196 3300005539 Bacteria 3696
86 Ga0068853_101055673 3300005539 Bacteria 783
87 Ga0070672_101955975 3300005543 Bacteria 528
88 Ga0070695_100430328 3300005545 Bacteria 1007
89 Ga0070695_101551894 3300005545 Bacteria 552
90 Ga0070696_100545730 3300005546 Bacteria 928
91 Ga0070693_100411827 3300005547 Bacteria 940
92 Ga0070665_100012942 3300005548 Bacteria 8402
93 Ga0070665_100126994 3300005548 Bacteria 2553
94 Ga0070704_100933218 3300005549 Bacteria 782
95 Ga0068855_100441731 3300005563 Bacteria 1421
96 Ga0068855_100932369 3300005563 Bacteria 916
97 Ga0070664_100008366 3300005564 Bacteria 8364
98 Ga0070664_100136327 3300005564 Bacteria 2159
99 Ga0070664_101542920 3300005564 Bacteria 629
100 Ga0068857_100352694 3300005577 Bacteria 1363
101 Ga0068857_100741698 3300005577 Bacteria 935
102 Ga0068854_100015270 3300005578 Bacteria 5083
103 Ga0068854_100041243 3300005578 Bacteria 3261
104 Ga0068854_100349697 3300005578 Bacteria 1209
105 Ga0068856_100003218 3300005614 Bacteria 16627
106 Ga0068856_100003467 3300005614 Bacteria 15940
107 Ga0068856_100035993 3300005614 Bacteria 4854
108 Ga0068856_100080843 3300005614 Bacteria 3224
109 Ga0068856_100639134 3300005614 Bacteria 1085
110 Ga0068856_100891185 3300005614 Bacteria 908
111 Ga0070702_100173171 3300005615 Bacteria 1406
112 Ga0070702_100243491 3300005615 Bacteria 1215
113 Ga0070702_101284739 3300005615 Bacteria 593
114 Ga0068852_100052503 3300005616 Bacteria 3504
115 Ga0068852_100115189 3300005616 Bacteria 2450
116 Ga0068852_101234165 3300005616 Bacteria 769
117 Ga0068852_101559823 3300005616 Bacteria 683
118 Ga0068859_101331052 3300005617 Bacteria 792
119 Ga0068864_100027360 3300005618 Bacteria 4816
120 Ga0068866_10009080 3300005718 Bacteria 4214
121 Ga0068866_10625379 3300005718 Bacteria 730
122 Ga0068861_100244469 3300005719 Bacteria 1528
123 Ga0068861_101754613 3300005719 Bacteria 615
124 Ga0068861_102276432 3300005719 Bacteria 544
125 Ga0068851_10275377 3300005834 Bacteria 961
126 Ga0068858_100700079 3300005842 Bacteria 986
127 Ga0068858_100845175 3300005842 Bacteria 894
128 Ga0068860_100350120 3300005843 Bacteria 1454
129 Ga0068862_101381103 3300005844 Unclassified 707
130 Ga0081538_10008407 3300005981 Bacteria 8769
131 Ga0081538_10015488 3300005981 Bacteria 5897
132 Ga0081540_1014933 3300005983 Bacteria 4940
133 Ga0081540_1071722 3300005983 Bacteria 1599
134 Ga0081539_10082521 3300005985 Bacteria 1685
135 Ga0075365_10679575 3300006038 Bacteria 727
136 Ga0075365_10810136 3300006038 Bacteria 661
137 Ga0075365_11154377 3300006038 Bacteria 545
138 Ga0075364_10938602 3300006051 Bacteria 589
139 Ga0075432_10042008 3300006058 Bacteria 1599
140 Ga0075432_10083500 3300006058 Bacteria 1161
141 Ga0075432_10418714 3300006058 Bacteria 582
142 Ga0075432_10546067 3300006058 Bacteria 523
143 Ga0070716_100429215 3300006173 Bacteria 958
144 Ga0070712_100004725 3300006175 Bacteria 8423
145 Ga0070712_101410656 3300006175 Bacteria 608
146 Ga0075370_11009828 3300006353 Bacteria 510
147 Ga0068871_101304509 3300006358 Bacteria 683
148 Ga0068871_102019896 3300006358 Bacteria 549
149 Ga0075428_100463588 3300006844 Bacteria 1356
150 Ga0075428_100482580 3300006844 Bacteria 1327
151 Ga0075428_101003293 3300006844 Bacteria 884
152 Ga0075428_101754935 3300006844 Bacteria 647
153 Ga0075428_101919243 3300006844 Bacteria 615
154 Ga0075430_100179394 3300006846 Bacteria 1762
155 Ga0075430_100491512 3300006846 Bacteria 1013
156 Ga0075431_100034755 3300006847 Bacteria 5192
157 Ga0075431_100135951 3300006847 Bacteria 2534
158 Ga0075431_100193241 3300006847 Bacteria 2085
159 Ga0075431_100246610 3300006847 Bacteria 1816
160 Ga0075431_100590071 3300006847 Bacteria 1096
161 Ga0075433_10003522 3300006852 Bacteria 12089
162 Ga0075433_10035409 3300006852 Bacteria 4293
163 Ga0075433_10089508 3300006852 Bacteria 2720
164 Ga0075434_100042159 3300006871 Bacteria 4523
165 Ga0075434_100244954 3300006871 Bacteria 1812
166 Ga0075434_100377387 3300006871 Bacteria 1439
167 Ga0075429_101123555 3300006880 Bacteria 686
168 Ga0068865_100097036 3300006881 Bacteria 2150
169 Ga0068865_101397737 3300006881 Bacteria 625
170 Ga0075436_100020660 3300006914 Bacteria 4518
171 Ga0075436_100062041 3300006914 Bacteria 2583
172 Ga0097620_101331148 3300006931 Bacteria 792
173 Ga0075435_100011209 3300007076 Bacteria 6580
174 Ga0075435_100297256 3300007076 Bacteria 1380
175 Ga0075435_100346175 3300007076 Bacteria 1274
176 Ga0105240_10032516 3300009093 Bacteria 6754
177 Ga0111539_10029871 3300009094 Bacteria 6630
178 Ga0111539_10077317 3300009094 Bacteria 3917
179 Ga0111539_10118101 3300009094 Bacteria 3108
180 Ga0111539_10450108 3300009094 Bacteria 1499
181 Ga0105245_10001866 3300009098 Bacteria 19157
182 Ga0105245_10841044 3300009098 Bacteria 957
183 Ga0105245_11158955 3300009098 Bacteria 820
184 Ga0105245_11291875 3300009098 Bacteria 779
185 Ga0105245_11691694 3300009098 Bacteria 685
186 Ga0105247_11286031 3300009101 Bacteria 587
187 Ga0105247_11675675 3300009101 Bacteria 525
188 Ga0114129_10505027 3300009147 Bacteria 1579
189 Ga0114129_11366938 3300009147 Bacteria 875
190 Ga0114129_11888939 3300009147 Bacteria 724
191 Ga0114129_12220569 3300009147 Bacteria 660
192 Ga0105243_10090806 3300009148 Bacteria 2514
193 Ga0105243_10176215 3300009148 Bacteria 1856
194 Ga0105243_10336628 3300009148 Bacteria 1381
195 Ga0105243_10699148 3300009148 Bacteria 988
196 Ga0105243_10867577 3300009148 Bacteria 895
197 Ga0105241_10132943 3300009174 Bacteria 2017
198 Ga0105241_10685521 3300009174 Bacteria 934
199 Ga0105242_10117870 3300009176 Bacteria 2274
200 Ga0105242_10297617 3300009176 Bacteria 1471
201 Ga0105242_12584415 3300009176 Bacteria 557
202 Ga0105242_12729538 3300009176 Bacteria 544
203 Ga0105248_10605975 3300009177 Bacteria 1236
204 Ga0105248_10639301 3300009177 Bacteria 1200
205 Ga0105248_10871875 3300009177 Bacteria 1016
206 Ga0105237_10001629 3300009545 Bacteria 29136
207 Ga0105237_10097582 3300009545 Bacteria 2929
208 Ga0105237_10268109 3300009545 Bacteria 1710
209 Ga0105237_10980957 3300009545 Bacteria 852
210 Ga0105238_10054931 3300009551 Bacteria 3999
211 Ga0105238_10165690 3300009551 Bacteria 2185
212 Ga0105238_11072248 3300009551 Bacteria 828
213 Ga0105249_10205309 3300009553 Bacteria 1930
214 Ga0105249_10474426 3300009553 Bacteria 1293
215 Ga0105249_10859191 3300009553 Bacteria 973
216 Ga0105239_10027496 3300010375 Bacteria 6261
217 Ga0105239_10459254 3300010375 Bacteria 1445
218 Ga0105239_10705226 3300010375 Bacteria 1154
219 Ga0105239_11355524 3300010375 Bacteria 821
220 Ga0105239_11844505 3300010375 Bacteria 701
221 Ga0105239_12668936 3300010375 Unclassified 583
222 Ga0105246_10063706 3300011119 Bacteria 2572
223 Ga0105246_10103191 3300011119 Bacteria 2080
224 Ga0157344_1011318 3300012476 Bacteria 655
225 Ga0157320_1014900 3300012481 Bacteria 652
226 Ga0157347_1026127 3300012502 Bacteria 710
227 Ga0157371_10287727 3300013102 Bacteria 1188
228 Ga0157371_10580228 3300013102 Bacteria 833
229 Ga0157370_10055229 3300013104 Bacteria 3784
230 Ga0157369_10139539 3300013105 Bacteria 2565
231 Ga0157369_11165891 3300013105 Bacteria 787
232 Ga0157374_10104157 3300013296 Bacteria 2724
233 Ga0157374_10521942 3300013296 Bacteria 1193
234 Ga0157378_10362867 3300013297 Bacteria 1418
235 Ga0163162_10604365 3300013306 Bacteria 1223
236 Ga0163162_11293008 3300013306 Bacteria 829
237 Ga0163162_12864819 3300013306 Bacteria 555
238 Ga0157372_10002922 3300013307 Bacteria 18455
239 Ga0157372_10033847 3300013307 Bacteria 5615
240 Ga0157372_10113244 3300013307 Bacteria 3109
241 Ga0157372_10127749 3300013307 Bacteria 2923
242 Ga0157372_10827303 3300013307 Bacteria 1075
243 Ga0157372_11389891 3300013307 Bacteria 809
244 Ga0157372_11621890 3300013307 Bacteria 745
245 Ga0157372_11856709 3300013307 Bacteria 693
246 Ga0157372_11892415 3300013307 Bacteria 686
247 Ga0157372_13334564 3300013307 Bacteria 511
248 Ga0157375_10104776 3300013308 Bacteria 2918
249 Ga0157375_11228234 3300013308 Bacteria 880
250 Ga0157375_11993139 3300013308 Bacteria 690
251 Ga0163163_10644566 3300014325 Bacteria 1123
252 Ga0163163_10827643 3300014325 Bacteria 989
253 Ga0157380_10044330 3300014326 Bacteria 3486
254 Ga0157380_10822134 3300014326 Bacteria 948
255 Ga0157380_11278460 3300014326 Bacteria 780
256 Ga0182008_10458325 3300014497 Bacteria 694
257 Ga0182008_10562119 3300014497 Bacteria 635
258 Ga0182008_10782088 3300014497 Bacteria 552
259 Ga0182008_10797027 3300014497 Bacteria 548
260 Ga0157377_10003379 3300014745 Bacteria 7218
261 Ga0157377_11097272 3300014745 Bacteria 609
262 Ga0157379_10173722 3300014968 Bacteria 1945
263 Ga0157376_10341400 3300014969 Bacteria 1430
264 Ga0157376_11399926 3300014969 Bacteria 731
265 Ga0182005_1196083 3300015265 Bacteria 605
266 Ga0197907_10440023 3300020069 Bacteria 1364
267 Ga0206356_10357493 3300020070 Bacteria 696
268 Ga0206356_10911400 3300020070 Bacteria 680
269 Ga0206356_11484564 3300020070 Bacteria 675
270 Ga0206356_11539313 3300020070 Bacteria 1767
271 Ga0206355_1257486 3300020076 Bacteria 1603
272 Ga0206355_1484770 3300020076 Bacteria 686
273 Ga0206352_10112042 3300020078 Bacteria 523
274 Ga0206354_10062792 3300020081 Bacteria 903
275 Ga0206354_10138309 3300020081 Bacteria 623
276 Ga0206354_10204167 3300020081 Bacteria 592
277 Ga0206354_10571446 3300020081 Bacteria 730
278 Ga0206354_10868740 3300020081 Bacteria 675
279 Ga0206353_10334063 3300020082 Bacteria 553
280 Ga0206353_10442345 3300020082 Bacteria 910
281 Ga0206353_11000297 3300020082 Bacteria 800
282 Ga0206353_11239158 3300020082 Bacteria 765
283 Ga0206353_11286259 3300020082 Bacteria 664
284 Ga0154015_1323912 3300020610 Bacteria 693
285 Ga0224712_10359149 3300022467 Bacteria 689
286 Ga0224712_10643072 3300022467 Bacteria 520
287 Ga0207656_10441664 3300025321 Bacteria 657
288 Ga0207692_10854317 3300025898 Bacteria 597
289 Ga0207642_10028700 3300025899 Bacteria 2294
290 Ga0207642_10493593 3300025899 Bacteria 748
291 Ga0207642_10912631 3300025899 Bacteria 563
292 Ga0207710_10710598 3300025900 Bacteria 527
293 Ga0207688_10012216 3300025901 Bacteria 4671
294 Ga0207688_10253523 3300025901 Bacteria 1066
295 Ga0207688_10909056 3300025901 Bacteria 557
296 Ga0207647_10301298 3300025904 Bacteria 913
297 Ga0207699_10117499 3300025906 Bacteria 1714
298 Ga0207699_10134001 3300025906 Bacteria 1620
299 Ga0207645_11034241 3300025907 Bacteria 555
300 Ga0207705_10162874 3300025909 Bacteria 1676
301 Ga0207705_10581288 3300025909 Bacteria 871
302 Ga0207654_11420214 3300025911 Bacteria 506
303 Ga0207707_10008167 3300025912 Bacteria 9082
304 Ga0207707_10134198 3300025912 Bacteria 2165
305 Ga0207707_10432790 3300025912 Bacteria 1127
306 Ga0207695_10155932 3300025913 Bacteria 2218
307 Ga0207671_10482696 3300025914 Bacteria 988
308 Ga0207693_10038695 3300025915 Bacteria 3755
309 Ga0207693_10091893 3300025915 Bacteria 2379
310 Ga0207663_10185057 3300025916 Bacteria 1491
311 Ga0207663_11087399 3300025916 Bacteria 643
312 Ga0207660_10003389 3300025917 Bacteria 10392
313 Ga0207660_10142903 3300025917 Bacteria 1831
314 Ga0207657_10017412 3300025919 Bacteria 6890
315 Ga0207657_10070032 3300025919 Bacteria 2974
316 Ga0207657_10167799 3300025919 Bacteria 1780
317 Ga0207657_10183813 3300025919 Bacteria 1689
318 Ga0207657_10700749 3300025919 Bacteria 786
319 Ga0207649_10050943 3300025920 Bacteria 2562
320 Ga0207649_10147213 3300025920 Bacteria 1618
321 Ga0207652_10032670 3300025921 Bacteria 4377
322 Ga0207652_10219913 3300025921 Bacteria 1711
323 Ga0207652_11132407 3300025921 Bacteria 683
324 Ga0207694_10157314 3300025924 Bacteria 1834
325 Ga0207694_10559562 3300025924 Bacteria 960
326 Ga0207659_10044197 3300025926 Bacteria 3133
327 Ga0207687_10107301 3300025927 Bacteria 2066
328 Ga0207687_10560081 3300025927 Bacteria 960
329 Ga0207687_10767485 3300025927 Bacteria 821
330 Ga0207664_11947819 3300025929 Bacteria 510
331 Ga0207644_10267301 3300025931 Bacteria 1369
332 Ga0207690_10013287 3300025932 Bacteria 4945
333 Ga0207690_10080846 3300025932 Bacteria 2269
334 Ga0207690_11091346 3300025932 Bacteria 665
335 Ga0207706_10035046 3300025933 Bacteria 4465
336 Ga0207706_11126066 3300025933 Bacteria 655
337 Ga0207686_10147525 3300025934 Bacteria 1634
338 Ga0207686_10622053 3300025934 Bacteria 852
339 Ga0207686_11329478 3300025934 Bacteria 590
340 Ga0207709_10064646 3300025935 Bacteria 2298
341 Ga0207709_10253526 3300025935 Bacteria 1287
342 Ga0207709_10645079 3300025935 Bacteria 842
343 Ga0207669_10366842 3300025937 Bacteria 1118
344 Ga0207704_10352840 3300025938 Bacteria 1146
345 Ga0207704_11524173 3300025938 Bacteria 574
346 Ga0207665_10531702 3300025939 Bacteria 911
347 Ga0207711_10425004 3300025941 Bacteria 1236
348 Ga0207711_10707757 3300025941 Bacteria 939
349 Ga0207689_10416789 3300025942 Bacteria 1120
350 Ga0207689_10895175 3300025942 Bacteria 749
351 Ga0207689_10943129 3300025942 Bacteria 728
352 Ga0207661_10061038 3300025944 Bacteria 3044
353 Ga0207661_10064224 3300025944 Bacteria 2975
354 Ga0207661_10100509 3300025944 Bacteria 2427
355 Ga0207661_10167546 3300025944 Bacteria 1910
356 Ga0207661_10827379 3300025944 Bacteria 852
357 Ga0207661_11428054 3300025944 Bacteria 635
358 Ga0207679_10039099 3300025945 Bacteria 3385
359 Ga0207679_10069802 3300025945 Bacteria 2645
360 Ga0207679_11401657 3300025945 Bacteria 641
361 Ga0207679_11593359 3300025945 Bacteria 598
362 Ga0207667_10805824 3300025949 Bacteria 936
363 Ga0207667_10875420 3300025949 Bacteria 891
364 Ga0207651_10171174 3300025960 Bacteria 1713
365 Ga0207712_10387711 3300025961 Bacteria 1171
366 Ga0207712_10755439 3300025961 Bacteria 852
367 Ga0207712_11229832 3300025961 Bacteria 669
368 Ga0207668_10071183 3300025972 Bacteria 2483
369 Ga0207668_10356198 3300025972 Bacteria 1225
370 Ga0207640_10018760 3300025981 Bacteria 4071
371 Ga0207640_11474397 3300025981 Bacteria 611
372 Ga0207658_10445352 3300025986 Bacteria 1146
373 Ga0207677_10025348 3300026023 Bacteria 3699
374 Ga0207677_10064690 3300026023 Bacteria 2548
375 Ga0207703_10098299 3300026035 Bacteria 2475
376 Ga0207639_10220474 3300026041 Bacteria 1638
377 Ga0207639_11774764 3300026041 Bacteria 577
378 Ga0207678_10115881 3300026067 Bacteria 2286
379 Ga0207678_10688084 3300026067 Bacteria 900
380 Ga0207708_10001537 3300026075 Bacteria 17196
381 Ga0207708_10125534 3300026075 Bacteria 2002
382 Ga0207708_10255277 3300026075 Bacteria 1414
383 Ga0207708_10560843 3300026075 Bacteria 964
384 Ga0207708_11210569 3300026075 Bacteria 660
385 Ga0207702_10118188 3300026078 Bacteria 2368
386 Ga0207702_10335868 3300026078 Bacteria 1442
387 Ga0207702_10784194 3300026078 Bacteria 942
388 Ga0207702_11190596 3300026078 Bacteria 756
389 Ga0207702_11593995 3300026078 Bacteria 646
390 Ga0207702_11919189 3300026078 Bacteria 583
391 Ga0207648_10649617 3300026089 Bacteria 975
392 Ga0207648_10746850 3300026089 Bacteria 909
393 Ga0207676_10010228 3300026095 Bacteria 6676
394 Ga0207676_10485871 3300026095 Bacteria 1170
395 Ga0207676_11910103 3300026095 Bacteria 592
396 Ga0207674_10088799 3300026116 Bacteria 3084
397 Ga0207674_10705496 3300026116 Bacteria 974
398 Ga0207675_100314170 3300026118 Bacteria 1529
399 Ga0207675_101306089 3300026118 Bacteria 746
400 Ga0207683_10732800 3300026121 Bacteria 917
401 Ga0207698_10040408 3300026142 Bacteria 3466
402 Ga0207698_10110517 3300026142 Bacteria 2302
403 Ga0207698_10417462 3300026142 Bacteria 1287
404 Ga0207428_10028198 3300027907 Bacteria 4666
405 Ga0207428_10138712 3300027907 Bacteria 1858
406 Ga0268266_10026828 3300028379 Bacteria 4901
407 Ga0268266_10057654 3300028379 Bacteria 3343
408 Ga0268265_10071916 3300028380 Bacteria 2696
409 Ga0268265_12607865 3300028380 Bacteria 511
410 Ga0268264_10370460 3300028381 Bacteria 1369
411 Ga0265337_1119864 3300028556 Bacteria 714
412 Ga0265319_1003108 3300028563 Bacteria 8771
413 Ga0265319_1004161 3300028563 Bacteria 7247
414 Ga0265319_1210825 3300028563 Bacteria 595
415 Ga0265334_10086827 3300028573 Bacteria 1146
416 Ga0265334_10284570 3300028573 Bacteria 567
417 Ga0265318_10000980 3300028577 Bacteria 18281
418 Ga0265338_10030683 3300028800 Bacteria 5287
419 Ga0265338_10550951 3300028800 Bacteria 807
420 Ga0265762_1176197 3300030760 Bacteria 524
421 Ga0265320_10006590 3300031240 Bacteria 7300
422 Ga0265320_10028716 3300031240 Bacteria 2885
423 Ga0265331_10098816 3300031250 Bacteria 1345
424 Ga0265316_10963276 3300031344 Bacteria 594
425 Ga0307408_102066545 3300031548 Bacteria 549
426 Ga0265313_10048980 3300031595 Bacteria 2036
427 Ga0307405_10154767 3300031731 Bacteria 1617
428 Ga0307405_10453044 3300031731 Bacteria 1018
429 Ga0307410_11086278 3300031852 Bacteria 693
430 Ga0307406_11070550 3300031901 Bacteria 695
431 Ga0307407_11659336 3300031903 Bacteria 508
432 Ga0307412_11651485 3300031911 Bacteria 586
433 Ga0307409_100951974 3300031995 Bacteria 875
434 Ga0307409_100953289 3300031995 Bacteria 874
435 Ga0307409_101073018 3300031995 Bacteria 826
436 Ga0307409_102337811 3300031995 Bacteria 564
437 Ga0307416_100725942 3300032002 Bacteria 1084
438 Ga0307416_101348543 3300032002 Bacteria 819
439 Ga0307416_101582695 3300032002 Bacteria 761
440 Ga0307416_101691876 3300032002 Bacteria 737
441 Ga0307416_102636647 3300032002 Bacteria 600
442 Ga0307416_102831610 3300032002 Bacteria 580
443 Ga0307416_102936123 3300032002 Bacteria 570
444 Ga0307416_103089674 3300032002 Bacteria 557
445 Ga0307416_103876974 3300032002 Bacteria 501
446 Ga0307415_100370392 3300032126 Bacteria 1213
447 Ga0307415_101004761 3300032126 Bacteria 775
448 Ga0307415_101048365 3300032126 Bacteria 761
449 Ga0307415_101810134 3300032126 Bacteria 591
450 Ga0307415_102189474 3300032126 Bacteria 541
451 Ga0373941_0193891 3300035115 Bacteria 769
452 Ga0373945_0142030 3300035116 Bacteria 969
453 Ga0373946_0092170 3300035171 Bacteria 1344
454 Ga0373947_0534293 3300035725 Bacteria 798
455 Ga0373925_0646658 3300037068 Bacteria 871
456 Ga0395899_0532306 3300037312 Bacteria 758
457 Ga0395900_1397605 3300037418 Bacteria 613
458 Ga0395898_0446665 3300037466 Bacteria 1232
459 Ga0436364_0155300 3300037853 Bacteria 585
460 Ga0395901_0193332 3300038443 Bacteria 2134
461 Ga0395901_0230398 3300038443 Bacteria 1934
462 Ga0395901_1422207 3300038443 Bacteria 651
463 Ga0395901_1453313 3300038443 Bacteria 643
464 Ga0436365_0165092 3300039437 Bacteria 902
465 Ga0451795_0772152 3300041456 Bacteria 566
466 Ga0451802_0259112 3300041460 Bacteria 757
467 Ga0451804_0708098 3300041463 Bacteria 817
468 Ga0451807_0405665 3300041486 Bacteria 847
469 Ga0451833_1211185 3300041491 Bacteria 726
470 Ga0451839_1178014 3300041496 Bacteria 777
471 Ga0451841_1079026 3300041498 Bacteria 598
472 Ga0451847_0097670 3300041503 Bacteria 820
473 Ga0451843_1232358 3300041509 Bacteria 512
474 Ga0451843_1591431 3300041509 Bacteria 518
475 Ga0451853_0647074 3300041512 Bacteria 586
476 Ga0451853_3756825 3300041512 Bacteria 506
477 Ga0466966_0042038 3300044684 Bacteria 2936
478 Ga0466961_0712788 3300044693 Bacteria 601
479 Ga0466964_0236071 3300044706 Bacteria 895
480 Ga0466960_0190224 3300044901 Bacteria 1117
481 Ga0466960_0329942 3300044901 Bacteria 866
482 Ga0466960_0596530 3300044901 Bacteria 655
483 Ga0466967_0086113 3300045976 Bacteria 2846
484 Ga0466967_0300861 3300045976 Bacteria 1543
485 Ga0466967_0315121 3300045976 Bacteria 1508
486 Ga0466967_0450270 3300045976 Bacteria 1258
487 Ga0466967_0627868 3300045976 Bacteria 1061
488 Ga0466967_1832431 3300045976 Bacteria 604
489 Ga0466967_1939454 3300045976 Bacteria 586
490 Ga0466967_2525543 3300045976 Bacteria 509
491 Ga0495603_0409630 3300046455 Bacteria 777
492 Ga0495582_0269627 3300046473 Bacteria 977
493 Ga0495582_0757133 3300046473 Bacteria 562
494 Ga0495584_0287009 3300046491 Bacteria 836
495 Ga0495585_0163738 3300046492 Bacteria 1152
496 Ga0495616_0164727 3300046513 Bacteria 995
497 Ga0495630_0000695 3300046517 Bacteria 23982
498 Ga0495609_0186417 3300046538 Bacteria 872
499 Ga0495656_0562931 3300046615 Bacteria 608
500 Ga0495635_0485180 3300046663 Bacteria 815
501 Ga0495659_0450758 3300046664 Bacteria 560
502 Ga0495588_0158493 3300046674 Bacteria 1197
503 Ga0495588_0509469 3300046674 Bacteria 631
504 Ga0495657_0000148 3300046675 Bacteria 63284
505 Ga0495670_0288729 3300046691 Bacteria 878
506 Ga0495581_0822780 3300047315 Bacteria 532
507 Ga0495676_0198123 3300047321 Bacteria 1397
508 Ga0495676_0402812 3300047321 Bacteria 908
509 Ga0495677_0141105 3300047445 Bacteria 925
510 Ga0495684_0023780 3300047471 Bacteria 4711
511 Ga0495615_0269937 3300048090 Bacteria 544
512 Ga0496100_0299749 3300048903 Bacteria 1203
513 Ga0496101_0042048 3300048904 Bacteria 3262
514 Ga0496101_1225452 3300048904 Bacteria 588
515 Ga0496102_0011819 3300048905 Bacteria 7536
516 Ga0496102_0410298 3300048905 Bacteria 1273
517 Ga0496102_1069453 3300048905 Bacteria 727
518 Ga0496103_0223797 3300048906 Bacteria 1210
519 Ga0496104_0021005 3300048907 Bacteria 5990
520 Ga0496104_0220816 3300048907 Bacteria 1807
521 Ga0496104_0625724 3300048907 Bacteria 986
522 Ga0496105_0010489 3300048908 Bacteria 7287
523 Ga0496105_0499853 3300048908 Bacteria 955
524 Ga0496105_0526529 3300048908 Bacteria 925
525 Ga0496106_0056815 3300048909 Bacteria 2959
526 Ga0496106_0207669 3300048909 Bacteria 1559
527 Ga0496106_0487391 3300048909 Bacteria 990
528 Ga0496106_1436849 3300048909 Bacteria 532
529 Ga0496107_0126999 3300048910 Bacteria 1881
530 Ga0496108_0002530 3300048911 Bacteria 14630
531 Ga0496108_0033477 3300048911 Bacteria 4269
532 Ga0496108_0051490 3300048911 Bacteria 3450
533 Ga0496108_0075382 3300048911 Bacteria 2850
534 Ga0496108_0462469 3300048911 Bacteria 1108
535 Ga0496108_1153142 3300048911 Bacteria 657
536 Ga0496109_0001649 3300048912 Bacteria 18646
537 Ga0496109_0109769 3300048912 Bacteria 2564
538 Ga0496109_0406124 3300048912 Bacteria 1287
539 Ga0496109_0418736 3300048912 Bacteria 1265
540 Ga0496109_0430381 3300048912 Bacteria 1246
541 Ga0496109_2031579 3300048912 Bacteria 507
542 Ga0496110_0012529 3300048913 Bacteria 6974
543 Ga0496110_0032794 3300048913 Bacteria 4489
544 Ga0496110_0058076 3300048913 Bacteria 3407
545 Ga0496111_0041565 3300048914 Bacteria 3299
546 Ga0496111_0065660 3300048914 Bacteria 2634
547 Ga0496111_0727557 3300048914 Bacteria 721
548 Ga0496111_0848385 3300048914 Bacteria 660
549 Ga0496112_0095362 3300048915 Bacteria 2945
550 Ga0496113_0001482 3300048916 Bacteria 13115
551 Ga0496113_0224536 3300048916 Bacteria 1497
552 Ga0496113_0439983 3300048916 Bacteria 1047
553 Ga0496114_0229169 3300048917 Bacteria 1632
554 Ga0496115_1431037 3300048918 Bacteria 509
555 Ga0501309_078915 3300049129 Bacteria 550
556 Ga0501313_032715 3300049529 Bacteria 679
557 Ga0501317_091796 3300049533 Bacteria 538
558 Ga0501317_105349 3300049533 Bacteria 513
559 Ga0501318_026578 3300049534 Bacteria 765
560 Ga0501321_067220 3300049537 Bacteria 552
561 Ga0501031_0484654 3300049568 Bacteria 798
562 Ga0501036_0120897 3300049572 Bacteria 2212
563 Ga0501040_0942908 3300049576 Bacteria 625
564 Ga0501041_0058394 3300049577 Bacteria 2360
565 Ga0501041_1122122 3300049577 Bacteria 507
566 Ga0501042_0784399 3300049578 Bacteria 693
567 Ga0501048_0940317 3300049582 Bacteria 622
568 Ga0501067_0140845 3300049583 Bacteria 1343
569 Ga0501068_0423283 3300049584 Bacteria 860
570 Ga0501069_0139135 3300049585 Bacteria 1392
571 Ga0501071_0587434 3300049587 Bacteria 856
572 Ga0501072_0229735 3300049588 Bacteria 1478
573 Ga0501074_0125361 3300049590 Bacteria 1837
574 Ga0501074_0167080 3300049590 Bacteria 1571
575 Ga0501075_0200258 3300049591 Bacteria 1523
576 Ga0501076_0265216 3300049592 Bacteria 1406
577 Ga0501076_1689214 3300049592 Bacteria 519
578 Ga0501077_0046142 3300049593 Bacteria 2769
579 Ga0501079_0124560 3300049741 Bacteria 2005
580 Ga0501081_1013624 3300049743 Bacteria 627
581 Ga0501045_0722704 3300049824 Bacteria 734
582 Ga0501045_0948838 3300049824 Bacteria 631
583 Ga0501045_1268691 3300049824 Bacteria 537
584 nmdc:mga03n38_876879_c1 3300050490 Bacteria 526
585 nmdc:mga05p37_1132469_c1 3300050507 Bacteria 816
586 nmdc:mga05p37_1379853_c1 3300050507 Bacteria 711
587 nmdc:mga05p37_985613_c1 3300050507 Bacteria 897
588 nmdc:mga09592_1001974_c1 3300050508 Bacteria 698
589 nmdc:mga09592_1187227_c1 3300050508 Bacteria 631
590 nmdc:mga0qj67_164939_c1 3300050509 Bacteria 1798
591 nmdc:mga0qj67_694044_c1 3300050509 Bacteria 810
592 nmdc:mga06r32_156184_c1 3300050510 Bacteria 2263
593 nmdc:mga06r32_174262_c1 3300050510 Bacteria 2135
594 nmdc:mga06r32_230491_c1 3300050510 Bacteria 1840
595 nmdc:mga06r32_561457_c1 3300050510 Bacteria 1115
596 nmdc:mga06r32_951598_c1 3300050510 Bacteria 813
597 nmdc:mga08y16_107162_c1 3300050511 Bacteria 2909
598 nmdc:mga08y16_1433653_c1 3300050511 Bacteria 653
599 nmdc:mga08y16_2157430_c1 3300050511 Bacteria 504
600 nmdc:mga08y16_428406_c1 3300050511 Bacteria 1351
601 nmdc:mga08y16_62111_c1 3300050511 Bacteria 3901
602 nmdc:mga0n895_1089451_c1 3300050512 Bacteria 777
603 nmdc:mga0n895_205579_c1 3300050512 Bacteria 2000
604 nmdc:mga0n895_226226_c1 3300050512 Bacteria 1899
605 nmdc:mga0rr50_130993_c1 3300050513 Bacteria 2008
606 nmdc:mga0rr50_220376_c1 3300050513 Bacteria 1566
607 nmdc:mga0rr50_78926_c1 3300050513 Bacteria 2534
608 nmdc:mga08x19_110901_c1 3300050514 Bacteria 1830
609 nmdc:mga0a205_232393_c1 3300050515 Bacteria 1727
610 nmdc:mga0a205_255454_c1 3300050515 Bacteria 1631
611 nmdc:mga0a205_8461_c1 3300050515 Bacteria 9363
612 Ga0495601_0000451 3300053077 Bacteria 21517
613 Ga0495601_0670024 3300053077 Bacteria 663
614 Ga0495612_0000474 3300053078 Bacteria 16164
615 Ga0495612_0561340 3300053078 Bacteria 526
616 Ga0501084_1113488 3300054114 Bacteria 663
617 Ga0501084_1498734 3300054114 Bacteria 564
618 Ga0587084_112702 3300059477 Bacteria 564
619 Ga0587084_159954 3300059477 Bacteria 501
620 Ga0587066_202324 3300059490 Bacteria 523
621 Ga0587088_064769 3300059508 Bacteria 749
622 Ga0587128_081261 3300059630 Bacteria 649
623 Ga0587067_043889 3300059640 Bacteria 879
624 Ga0587067_123267 3300059640 Bacteria 624
625 Ga0501082_0941559 3300060353 Bacteria 755
626 Ga0466962_0636020 3300061719 Bacteria 545
627 Ga0530510_0005724 3300061734 Bacteria 8611
628 Ga0530510_0326012 3300061734 Bacteria 1152
629 Ga0530510_0992906 3300061734 Bacteria 642
630 Ga0070679_102112399
631 JGI24735J21928_10087958
632 JGI24745J21846_1018138
633 JGI24738J21930_10118652
634 Ga0006778J45830_1037573
635 JGI25407J50210_10010502
636 Ga0058859_11691900
637 Ga0058863_10031804
638 Ga0058863_10071273
639 Ga0058861_11806899
640 Ga0058861_11955149
641 Ga0058862_10066726
642 Ga0058862_12831607
643 Ga0070658_10618680
644 Ga0070658_11169785
645 Ga0070683_100008794
646 Ga0070683_100095360
647 Ga0070683_100129069
648 Ga0070683_100225318
649 Ga0070683_100611139
650 Ga0070683_101057060
651 Ga0068869_100434991
652 Ga0070680_100012714
653 Ga0070680_100184185
654 Ga0070680_100218387
655 Ga0070682_100014290
656 Ga0068868_100031766
657 Ga0068868_100113021
658 Ga0068868_101503088
659 Ga0068868_101723696
660 Ga0068868_101825744
661 Ga0070660_100103558
662 Ga0070660_100171422
663 Ga0070687_100331386
664 Ga0070661_100101982
665 Ga0070661_100174903
666 Ga0070661_100838831
667 Ga0070692_10187065
668 Ga0070692_10397489
669 Ga0070668_100094938
670 Ga0070668_100181229
671 Ga0070668_100532147
672 Ga0070668_100549933
673 Ga0070675_100072938
674 Ga0070671_100123083
675 Ga0070674_100180935
676 Ga0070673_102143726
677 Ga0070659_100067879
678 Ga0070659_100203577
679 Ga0070659_100433332
680 Ga0070659_100770030
681 Ga0070667_101864829
682 Ga0070709_10176307
683 Ga0070709_10293188
684 Ga0070714_101110478
685 Ga0070710_10505592
686 Ga0070710_10854740
687 Ga0070701_10317404
688 Ga0070701_11393018
689 Ga0070711_100160500
690 Ga0070700_100000915
691 Ga0070700_100185784
692 Ga0070694_101109721
693 Ga0070663_100049078
694 Ga0070663_100128170
695 Ga0070663_100424686
696 Ga0070663_100858131
697 Ga0070663_101202929
698 Ga0070663_102022997
699 Ga0070662_100074505
700 Ga0070662_101602059
701 Ga0070662_102007647
702 Ga0070681_10142461
703 Ga0070681_10430328
704 Ga0068867_100674086
705 Ga0070685_10128836
706 Ga0070679_100028040
707 Ga0070679_100030829
708 Ga0070679_100105129
709 Ga0070679_100628203
710 Ga0070679_100906905
711 Ga0070684_100022597
712 Ga0070684_100174540
713 Ga0070684_100941312
714 Ga0068853_100047196
715 Ga0068853_101055673
716 Ga0070672_101955975
717 Ga0070695_100430328
718 Ga0070695_101551894
719 Ga0070696_100545730
720 Ga0070693_100411827
721 Ga0070665_100012942
722 Ga0070665_100126994
723 Ga0070704_100933218
724 Ga0068855_100441731
725 Ga0068855_100932369
726 Ga0070664_100008366
727 Ga0070664_100136327
728 Ga0070664_101542920
729 Ga0068857_100352694
730 Ga0068857_100741698
731 Ga0068854_100015270
732 Ga0068854_100041243
733 Ga0068854_100349697
734 Ga0068856_100003218
735 Ga0068856_100003467
736 Ga0068856_100035993
737 Ga0068856_100080843
738 Ga0068856_100639134
739 Ga0068856_100891185
740 Ga0070702_100173171
741 Ga0070702_100243491
742 Ga0070702_101284739
743 Ga0068852_100052503
744 Ga0068852_100115189
745 Ga0068852_101234165
746 Ga0068852_101559823
747 Ga0068859_101331052
748 Ga0068864_100027360
749 Ga0068866_10009080
750 Ga0068866_10625379
751 Ga0068861_100244469
752 Ga0068861_101754613
753 Ga0068861_102276432
754 Ga0068851_10275377
755 Ga0068858_100700079
756 Ga0068858_100845175
757 Ga0068860_100350120
758 Ga0068862_101381103
759 Ga0081538_10008407
760 Ga0081538_10015488
761 Ga0081540_1014933
762 Ga0081540_1071722
763 Ga0081539_10082521
764 Ga0075365_10679575
765 Ga0075365_10810136
766 Ga0075365_11154377
767 Ga0075364_10938602
768 Ga0075432_10042008
769 Ga0075432_10083500
770 Ga0075432_10418714
771 Ga0075432_10546067
772 Ga0070716_100429215
773 Ga0070712_100004725
774 Ga0070712_101410656
775 Ga0075370_11009828
776 Ga0068871_101304509
777 Ga0068871_102019896
778 Ga0075428_100463588
779 Ga0075428_100482580
780 Ga0075428_101003293
781 Ga0075428_101754935
782 Ga0075428_101919243
783 Ga0075430_100179394
784 Ga0075430_100491512
785 Ga0075431_100034755
786 Ga0075431_100135951
787 Ga0075431_100193241
788 Ga0075431_100246610
789 Ga0075431_100590071
790 Ga0075433_10003522
791 Ga0075433_10035409
792 Ga0075433_10089508
793 Ga0075434_100042159
794 Ga0075434_100244954
795 Ga0075434_100377387
796 Ga0075429_101123555
797 Ga0068865_100097036
798 Ga0068865_101397737
799 Ga0075436_100020660
800 Ga0075436_100062041
801 Ga0097620_101331148
802 Ga0075435_100011209
803 Ga0075435_100297256
804 Ga0075435_100346175
805 Ga0105240_10032516
806 Ga0111539_10029871
807 Ga0111539_10077317
808 Ga0111539_10118101
809 Ga0111539_10450108
810 Ga0105245_10001866
811 Ga0105245_10841044
812 Ga0105245_11158955
813 Ga0105245_11291875
814 Ga0105245_11691694
815 Ga0105247_11286031
816 Ga0105247_11675675
817 Ga0114129_10505027
818 Ga0114129_11366938
819 Ga0114129_11888939
820 Ga0114129_12220569
821 Ga0105243_10090806
822 Ga0105243_10176215
823 Ga0105243_10336628
824 Ga0105243_10699148
825 Ga0105243_10867577
826 Ga0105241_10132943
827 Ga0105241_10685521
828 Ga0105242_10117870
829 Ga0105242_10297617
830 Ga0105242_12584415
831 Ga0105242_12729538
832 Ga0105248_10605975
833 Ga0105248_10639301
834 Ga0105248_10871875
835 Ga0105237_10001629
836 Ga0105237_10097582
837 Ga0105237_10268109
838 Ga0105237_10980957
839 Ga0105238_10054931
840 Ga0105238_10165690
841 Ga0105238_11072248
842 Ga0105249_10205309
843 Ga0105249_10474426
844 Ga0105249_10859191
845 Ga0105239_10027496
846 Ga0105239_10459254
847 Ga0105239_10705226
848 Ga0105239_11355524
849 Ga0105239_11844505
850 Ga0105239_12668936
851 Ga0105246_10063706
852 Ga0105246_10103191
853 Ga0157344_1011318
854 Ga0157320_1014900
855 Ga0157347_1026127
856 Ga0157371_10287727
857 Ga0157371_10580228
858 Ga0157370_10055229
859 Ga0157369_10139539
860 Ga0157369_11165891
861 Ga0157374_10104157
862 Ga0157374_10521942
863 Ga0157378_10362867
864 Ga0163162_10604365
865 Ga0163162_11293008
866 Ga0163162_12864819
867 Ga0157372_10002922
868 Ga0157372_10033847
869 Ga0157372_10113244
870 Ga0157372_10127749
871 Ga0157372_10827303
872 Ga0157372_11389891
873 Ga0157372_11621890
874 Ga0157372_11856709
875 Ga0157372_11892415
876 Ga0157372_13334564
877 Ga0157375_10104776
878 Ga0157375_11228234
879 Ga0157375_11993139
880 Ga0163163_10644566
881 Ga0163163_10827643
882 Ga0157380_10044330
883 Ga0157380_10822134
884 Ga0157380_11278460
885 Ga0182008_10458325
886 Ga0182008_10562119
887 Ga0182008_10782088
888 Ga0182008_10797027
889 Ga0157377_10003379
890 Ga0157377_11097272
891 Ga0157379_10173722
892 Ga0157376_10341400
893 Ga0157376_11399926
894 Ga0182005_1196083
895 Ga0197907_10440023
896 Ga0206356_10357493
897 Ga0206356_10911400
898 Ga0206356_11484564
899 Ga0206356_11539313
900 Ga0206355_1257486
901 Ga0206355_1484770
902 Ga0206352_10112042
903 Ga0206354_10062792
904 Ga0206354_10138309
905 Ga0206354_10204167
906 Ga0206354_10571446
907 Ga0206354_10868740
908 Ga0206353_10334063
909 Ga0206353_10442345
910 Ga0206353_11000297
911 Ga0206353_11239158
912 Ga0206353_11286259
913 Ga0154015_1323912
914 Ga0224712_10359149
915 Ga0224712_10643072
916 Ga0207656_10441664
917 Ga0207692_10854317
918 Ga0207642_10028700
919 Ga0207642_10493593
920 Ga0207642_10912631
921 Ga0207710_10710598
922 Ga0207688_10012216
923 Ga0207688_10253523
924 Ga0207688_10909056
925 Ga0207647_10301298
926 Ga0207699_10117499
927 Ga0207699_10134001
928 Ga0207645_11034241
929 Ga0207705_10162874
930 Ga0207705_10581288
931 Ga0207654_11420214
932 Ga0207707_10008167
933 Ga0207707_10134198
934 Ga0207707_10432790
935 Ga0207695_10155932
936 Ga0207671_10482696
937 Ga0207693_10038695
938 Ga0207693_10091893
939 Ga0207663_10185057
940 Ga0207663_11087399
941 Ga0207660_10003389
942 Ga0207660_10142903
943 Ga0207657_10017412
944 Ga0207657_10070032
945 Ga0207657_10167799
946 Ga0207657_10183813
947 Ga0207657_10700749
948 Ga0207649_10050943
949 Ga0207649_10147213
950 Ga0207652_10032670
951 Ga0207652_10219913
952 Ga0207652_11132407
953 Ga0207694_10157314
954 Ga0207694_10559562
955 Ga0207659_10044197
956 Ga0207687_10107301
957 Ga0207687_10560081
958 Ga0207687_10767485
959 Ga0207664_11947819
960 Ga0207644_10267301
961 Ga0207690_10013287
962 Ga0207690_10080846
963 Ga0207690_11091346
964 Ga0207706_10035046
965 Ga0207706_11126066
966 Ga0207686_10147525
967 Ga0207686_10622053
968 Ga0207686_11329478
969 Ga0207709_10064646
970 Ga0207709_10253526
971 Ga0207709_10645079
972 Ga0207669_10366842
973 Ga0207704_10352840
974 Ga0207704_11524173
975 Ga0207665_10531702
976 Ga0207711_10425004
977 Ga0207711_10707757
978 Ga0207689_10416789
979 Ga0207689_10895175
980 Ga0207689_10943129
981 Ga0207661_10061038
982 Ga0207661_10064224
983 Ga0207661_10100509
984 Ga0207661_10167546
985 Ga0207661_10827379
986 Ga0207661_11428054
987 Ga0207679_10039099
988 Ga0207679_10069802
989 Ga0207679_11401657
990 Ga0207679_11593359
991 Ga0207667_10805824
992 Ga0207667_10875420
993 Ga0207651_10171174
994 Ga0207712_10387711
995 Ga0207712_10755439
996 Ga0207712_11229832
997 Ga0207668_10071183
998 Ga0207668_10356198
999 Ga0207640_10018760
1000 Ga0207640_11474397
1001 Ga0207658_10445352
1002 Ga0207677_10025348
1003 Ga0207677_10064690
1004 Ga0207703_10098299
1005 Ga0207639_10220474
1006 Ga0207639_11774764
1007 Ga0207678_10115881
1008 Ga0207678_10688084
1009 Ga0207708_10001537
1010 Ga0207708_10125534
1011 Ga0207708_10255277
1012 Ga0207708_10560843
1013 Ga0207708_11210569
1014 Ga0207702_10118188
1015 Ga0207702_10335868
1016 Ga0207702_10784194
1017 Ga0207702_11190596
1018 Ga0207702_11593995
1019 Ga0207702_11919189
1020 Ga0207648_10649617
1021 Ga0207648_10746850
1022 Ga0207676_10010228
1023 Ga0207676_10485871
1024 Ga0207676_11910103
1025 Ga0207674_10088799
1026 Ga0207674_10705496
1027 Ga0207675_100314170
1028 Ga0207675_101306089
1029 Ga0207683_10732800
1030 Ga0207698_10040408
1031 Ga0207698_10110517
1032 Ga0207698_10417462
1033 Ga0207428_10028198
1034 Ga0207428_10138712
1035 Ga0268266_10026828
1036 Ga0268266_10057654
1037 Ga0268265_10071916
1038 Ga0268265_12607865
1039 Ga0268264_10370460
1040 Ga0265337_1119864
1041 Ga0265319_1003108
1042 Ga0265319_1004161
1043 Ga0265319_1210825
1044 Ga0265334_10086827
1045 Ga0265334_10284570
1046 Ga0265318_10000980
1047 Ga0265338_10030683
1048 Ga0265338_10550951
1049 Ga0265762_1176197
1050 Ga0265320_10006590
1051 Ga0265320_10028716
1052 Ga0265331_10098816
1053 Ga0265316_10963276
1054 Ga0307408_102066545
1055 Ga0265313_10048980
1056 Ga0307405_10154767
1057 Ga0307405_10453044
1058 Ga0307410_11086278
1059 Ga0307406_11070550
1060 Ga0307407_11659336
1061 Ga0307412_11651485
1062 Ga0307409_100951974
1063 Ga0307409_100953289
1064 Ga0307409_101073018
1065 Ga0307409_102337811
1066 Ga0307416_100725942
1067 Ga0307416_101348543
1068 Ga0307416_101582695
1069 Ga0307416_101691876
1070 Ga0307416_102636647
1071 Ga0307416_102831610
1072 Ga0307416_102936123
1073 Ga0307416_103089674
1074 Ga0307416_103876974
1075 Ga0307415_100370392
1076 Ga0307415_101004761
1077 Ga0307415_101048365
1078 Ga0307415_101810134
1079 Ga0307415_102189474
1080 Ga0373941_0193891
1081 Ga0373945_0142030
1082 Ga0373946_0092170
1083 Ga0373947_0534293
1084 Ga0373925_0646658
1085 Ga0395899_0532306
1086 Ga0395900_1397605
1087 Ga0395898_0446665
1088 Ga0436364_0155300
1089 Ga0395901_0193332
1090 Ga0395901_0230398
1091 Ga0395901_1422207
1092 Ga0395901_1453313
1093 Ga0436365_0165092
1094 Ga0451795_0772152
1095 Ga0451802_0259112
1096 Ga0451804_0708098
1097 Ga0451807_0405665
1098 Ga0451833_1211185
1099 Ga0451839_1178014
1100 Ga0451841_1079026
1101 Ga0451847_0097670
1102 Ga0451843_1232358
1103 Ga0451843_1591431
1104 Ga0451853_0647074
1105 Ga0451853_3756825
1106 Ga0466966_0042038
1107 Ga0466961_0712788
1108 Ga0466964_0236071
1109 Ga0466960_0190224
1110 Ga0466960_0329942
1111 Ga0466960_0596530
1112 Ga0466967_0086113
1113 Ga0466967_0300861
1114 Ga0466967_0315121
1115 Ga0466967_0450270
1116 Ga0466967_0627868
1117 Ga0466967_1832431
1118 Ga0466967_1939454
1119 Ga0466967_2525543
1120 Ga0495603_0409630
1121 Ga0495582_0269627
1122 Ga0495582_0757133
1123 Ga0495584_0287009
1124 Ga0495585_0163738
1125 Ga0495616_0164727
1126 Ga0495630_0000695
1127 Ga0495609_0186417
1128 Ga0495656_0562931
1129 Ga0495635_0485180
1130 Ga0495659_0450758
1131 Ga0495588_0158493
1132 Ga0495588_0509469
1133 Ga0495657_0000148
1134 Ga0495670_0288729
1135 Ga0495581_0822780
1136 Ga0495676_0198123
1137 Ga0495676_0402812
1138 Ga0495677_0141105
1139 Ga0495684_0023780
1140 Ga0495615_0269937
1141 Ga0496100_0299749
1142 Ga0496101_0042048
1143 Ga0496101_1225452
1144 Ga0496102_0011819
1145 Ga0496102_0410298
1146 Ga0496102_1069453
1147 Ga0496103_0223797
1148 Ga0496104_0021005
1149 Ga0496104_0220816
1150 Ga0496104_0625724
1151 Ga0496105_0010489
1152 Ga0496105_0499853
1153 Ga0496105_0526529
1154 Ga0496106_0056815
1155 Ga0496106_0207669
1156 Ga0496106_0487391
1157 Ga0496106_1436849
1158 Ga0496107_0126999
1159 Ga0496108_0002530
1160 Ga0496108_0033477
1161 Ga0496108_0051490
1162 Ga0496108_0075382
1163 Ga0496108_0462469
1164 Ga0496108_1153142
1165 Ga0496109_0001649
1166 Ga0496109_0109769
1167 Ga0496109_0406124
1168 Ga0496109_0418736
1169 Ga0496109_0430381
1170 Ga0496109_2031579
1171 Ga0496110_0012529
1172 Ga0496110_0032794
1173 Ga0496110_0058076
1174 Ga0496111_0041565
1175 Ga0496111_0065660
1176 Ga0496111_0727557
1177 Ga0496111_0848385
1178 Ga0496112_0095362
1179 Ga0496113_0001482
1180 Ga0496113_0224536
1181 Ga0496113_0439983
1182 Ga0496114_0229169
1183 Ga0496115_1431037
1184 Ga0501309_078915
1185 Ga0501313_032715
1186 Ga0501317_091796
1187 Ga0501317_105349
1188 Ga0501318_026578
1189 Ga0501321_067220
1190 Ga0501031_0484654
1191 Ga0501036_0120897
1192 Ga0501040_0942908
1193 Ga0501041_0058394
1194 Ga0501041_1122122
1195 Ga0501042_0784399
1196 Ga0501048_0940317
1197 Ga0501067_0140845
1198 Ga0501068_0423283
1199 Ga0501069_0139135
1200 Ga0501071_0587434
1201 Ga0501072_0229735
1202 Ga0501074_0125361
1203 Ga0501074_0167080
1204 Ga0501075_0200258
1205 Ga0501076_0265216
1206 Ga0501076_1689214
1207 Ga0501077_0046142
1208 Ga0501079_0124560
1209 Ga0501081_1013624
1210 Ga0501045_0722704
1211 Ga0501045_0948838
1212 Ga0501045_1268691
1213 nmdc:mga03n38_876879_c1
1214 nmdc:mga05p37_1132469_c1
1215 nmdc:mga05p37_1379853_c1
1216 nmdc:mga05p37_985613_c1
1217 nmdc:mga09592_1001974_c1
1218 nmdc:mga09592_1187227_c1
1219 nmdc:mga0qj67_164939_c1
1220 nmdc:mga0qj67_694044_c1
1221 nmdc:mga06r32_156184_c1
1222 nmdc:mga06r32_174262_c1
1223 nmdc:mga06r32_230491_c1
1224 nmdc:mga06r32_561457_c1
1225 nmdc:mga06r32_951598_c1
1226 nmdc:mga08y16_107162_c1
1227 nmdc:mga08y16_1433653_c1
1228 nmdc:mga08y16_2157430_c1
1229 nmdc:mga08y16_428406_c1
1230 nmdc:mga08y16_62111_c1
1231 nmdc:mga0n895_1089451_c1
1232 nmdc:mga0n895_205579_c1
1233 nmdc:mga0n895_226226_c1
1234 nmdc:mga0rr50_130993_c1
1235 nmdc:mga0rr50_220376_c1
1236 nmdc:mga0rr50_78926_c1
1237 nmdc:mga08x19_110901_c1
1238 nmdc:mga0a205_232393_c1
1239 nmdc:mga0a205_255454_c1
1240 nmdc:mga0a205_8461_c1
1241 Ga0495601_0000451
1242 Ga0495601_0670024
1243 Ga0495612_0000474
1244 Ga0495612_0561340
1245 Ga0501084_1113488
1246 Ga0501084_1498734
1247 Ga0587084_112702
1248 Ga0587084_159954
1249 Ga0587066_202324
1250 Ga0587088_064769
1251 Ga0587128_081261
1252 Ga0587067_043889
1253 Ga0587067_123267
1254 Ga0501082_0941559
1255 Ga0466962_0636020
1256 Ga0530510_0005724
1257 Ga0530510_0326012
1258 Ga0530510_0992906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

12

77

0.98

PF08206

OB_RNB

Ribonuclease B OB domain

15

47

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aqq-assembly1.cif.gz_C crystal structure of human crhsp-24 0.9296 2 50
3pf5-assembly2.cif.gz_B crystal structure of bs-cspb in complex with ru6 0.8914 1 66
6szz-assembly1.cif.gz_A crystal structure of cold shock protein b (cspb) containing the modified residue 4-f-trp 0.8882 1 67
2i5m-assembly1.cif.gz_X crystal structure of bacillus subtilis cold shock protein cspb variant a46k s48r 0.8853 1 67
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.8852 1 67
ID Description Score Start End Superfamily
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8999 2 64 2.40.50.140
af_P91306_55_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8601 2 64 2.40.50.140
af_Q4DCA9_18_92_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8601 3 66 2.40.50.140
af_P91398_61_146_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8597 2 64 2.40.50.140
5jx4A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8488 1 67 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A373CSJ3-F1-model_v4 Cold-shock protein 0.9345 1 64 GO:0003676
GO:0005737
AF-A0A7S0C4T9-F1-model_v4 CSD domain-containing protein 0.9226 2 67 GO:0003676
AF-A0A5B6W505-F1-model_v4 Cold shock protein 2-like 0.9206 2 67 GO:0003676
GO:0008270
AF-A0A392QZS8-F1-model_v4 Glycine-rich protein 2-like 0.9183 2 64 GO:0003676
AF-A0A445EUD0-F1-model_v4 CSD domain-containing protein 0.9171 2 66 GO:0003676
GO:0016020

Map