F470653

General Info

Members Datasets Scaffolds Average Seq Length
628 270 1256 187

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10144249|Ga0207639_101442492
Length 221
Sequence MFPCVSWQFCGAGPASAGRSRRLAWLGNCRSNLGVDAFSYLSVLLSIILGLAITQILQGYRGLLLARGRVTFYAPTMIWSVLLLMIVAQAWWSSFGLVKHENWTFLQFCAVLLQMVLLYMMCGLVLPDIPVEEAVDLRAHYYRERRPLFGAFLLMLVASVAKDFILTGHPPSKENLAFHGVFAALSVGGLVIGARRYHEIITPIGGLVMIAYVALLFAHLA

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
197 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 6.53
Rhizosphere 90.92
Stem 0
Stem Tuber 0
Unclassified 17.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10144249 3300026041 Bacteria 1987
2 SwRhRL2b_contig_3044722 2162886007 Bacteria 1519
3 MRS1b_contig_6314018 2162886011 Bacteria 1000
4 JGI24740J21852_10015187 3300001979 Bacteria 2818
5 JGI24740J21852_10030294 3300001979 Bacteria 1764
6 JGI24737J22298_10027767 3300001990 Bacteria 1782
7 JGI24735J21928_10151707 3300002067 Unclassified 669
8 JGI24034J26672_10026896 3300002239 Bacteria 924
9 rootL2_10355494 3300003322 Unclassified 1306
10 Ga0065704_10004938 3300005289 Bacteria 3117
11 Ga0065704_10009865 3300005289 Bacteria 2826
12 Ga0065712_10207378 3300005290 Bacteria 1085
13 Ga0065715_10066692 3300005293 Bacteria 1019
14 Ga0065707_10108066 3300005295 Bacteria 2526
15 Ga0070658_10124296 3300005327 Bacteria 2146
16 Ga0070658_10164771 3300005327 Bacteria 1861
17 Ga0070658_10261652 3300005327 Bacteria 1469
18 Ga0070658_10374432 3300005327 Bacteria 1221
19 Ga0070658_10870529 3300005327 Bacteria 783
20 Ga0070676_10783220 3300005328 Bacteria 702
21 Ga0070683_100086048 3300005329 Bacteria 2947
22 Ga0070683_100103310 3300005329 Bacteria 2685
23 Ga0070683_100228012 3300005329 Unclassified 1771
24 Ga0070683_100521968 3300005329 Bacteria 1135
25 Ga0070690_100082723 3300005330 Bacteria 2102
26 Ga0070670_100002167 3300005331 Bacteria 16130
27 Ga0070670_100006159 3300005331 Bacteria 10141
28 Ga0070670_100078780 3300005331 Bacteria 2831
29 Ga0070670_100101457 3300005331 Bacteria 2478
30 Ga0070670_100831898 3300005331 Bacteria 835
31 Ga0068869_100247611 3300005334 Bacteria 1422
32 Ga0070666_10001456 3300005335 Bacteria 14358
33 Ga0070666_10170783 3300005335 Bacteria 1523
34 Ga0070666_10465901 3300005335 Unclassified 914
35 Ga0070680_100089269 3300005336 Bacteria 2550
36 Ga0070680_100800745 3300005336 Bacteria 812
37 Ga0070682_100359125 3300005337 Bacteria 1089
38 Ga0068868_100760248 3300005338 Unclassified 871
39 Ga0070660_100045646 3300005339 Bacteria 3355
40 Ga0070660_100057872 3300005339 Bacteria 3004
41 Ga0070660_100111353 3300005339 Bacteria 2178
42 Ga0070660_100243638 3300005339 Bacteria 1465
43 Ga0070660_100409060 3300005339 Bacteria 1123
44 Ga0070660_100600854 3300005339 Bacteria 920
45 Ga0070660_100793676 3300005339 Bacteria 796
46 Ga0070691_10031852 3300005341 Bacteria 2474
47 Ga0070661_100097554 3300005344 Bacteria 2182
48 Ga0070661_100235404 3300005344 Bacteria 1408
49 Ga0070661_100406635 3300005344 Unclassified 1077
50 Ga0070661_100415894 3300005344 Bacteria 1065
51 Ga0070661_101060936 3300005344 Bacteria 674
52 Ga0070692_10013140 3300005345 Bacteria 3853
53 Ga0070692_10023871 3300005345 Bacteria 3000
54 Ga0070692_10048594 3300005345 Bacteria 2199
55 Ga0070668_100051664 3300005347 Bacteria 3168
56 Ga0070668_100150159 3300005347 Bacteria 1884
57 Ga0070668_100163561 3300005347 Bacteria 1807
58 Ga0070675_100016071 3300005354 Bacteria 5932
59 Ga0070675_100864322 3300005354 Unclassified 828
60 Ga0070675_100995010 3300005354 Bacteria 770
61 Ga0070671_100008382 3300005355 Bacteria 8284
62 Ga0070671_100030092 3300005355 Bacteria 4480
63 Ga0070674_100068449 3300005356 Bacteria 2501
64 Ga0070674_100073268 3300005356 Bacteria 2427
65 Ga0070673_100903501 3300005364 Bacteria 819
66 Ga0070659_100037335 3300005366 Bacteria 3787
67 Ga0070659_100114133 3300005366 Bacteria 2182
68 Ga0070659_100418157 3300005366 Unclassified 1133
69 Ga0070667_100006596 3300005367 Bacteria 9650
70 Ga0070667_100367964 3300005367 Unclassified 1304
71 Ga0070667_100399642 3300005367 Bacteria 1251
72 Ga0070667_100755494 3300005367 Bacteria 901
73 Ga0070667_101553991 3300005367 Bacteria 622
74 Ga0070709_10237395 3300005434 Bacteria 1307
75 Ga0070709_10644243 3300005434 Unclassified 820
76 Ga0070714_100006317 3300005435 Bacteria 9134
77 Ga0070714_100454790 3300005435 Unclassified 1217
78 Ga0070714_101231594 3300005435 Unclassified 730
79 Ga0070713_100218805 3300005436 Bacteria 1727
80 Ga0070713_100393858 3300005436 Bacteria 1292
81 Ga0070710_10049815 3300005437 Bacteria 2344
82 Ga0070710_10126131 3300005437 Bacteria 1555
83 Ga0070710_10498100 3300005437 Unclassified 834
84 Ga0070705_100533156 3300005440 Unclassified 897
85 Ga0070708_100366695 3300005445 Bacteria 1357
86 Ga0070663_100058724 3300005455 Bacteria 2763
87 Ga0070663_100185303 3300005455 Bacteria 1617
88 Ga0070663_100216318 3300005455 Bacteria 1502
89 Ga0070663_101057131 3300005455 Bacteria 708
90 Ga0070678_100018439 3300005456 Bacteria 4522
91 Ga0070678_100055287 3300005456 Bacteria 2897
92 Ga0070678_100058408 3300005456 Bacteria 2831
93 Ga0070662_100008697 3300005457 Bacteria 6620
94 Ga0070662_100110823 3300005457 Bacteria 2090
95 Ga0070662_100255129 3300005457 Bacteria 1411
96 Ga0070681_10128149 3300005458 Bacteria 2470
97 Ga0068867_100029532 3300005459 Bacteria 3951
98 Ga0070685_10173250 3300005466 Unclassified 1384
99 Ga0070706_100752252 3300005467 Bacteria 903
100 Ga0070706_101094629 3300005467 Unclassified 733
101 Ga0070707_100031425 3300005468 Bacteria 5058
102 Ga0070707_100068859 3300005468 Bacteria 3406
103 Ga0070707_100801487 3300005468 Unclassified 906
104 Ga0070698_100012876 3300005471 Bacteria 8858
105 Ga0070699_100296805 3300005518 Bacteria 1450
106 Ga0070699_100819857 3300005518 Unclassified 852
107 Ga0070679_100041062 3300005530 Bacteria 4605
108 Ga0070679_100117155 3300005530 Bacteria 2648
109 Ga0070679_100227965 3300005530 Bacteria 1823
110 Ga0070684_100020430 3300005535 Bacteria 5494
111 Ga0070684_100381416 3300005535 Bacteria 1298
112 Ga0070697_100024304 3300005536 Bacteria 4823
113 Ga0070697_100376864 3300005536 Bacteria 1228
114 Ga0068853_100027618 3300005539 Bacteria 4768
115 Ga0068853_100101403 3300005539 Bacteria 2546
116 Ga0068853_100206495 3300005539 Bacteria 1789
117 Ga0068853_100353163 3300005539 Bacteria 1368
118 Ga0068853_100837640 3300005539 Unclassified 882
119 Ga0068853_100912872 3300005539 Bacteria 844
120 Ga0070672_100001795 3300005543 Bacteria 13422
121 Ga0070672_100012274 3300005543 Bacteria 6005
122 Ga0070672_100216058 3300005543 Bacteria 1607
123 Ga0070672_100406323 3300005543 Bacteria 1168
124 Ga0070672_100411183 3300005543 Bacteria 1161
125 Ga0070686_100618558 3300005544 Unclassified 855
126 Ga0070696_100774043 3300005546 Unclassified 788
127 Ga0070665_100000636 3300005548 Bacteria 47736
128 Ga0070665_100026248 3300005548 Bacteria 5867
129 Ga0070665_100074742 3300005548 Bacteria 3394
130 Ga0070665_100644902 3300005548 Unclassified 1072
131 Ga0070665_101374567 3300005548 Unclassified 715
132 Ga0070704_100657050 3300005549 Bacteria 926
133 Ga0068855_100044117 3300005563 Bacteria 5278
134 Ga0068855_100194686 3300005563 Bacteria 2284
135 Ga0068855_100268634 3300005563 Bacteria 1897
136 Ga0070664_100011305 3300005564 Bacteria 7242
137 Ga0070664_100064162 3300005564 Bacteria 3132
138 Ga0068857_100019712 3300005577 Bacteria 5924
139 Ga0068854_100847301 3300005578 Unclassified 800
140 Ga0068856_100001655 3300005614 Bacteria 23351
141 Ga0068856_100225438 3300005614 Bacteria 1890
142 Ga0068852_100001333 3300005616 Bacteria 16553
143 Ga0068852_100021356 3300005616 Bacteria 5168
144 Ga0068852_100158769 3300005616 Bacteria 2109
145 Ga0068852_100335177 3300005616 Unclassified 1473
146 Ga0068852_100491387 3300005616 Bacteria 1221
147 Ga0068852_101061067 3300005616 Bacteria 830
148 Ga0068859_100063166 3300005617 Bacteria 3734
149 Ga0068864_100000828 3300005618 Bacteria 26083
150 Ga0068864_100051301 3300005618 Bacteria 3553
151 Ga0068864_100359495 3300005618 Unclassified 1376
152 Ga0068864_100916734 3300005618 Unclassified 866
153 Ga0068866_10026160 3300005718 Bacteria 2752
154 Ga0068861_100119491 3300005719 Bacteria 2124
155 Ga0068861_100584844 3300005719 Bacteria 1022
156 Ga0068851_10049921 3300005834 Unclassified 2124
157 Ga0068863_100003749 3300005841 Bacteria 15037
158 Ga0068863_100213188 3300005841 Bacteria 1860
159 Ga0068863_100361597 3300005841 Bacteria 1415
160 Ga0068858_100000626 3300005842 Bacteria 36822
161 Ga0068858_101000813 3300005842 Bacteria 819
162 Ga0081540_1188281 3300005983 Bacteria 764
163 Ga0070717_10042039 3300006028 Bacteria 3728
164 Ga0070717_10302734 3300006028 Unclassified 1421
165 Ga0070717_10427058 3300006028 Bacteria 1192
166 Ga0070717_10584084 3300006028 Bacteria 1013
167 Ga0070717_10886413 3300006028 Unclassified 812
168 Ga0070715_10114397 3300006163 Bacteria 1277
169 Ga0070716_100122805 3300006173 Bacteria 1628
170 Ga0070716_100245997 3300006173 Bacteria 1215
171 Ga0097621_100009198 3300006237 Bacteria 7164
172 Ga0097621_100014969 3300006237 Bacteria 5822
173 Ga0097621_100205400 3300006237 Bacteria 1711
174 Ga0068871_100017862 3300006358 Bacteria 5378
175 Ga0068871_100113218 3300006358 Bacteria 2285
176 Ga0068871_100155848 3300006358 Bacteria 1950
177 Ga0075430_100601401 3300006846 Bacteria 907
178 Ga0075434_100068738 3300006871 Bacteria 3530
179 Ga0075434_100181164 3300006871 Bacteria 2127
180 Ga0068865_100128159 3300006881 Bacteria 1897
181 Ga0068865_100388120 3300006881 Bacteria 1141
182 Ga0075436_100251773 3300006914 Unclassified 1258
183 Ga0097620_100063166 3300006931 Bacteria 3734
184 Ga0099794_10151103 3300007265 Bacteria 1179
185 Ga0099795_10124613 3300007788 Bacteria 1034
186 Ga0099795_10168010 3300007788 Unclassified 909
187 Ga0105240_10001262 3300009093 Bacteria 43870
188 Ga0105240_10025646 3300009093 Bacteria 7743
189 Ga0105240_10091849 3300009093 Bacteria 3708
190 Ga0105240_10142165 3300009093 Bacteria 2868
191 Ga0105240_10955953 3300009093 Unclassified 919
192 Ga0114129_11513819 3300009147 Unclassified 824
193 Ga0105241_10133235 3300009174 Unclassified 2014
194 Ga0105242_10023594 3300009176 Bacteria 4848
195 Ga0105242_10517984 3300009176 Unclassified 1137
196 Ga0105248_10004669 3300009177 Bacteria 15163
197 Ga0105248_10005203 3300009177 Bacteria 14334
198 Ga0105248_10005926 3300009177 Bacteria 13438
199 Ga0105248_10629393 3300009177 Bacteria 1211
200 Ga0105248_11698707 3300009177 Unclassified 716
201 Ga0105237_10027830 3300009545 Bacteria 5760
202 Ga0105237_10401052 3300009545 Bacteria 1376
203 Ga0105237_10700875 3300009545 Unclassified 1019
204 Ga0105238_10063186 3300009551 Bacteria 3702
205 Ga0105238_10209961 3300009551 Bacteria 1923
206 Ga0105238_10305571 3300009551 Bacteria 1575
207 Ga0105249_10758742 3300009553 Bacteria 1032
208 Ga0099796_10071335 3300010159 Bacteria 1255
209 Ga0099796_10074025 3300010159 Unclassified 1236
210 Ga0105239_10005194 3300010375 Bacteria 15321
211 Ga0105239_11119362 3300010375 Unclassified 907
212 Ga0157373_10731842 3300013100 Unclassified 726
213 Ga0157371_10045805 3300013102 Bacteria 3112
214 Ga0157371_10112475 3300013102 Bacteria 1933
215 Ga0157371_10215719 3300013102 Bacteria 1378
216 Ga0157371_10260499 3300013102 Bacteria 1250
217 Ga0157371_10622661 3300013102 Bacteria 804
218 Ga0157370_10075937 3300013104 Bacteria 3166
219 Ga0157370_10107979 3300013104 Bacteria 2603
220 Ga0157370_10285132 3300013104 Bacteria 1526
221 Ga0157370_10575659 3300013104 Bacteria 1032
222 Ga0157370_10671453 3300013104 Unclassified 947
223 Ga0157369_10113422 3300013105 Bacteria 2879
224 Ga0157369_10231562 3300013105 Bacteria 1931
225 Ga0157369_10452998 3300013105 Bacteria 1329
226 Ga0157369_11186369 3300013105 Unclassified 779
227 Ga0157374_10001701 3300013296 Bacteria 18438
228 Ga0157374_10007767 3300013296 Bacteria 9154
229 Ga0157374_10109309 3300013296 Bacteria 2658
230 Ga0157374_10120920 3300013296 Bacteria 2527
231 Ga0157374_10267851 3300013296 Bacteria 1684
232 Ga0163162_10009086 3300013306 Bacteria 9663
233 Ga0163162_10093381 3300013306 Bacteria 3093
234 Ga0157372_10007088 3300013307 Bacteria 11947
235 Ga0157372_10143474 3300013307 Bacteria 2753
236 Ga0157372_10773427 3300013307 Bacteria 1116
237 Ga0157375_10002801 3300013308 Bacteria 15086
238 Ga0157375_10012273 3300013308 Bacteria 7597
239 Ga0157375_10085949 3300013308 Bacteria 3195
240 Ga0157375_10613332 3300013308 Bacteria 1247
241 Ga0163163_10031632 3300014325 Bacteria 5108
242 Ga0157377_11051747 3300014745 Unclassified 620
243 Ga0157379_10054440 3300014968 Bacteria 3575
244 Ga0157379_10402534 3300014968 Unclassified 1258
245 Ga0157376_10003209 3300014969 Bacteria 11252
246 Ga0157376_10433828 3300014969 Unclassified 1278
247 Ga0157376_10486100 3300014969 Bacteria 1211
248 Ga0157376_10551975 3300014969 Unclassified 1140
249 Ga0182007_10180941 3300015262 Unclassified 729
250 Ga0163161_10554451 3300017792 Bacteria 942
251 Ga0206356_10594416 3300020070 Bacteria 960
252 Ga0206353_10632324 3300020082 Bacteria 2589
253 Ga0213876_10486145 3300021384 Unclassified 657
254 Ga0209437_106313 3300025233 Bacteria 1978
255 Ga0209233_1000164 3300025261 Bacteria 152430
256 Ga0209455_1002787 3300025272 Bacteria 6523
257 Ga0207656_10082194 3300025321 Unclassified 1449
258 Ga0207692_10147847 3300025898 Unclassified 1343
259 Ga0207642_10118457 3300025899 Unclassified 1361
260 Ga0207680_10081222 3300025903 Bacteria 2037
261 Ga0207680_10104983 3300025903 Bacteria 1822
262 Ga0207680_10764844 3300025903 Bacteria 692
263 Ga0207647_10006725 3300025904 Bacteria 8348
264 Ga0207647_10137348 3300025904 Bacteria 1434
265 Ga0207647_10400077 3300025904 Bacteria 774
266 Ga0207685_10048167 3300025905 Unclassified 1631
267 Ga0207685_10098213 3300025905 Bacteria 1247
268 Ga0207699_10340754 3300025906 Bacteria 1056
269 Ga0207645_10067729 3300025907 Bacteria 2282
270 Ga0207705_10015766 3300025909 Bacteria 5426
271 Ga0207705_10029231 3300025909 Bacteria 3929
272 Ga0207705_10038020 3300025909 Bacteria 3445
273 Ga0207705_10200405 3300025909 Unclassified 1512
274 Ga0207705_10232487 3300025909 Unclassified 1403
275 Ga0207705_10240770 3300025909 Bacteria 1378
276 Ga0207684_10028953 3300025910 Unclassified 4717
277 Ga0207684_10277646 3300025910 Bacteria 1445
278 Ga0207684_10651896 3300025910 Bacteria 897
279 Ga0207654_10494670 3300025911 Unclassified 863
280 Ga0207707_10010497 3300025912 Bacteria 8039
281 Ga0207707_10228554 3300025912 Bacteria 1619
282 Ga0207695_10000680 3300025913 Bacteria 66673
283 Ga0207695_10000841 3300025913 Bacteria 56351
284 Ga0207695_10006293 3300025913 Bacteria 15449
285 Ga0207695_10031022 3300025913 Bacteria 5874
286 Ga0207695_10064995 3300025913 Bacteria 3752
287 Ga0207695_10196978 3300025913 Bacteria 1930
288 Ga0207671_10062442 3300025914 Bacteria 2766
289 Ga0207693_10182556 3300025915 Unclassified 1651
290 Ga0207660_10382368 3300025917 Bacteria 1132
291 Ga0207657_10017968 3300025919 Bacteria 6768
292 Ga0207657_10062277 3300025919 Bacteria 3195
293 Ga0207657_10080342 3300025919 Bacteria 2741
294 Ga0207657_10241887 3300025919 Bacteria 1441
295 Ga0207649_10032112 3300025920 Bacteria 3127
296 Ga0207649_10098021 3300025920 Bacteria 1934
297 Ga0207649_10590366 3300025920 Unclassified 853
298 Ga0207652_10050098 3300025921 Bacteria 3577
299 Ga0207652_10085708 3300025921 Bacteria 2761
300 Ga0207652_10377462 3300025921 Bacteria 1280
301 Ga0207646_10002319 3300025922 Bacteria 22546
302 Ga0207646_10469455 3300025922 Unclassified 1135
303 Ga0207646_10900750 3300025922 Unclassified 785
304 Ga0207694_10267317 3300025924 Unclassified 1402
305 Ga0207650_10016416 3300025925 Bacteria 5174
306 Ga0207650_10059600 3300025925 Bacteria 2846
307 Ga0207650_10129942 3300025925 Bacteria 1970
308 Ga0207659_10478513 3300025926 Bacteria 1052
309 Ga0207659_10744720 3300025926 Bacteria 840
310 Ga0207687_10011495 3300025927 Bacteria 5786
311 Ga0207700_10057451 3300025928 Unclassified 2934
312 Ga0207700_10194960 3300025928 Bacteria 1704
313 Ga0207700_10244268 3300025928 Unclassified 1531
314 Ga0207700_10808530 3300025928 Unclassified 838
315 Ga0207664_10257652 3300025929 Bacteria 1524
316 Ga0207664_10999181 3300025929 Unclassified 750
317 Ga0207644_10001488 3300025931 Bacteria 15073
318 Ga0207644_10009642 3300025931 Bacteria 6343
319 Ga0207644_10013365 3300025931 Bacteria 5472
320 Ga0207644_10649160 3300025931 Unclassified 878
321 Ga0207690_10072400 3300025932 Bacteria 2380
322 Ga0207690_10082924 3300025932 Bacteria 2243
323 Ga0207690_10102885 3300025932 Bacteria 2043
324 Ga0207706_10005791 3300025933 Bacteria 11497
325 Ga0207706_10066288 3300025933 Bacteria 3177
326 Ga0207706_10110603 3300025933 Bacteria 2417
327 Ga0207706_10535921 3300025933 Bacteria 1009
328 Ga0207686_10017769 3300025934 Bacteria 4013
329 Ga0207709_10075050 3300025935 Bacteria 2160
330 Ga0207669_10064585 3300025937 Unclassified 2266
331 Ga0207669_10237117 3300025937 Bacteria 1350
332 Ga0207665_10113634 3300025939 Bacteria 1905
333 Ga0207665_10335019 3300025939 Bacteria 1139
334 Ga0207691_10012580 3300025940 Bacteria 8111
335 Ga0207691_10019454 3300025940 Bacteria 6424
336 Ga0207691_10067094 3300025940 Bacteria 3244
337 Ga0207691_10146470 3300025940 Bacteria 2079
338 Ga0207691_10390489 3300025940 Bacteria 1187
339 Ga0207711_10000055 3300025941 Bacteria 136126
340 Ga0207711_10020807 3300025941 Bacteria 5475
341 Ga0207711_10042604 3300025941 Bacteria 3868
342 Ga0207711_10176285 3300025941 Bacteria 1942
343 Ga0207689_10194775 3300025942 Bacteria 1672
344 Ga0207689_10295642 3300025942 Bacteria 1342
345 Ga0207689_10543570 3300025942 Unclassified 975
346 Ga0207689_10781644 3300025942 Bacteria 806
347 Ga0207661_10049762 3300025944 Bacteria 3337
348 Ga0207661_10443537 3300025944 Unclassified 1181
349 Ga0207679_10019707 3300025945 Bacteria 4539
350 Ga0207679_10056312 3300025945 Bacteria 2902
351 Ga0207667_10009439 3300025949 Bacteria 11487
352 Ga0207667_10093376 3300025949 Bacteria 3107
353 Ga0207667_10139454 3300025949 Bacteria 2496
354 Ga0207667_10169445 3300025949 Bacteria 2244
355 Ga0207667_10230247 3300025949 Bacteria 1898
356 Ga0207667_10611180 3300025949 Bacteria 1098
357 Ga0207712_10401404 3300025961 Bacteria 1152
358 Ga0207668_10312227 3300025972 Bacteria 1302
359 Ga0207640_10290890 3300025981 Bacteria 1288
360 Ga0207640_11324789 3300025981 Bacteria 643
361 Ga0207658_10018562 3300025986 Bacteria 4805
362 Ga0207658_10088852 3300025986 Bacteria 2390
363 Ga0207658_10286654 3300025986 Bacteria 1414
364 Ga0207658_10482964 3300025986 Bacteria 1101
365 Ga0207658_10642136 3300025986 Unclassified 956
366 Ga0207703_10000142 3300026035 Bacteria 84567
367 Ga0207703_10035978 3300026035 Bacteria 3937
368 Ga0207703_10354546 3300026035 Bacteria 1351
369 Ga0207639_10030573 3300026041 Bacteria 3950
370 Ga0207639_10046953 3300026041 Bacteria 3260
371 Ga0207639_10234754 3300026041 Bacteria 1592
372 Ga0207639_10860407 3300026041 Unclassified 846
373 Ga0207639_10866776 3300026041 Bacteria 843
374 Ga0207678_10006429 3300026067 Bacteria 10425
375 Ga0207678_10016373 3300026067 Bacteria 6510
376 Ga0207678_10030171 3300026067 Bacteria 4733
377 Ga0207678_10236260 3300026067 Bacteria 1565
378 Ga0207702_10032194 3300026078 Bacteria 4374
379 Ga0207702_10032482 3300026078 Bacteria 4355
380 Ga0207702_10361382 3300026078 Bacteria 1392
381 Ga0207641_10022908 3300026088 Bacteria 5144
382 Ga0207641_10361642 3300026088 Bacteria 1386
383 Ga0207648_10041232 3300026089 Bacteria 4054
384 Ga0207648_10074063 3300026089 Bacteria 2967
385 Ga0207676_10005760 3300026095 Bacteria 8763
386 Ga0207676_10015093 3300026095 Bacteria 5570
387 Ga0207676_10304089 3300026095 Unclassified 1457
388 Ga0207676_10822140 3300026095 Unclassified 907
389 Ga0207676_11593504 3300026095 Bacteria 651
390 Ga0207674_10224685 3300026116 Unclassified 1826
391 Ga0207675_100139511 3300026118 Bacteria 2302
392 Ga0207675_100936154 3300026118 Bacteria 883
393 Ga0207683_10000745 3300026121 Bacteria 29522
394 Ga0207683_10079418 3300026121 Bacteria 2909
395 Ga0207683_10097751 3300026121 Unclassified 2619
396 Ga0207698_10003993 3300026142 Bacteria 8950
397 Ga0207698_10004706 3300026142 Bacteria 8345
398 Ga0207698_10186270 3300026142 Bacteria 1844
399 Ga0207698_10310466 3300026142 Bacteria 1472
400 Ga0207698_10336978 3300026142 Unclassified 1419
401 Ga0207698_10995329 3300026142 Bacteria 849
402 Ga0209588_1174043 3300027671 Bacteria 677
403 Ga0268266_10000001 3300028379 Bacteria 4040580
404 Ga0268266_10556105 3300028379 Bacteria 1100
405 Ga0268266_10612059 3300028379 Unclassified 1047
406 Ga0268266_10748664 3300028379 Unclassified 943
407 Ga0268264_10609339 3300028381 Bacteria 1077
408 Ga0307509_10177530 3300031507 Bacteria 2000
409 Ga0307508_10008194 3300031616 Bacteria 9691
410 Ga0307516_10051345 3300031730 Bacteria 4042
411 Ga0307410_10369868 3300031852 Unclassified 1151
412 Ga0307407_10192805 3300031903 Bacteria 1360
413 Ga0307416_100903958 3300032002 Bacteria 983
414 Ga0307411_10238539 3300032005 Bacteria 1422
415 Ga0307415_100140296 3300032126 Unclassified 1845
416 Ga0373932_0037856 3300035112 Bacteria 1377
417 Ga0373954_0273401 3300035118 Bacteria 833
418 Ga0373955_0448842 3300035172 Bacteria 786
419 Ga0373931_0052755 3300035691 Bacteria 2169
420 Ga0373931_0386202 3300035691 Unclassified 884
421 Ga0373931_0789074 3300035691 Unclassified 633
422 Ga0373935_0014276 3300035692 Bacteria 4794
423 Ga0373927_0315788 3300035695 Unclassified 1029
424 Ga0373947_0062657 3300035725 Unclassified 2264
425 Ga0395899_0012153 3300037312 Bacteria 6593
426 Ga0395899_0019957 3300037312 Bacteria 5084
427 Ga0395899_0039187 3300037312 Bacteria 3548
428 Ga0395899_0063258 3300037312 Bacteria 2722
429 Ga0395899_0078874 3300037312 Bacteria 2399
430 Ga0395899_0118680 3300037312 Bacteria 1897
431 Ga0395899_0238242 3300037312 Bacteria 1253
432 Ga0395899_0296731 3300037312 Unclassified 1095
433 Ga0395900_0000129 3300037418 Bacteria 126281
434 Ga0395900_0043823 3300037418 Bacteria 4611
435 Ga0395900_0211291 3300037418 Bacteria 1959
436 Ga0395900_0225048 3300037418 Bacteria 1889
437 Ga0395900_0231166 3300037418 Bacteria 1859
438 Ga0395900_0263766 3300037418 Bacteria 1719
439 Ga0395900_0376921 3300037418 Bacteria 1387
440 Ga0395900_0638306 3300037418 Bacteria 1002
441 Ga0395900_0944506 3300037418 Bacteria 784
442 Ga0395898_0055774 3300037466 Bacteria 3854
443 Ga0395898_0121689 3300037466 Bacteria 2500
444 Ga0395898_0137193 3300037466 Bacteria 2342
445 Ga0395898_0139165 3300037466 Bacteria 2324
446 Ga0395898_0220856 3300037466 Bacteria 1807
447 Ga0395898_0225084 3300037466 Bacteria 1789
448 Ga0395905_0016756 3300037471 Bacteria 6963
449 Ga0395905_0081650 3300037471 Bacteria 3029
450 Ga0395905_0084065 3300037471 Bacteria 2982
451 Ga0395905_0103900 3300037471 Bacteria 2667
452 Ga0395905_0118656 3300037471 Bacteria 2486
453 Ga0395905_0165879 3300037471 Bacteria 2075
454 Ga0395905_0174168 3300037471 Bacteria 2020
455 Ga0395905_0314638 3300037471 Bacteria 1454
456 Ga0395905_0391400 3300037471 Bacteria 1284
457 Ga0395905_0608118 3300037471 Unclassified 995
458 Ga0395905_0750995 3300037471 Unclassified 878
459 Ga0395901_0000111 3300038443 Bacteria 112522
460 Ga0395901_0028976 3300038443 Bacteria 5695
461 Ga0395901_0099049 3300038443 Bacteria 3056
462 Ga0395901_0139868 3300038443 Bacteria 2544
463 Ga0395901_0176597 3300038443 Bacteria 2240
464 Ga0395901_0225788 3300038443 Bacteria 1956
465 Ga0395901_0315432 3300038443 Unclassified 1618
466 Ga0395901_0332651 3300038443 Bacteria 1570
467 Ga0395901_0430214 3300038443 Bacteria 1352
468 Ga0395901_0516148 3300038443 Bacteria 1214
469 Ga0395901_0521179 3300038443 Bacteria 1207
470 Ga0395901_0573664 3300038443 Unclassified 1141
471 Ga0436365_0595875 3300039437 Unclassified 959
472 Ga0436365_1396233 3300039437 Bacteria 32095
473 Ga0436365_1629876 3300039437 Bacteria 1729
474 Ga0436360_0299700 3300039438 Unclassified 991
475 Ga0436361_0901056 3300039447 Bacteria 1731
476 Ga0436363_0474778 3300039450 Bacteria 4361
477 Ga0436362_0799873 3300039453 Bacteria 1546
478 Ga0451793_1325943 3300041452 Bacteria 1861
479 Ga0451797_0762014 3300041453 Bacteria 1599
480 Ga0451807_0256388 3300041486 Bacteria 2719
481 Ga0451843_0824547 3300041509 Bacteria 1598
482 Ga0466969_0088909 3300044656 Bacteria 1466
483 Ga0466972_0105016 3300044658 Unclassified 1336
484 Ga0466966_0031054 3300044684 Bacteria 3464
485 Ga0466966_0427968 3300044684 Unclassified 796
486 Ga0466961_0025252 3300044693 Bacteria 3821
487 Ga0466961_0043619 3300044693 Bacteria 2871
488 Ga0466961_0075882 3300044693 Bacteria 2130
489 Ga0466963_0043971 3300044694 Bacteria 2939
490 Ga0466963_0045245 3300044694 Bacteria 2899
491 Ga0466964_0014173 3300044706 Bacteria 3029
492 Ga0466964_0060021 3300044706 Unclassified 1581
493 Ga0466971_0181143 3300044719 Bacteria 990
494 Ga0466970_0019969 3300044765 Bacteria 3477
495 Ga0466970_0097886 3300044765 Bacteria 1596
496 Ga0466957_0098544 3300044842 Bacteria 1839
497 Ga0466957_0302896 3300044842 Unclassified 1074
498 Ga0466959_0017759 3300045049 Bacteria 5217
499 Ga0466959_0087444 3300045049 Bacteria 2241
500 Ga0466958_0009111 3300045836 Bacteria 5517
501 Ga0466958_0017524 3300045836 Bacteria 4143
502 Ga0466958_0376896 3300045836 Bacteria 915
503 Ga0466958_0474951 3300045836 Bacteria 810
504 Ga0466967_0012264 3300045976 Bacteria 6545
505 Ga0466967_0036011 3300045976 Bacteria 4221
506 Ga0466967_0166586 3300045976 Bacteria 2071
507 Ga0466967_0414280 3300045976 Bacteria 1312
508 Ga0466967_0603820 3300045976 Bacteria 1083
509 Ga0466967_1689759 3300045976 Bacteria 630
510 Ga0495608_0137503 3300046511 Bacteria 1561
511 Ga0495618_0080977 3300046514 Bacteria 2073
512 Ga0495652_0278573 3300046529 Bacteria 1226
513 Ga0495645_0336953 3300046543 Bacteria 975
514 Ga0495599_0145663 3300046678 Bacteria 1468
515 Ga0495623_0153015 3300046679 Bacteria 1362
516 Ga0495674_0624956 3300047319 Bacteria 851
517 Ga0495602_0495988 3300048088 Bacteria 854
518 Ga0496100_0026250 3300048903 Bacteria 3570
519 Ga0496100_0219174 3300048903 Bacteria 1395
520 Ga0496100_0393431 3300048903 Bacteria 1054
521 Ga0496101_0019668 3300048904 Bacteria 4614
522 Ga0496101_0083859 3300048904 Bacteria 2359
523 Ga0496101_0110901 3300048904 Bacteria 2065
524 Ga0496101_0368952 3300048904 Unclassified 1129
525 Ga0496101_0732572 3300048904 Unclassified 780
526 Ga0496102_0242830 3300048905 Bacteria 1698
527 Ga0496103_0434592 3300048906 Unclassified 842
528 Ga0496104_0283355 3300048907 Bacteria 1570
529 Ga0496106_0002420 3300048909 Bacteria 13910
530 Ga0496106_0047147 3300048909 Bacteria 3242
531 Ga0496106_0832104 3300048909 Unclassified 731
532 Ga0496107_0002628 3300048910 Bacteria 11750
533 Ga0496107_0012732 3300048910 Bacteria 5877
534 Ga0496108_0017914 3300048911 Bacteria 5794
535 Ga0496108_0048034 3300048911 Bacteria 3568
536 Ga0496109_0011703 3300048912 Bacteria 7546
537 Ga0496109_0021054 3300048912 Bacteria 5765
538 Ga0496109_0590012 3300048912 Bacteria 1047
539 Ga0496109_1322289 3300048912 Unclassified 657
540 Ga0496110_0008269 3300048913 Bacteria 8364
541 Ga0496110_0019537 3300048913 Bacteria 5704
542 Ga0496111_0001851 3300048914 Bacteria 12479
543 Ga0496111_0350161 3300048914 Bacteria 1093
544 Ga0496112_0020106 3300048915 Bacteria 6320
545 Ga0496112_0147907 3300048915 Bacteria 2317
546 Ga0496112_0177807 3300048915 Bacteria 2092
547 Ga0496113_0005391 3300048916 Bacteria 7975
548 Ga0496113_0011133 3300048916 Bacteria 5984
549 Ga0496114_0000001 3300048917 Bacteria 893286
550 Ga0496114_0109603 3300048917 Bacteria 2364
551 Ga0496115_0000277 3300048918 Bacteria 45027
552 Ga0496115_0000893 3300048918 Bacteria 21636
553 Ga0496115_0162578 3300048918 Bacteria 1845
554 Ga0496115_0699256 3300048918 Unclassified 797
555 Ga0496115_1015434 3300048918 Unclassified 633
556 Ga0501299_023684 3300049522 Unclassified 1141
557 Ga0501032_0022474 3300049569 Bacteria 4370
558 Ga0501033_0000648 3300049570 Bacteria 32231
559 Ga0501033_0187145 3300049570 Bacteria 1482
560 Ga0501033_0215414 3300049570 Bacteria 1368
561 Ga0501034_0010499 3300049571 Bacteria 9643
562 Ga0501034_0024726 3300049571 Bacteria 6109
563 Ga0501034_0027777 3300049571 Bacteria 5753
564 Ga0501036_0290313 3300049572 Bacteria 1368
565 Ga0501036_1058375 3300049572 Bacteria 663
566 Ga0501037_0035303 3300049573 Bacteria 3687
567 Ga0501037_0055482 3300049573 Bacteria 2896
568 Ga0501038_0009401 3300049574 Bacteria 8970
569 Ga0501038_0052805 3300049574 Bacteria 3502
570 Ga0501038_0070725 3300049574 Bacteria 2961
571 Ga0501039_0017676 3300049575 Bacteria 5470
572 Ga0501039_0182484 3300049575 Bacteria 1650
573 Ga0501040_0013411 3300049576 Bacteria 5386
574 Ga0501041_0154696 3300049577 Bacteria 1433
575 Ga0501042_0107895 3300049578 Bacteria 2004
576 Ga0501042_0384195 3300049578 Bacteria 1017
577 Ga0501043_0013291 3300049579 Bacteria 6438
578 Ga0501043_0015966 3300049579 Bacteria 5886
579 Ga0501043_0036726 3300049579 Bacteria 3854
580 Ga0501043_0128802 3300049579 Unclassified 1984
581 Ga0501046_0015614 3300049580 Bacteria 6376
582 Ga0501046_0017282 3300049580 Bacteria 6023
583 Ga0501046_0071270 3300049580 Bacteria 2700
584 Ga0501047_0131318 3300049581 Bacteria 2385
585 Ga0501047_0208098 3300049581 Bacteria 1815
586 Ga0501048_0104065 3300049582 Bacteria 2003
587 Ga0501067_0063710 3300049583 Bacteria 2041
588 Ga0501068_0050769 3300049584 Bacteria 2507
589 Ga0501068_0429217 3300049584 Bacteria 854
590 Ga0501068_0596006 3300049584 Bacteria 720
591 Ga0501069_0042848 3300049585 Bacteria 2504
592 Ga0501070_0264482 3300049586 Bacteria 1405
593 Ga0501070_0588883 3300049586 Bacteria 887
594 Ga0501071_0334260 3300049587 Bacteria 1151
595 Ga0501071_1001005 3300049587 Bacteria 646
596 Ga0501072_0546055 3300049588 Bacteria 915
597 Ga0501073_0013235 3300049589 Bacteria 6012
598 Ga0501073_0098148 3300049589 Bacteria 2034
599 Ga0501073_0634747 3300049589 Bacteria 737
600 Ga0501074_0009236 3300049590 Bacteria 7164
601 Ga0501076_0178236 3300049592 Bacteria 1732
602 Ga0501079_0037327 3300049741 Unclassified 3744
603 Ga0501079_1032681 3300049741 Unclassified 647
604 Ga0501080_0461952 3300049742 Bacteria 1137
605 Ga0501080_0560046 3300049742 Bacteria 1017
606 Ga0501080_0905726 3300049742 Bacteria 768
607 Ga0501081_0115943 3300049743 Bacteria 1904
608 Ga0501083_0053677 3300049744 Plasmid 2705
609 Ga0501035_0013435 3300049822 Bacteria 7558
610 Ga0501035_0070944 3300049822 Bacteria 3085
611 Ga0501035_0101727 3300049822 Bacteria 2521
612 Ga0501035_0132867 3300049822 Unclassified 2168
613 Ga0501044_0014392 3300049823 Bacteria 8543
614 Ga0501044_0028425 3300049823 Bacteria 5902
615 Ga0501044_0080244 3300049823 Bacteria 3305
616 Ga0501044_0156334 3300049823 Unclassified 2259
617 Ga0501044_0220439 3300049823 Bacteria 1847
618 Ga0501044_0314150 3300049823 Bacteria 1493
619 Ga0501044_0697362 3300049823 Unclassified 901
620 Ga0501045_0052777 3300049824 Bacteria 2969
621 nmdc:mga0qj67_567810_c1 3300050509 Bacteria 909
622 nmdc:mga0n895_159614_c1 3300050512 Bacteria 2286
623 nmdc:mga0n895_296465_c1 3300050512 Bacteria 1639
624 Ga0500559_0034723 3300053136 Bacteria 2176
625 Ga0500559_0039937 3300053136 Bacteria 2042
626 Ga0500568_0000336 3300053139 Bacteria 37013
627 Ga0501082_0000969 3300060353 Bacteria 25393
628 Ga0501082_0009960 3300060353 Bacteria 8196
629 Ga0207639_10144249
630 SwRhRL2b_contig_3044722
631 MRS1b_contig_6314018
632 JGI24740J21852_10015187
633 JGI24740J21852_10030294
634 JGI24737J22298_10027767
635 JGI24735J21928_10151707
636 JGI24034J26672_10026896
637 rootL2_10355494
638 Ga0065704_10004938
639 Ga0065704_10009865
640 Ga0065712_10207378
641 Ga0065715_10066692
642 Ga0065707_10108066
643 Ga0070658_10124296
644 Ga0070658_10164771
645 Ga0070658_10261652
646 Ga0070658_10374432
647 Ga0070658_10870529
648 Ga0070676_10783220
649 Ga0070683_100086048
650 Ga0070683_100103310
651 Ga0070683_100228012
652 Ga0070683_100521968
653 Ga0070690_100082723
654 Ga0070670_100002167
655 Ga0070670_100006159
656 Ga0070670_100078780
657 Ga0070670_100101457
658 Ga0070670_100831898
659 Ga0068869_100247611
660 Ga0070666_10001456
661 Ga0070666_10170783
662 Ga0070666_10465901
663 Ga0070680_100089269
664 Ga0070680_100800745
665 Ga0070682_100359125
666 Ga0068868_100760248
667 Ga0070660_100045646
668 Ga0070660_100057872
669 Ga0070660_100111353
670 Ga0070660_100243638
671 Ga0070660_100409060
672 Ga0070660_100600854
673 Ga0070660_100793676
674 Ga0070691_10031852
675 Ga0070661_100097554
676 Ga0070661_100235404
677 Ga0070661_100406635
678 Ga0070661_100415894
679 Ga0070661_101060936
680 Ga0070692_10013140
681 Ga0070692_10023871
682 Ga0070692_10048594
683 Ga0070668_100051664
684 Ga0070668_100150159
685 Ga0070668_100163561
686 Ga0070675_100016071
687 Ga0070675_100864322
688 Ga0070675_100995010
689 Ga0070671_100008382
690 Ga0070671_100030092
691 Ga0070674_100068449
692 Ga0070674_100073268
693 Ga0070673_100903501
694 Ga0070659_100037335
695 Ga0070659_100114133
696 Ga0070659_100418157
697 Ga0070667_100006596
698 Ga0070667_100367964
699 Ga0070667_100399642
700 Ga0070667_100755494
701 Ga0070667_101553991
702 Ga0070709_10237395
703 Ga0070709_10644243
704 Ga0070714_100006317
705 Ga0070714_100454790
706 Ga0070714_101231594
707 Ga0070713_100218805
708 Ga0070713_100393858
709 Ga0070710_10049815
710 Ga0070710_10126131
711 Ga0070710_10498100
712 Ga0070705_100533156
713 Ga0070708_100366695
714 Ga0070663_100058724
715 Ga0070663_100185303
716 Ga0070663_100216318
717 Ga0070663_101057131
718 Ga0070678_100018439
719 Ga0070678_100055287
720 Ga0070678_100058408
721 Ga0070662_100008697
722 Ga0070662_100110823
723 Ga0070662_100255129
724 Ga0070681_10128149
725 Ga0068867_100029532
726 Ga0070685_10173250
727 Ga0070706_100752252
728 Ga0070706_101094629
729 Ga0070707_100031425
730 Ga0070707_100068859
731 Ga0070707_100801487
732 Ga0070698_100012876
733 Ga0070699_100296805
734 Ga0070699_100819857
735 Ga0070679_100041062
736 Ga0070679_100117155
737 Ga0070679_100227965
738 Ga0070684_100020430
739 Ga0070684_100381416
740 Ga0070697_100024304
741 Ga0070697_100376864
742 Ga0068853_100027618
743 Ga0068853_100101403
744 Ga0068853_100206495
745 Ga0068853_100353163
746 Ga0068853_100837640
747 Ga0068853_100912872
748 Ga0070672_100001795
749 Ga0070672_100012274
750 Ga0070672_100216058
751 Ga0070672_100406323
752 Ga0070672_100411183
753 Ga0070686_100618558
754 Ga0070696_100774043
755 Ga0070665_100000636
756 Ga0070665_100026248
757 Ga0070665_100074742
758 Ga0070665_100644902
759 Ga0070665_101374567
760 Ga0070704_100657050
761 Ga0068855_100044117
762 Ga0068855_100194686
763 Ga0068855_100268634
764 Ga0070664_100011305
765 Ga0070664_100064162
766 Ga0068857_100019712
767 Ga0068854_100847301
768 Ga0068856_100001655
769 Ga0068856_100225438
770 Ga0068852_100001333
771 Ga0068852_100021356
772 Ga0068852_100158769
773 Ga0068852_100335177
774 Ga0068852_100491387
775 Ga0068852_101061067
776 Ga0068859_100063166
777 Ga0068864_100000828
778 Ga0068864_100051301
779 Ga0068864_100359495
780 Ga0068864_100916734
781 Ga0068866_10026160
782 Ga0068861_100119491
783 Ga0068861_100584844
784 Ga0068851_10049921
785 Ga0068863_100003749
786 Ga0068863_100213188
787 Ga0068863_100361597
788 Ga0068858_100000626
789 Ga0068858_101000813
790 Ga0081540_1188281
791 Ga0070717_10042039
792 Ga0070717_10302734
793 Ga0070717_10427058
794 Ga0070717_10584084
795 Ga0070717_10886413
796 Ga0070715_10114397
797 Ga0070716_100122805
798 Ga0070716_100245997
799 Ga0097621_100009198
800 Ga0097621_100014969
801 Ga0097621_100205400
802 Ga0068871_100017862
803 Ga0068871_100113218
804 Ga0068871_100155848
805 Ga0075430_100601401
806 Ga0075434_100068738
807 Ga0075434_100181164
808 Ga0068865_100128159
809 Ga0068865_100388120
810 Ga0075436_100251773
811 Ga0097620_100063166
812 Ga0099794_10151103
813 Ga0099795_10124613
814 Ga0099795_10168010
815 Ga0105240_10001262
816 Ga0105240_10025646
817 Ga0105240_10091849
818 Ga0105240_10142165
819 Ga0105240_10955953
820 Ga0114129_11513819
821 Ga0105241_10133235
822 Ga0105242_10023594
823 Ga0105242_10517984
824 Ga0105248_10004669
825 Ga0105248_10005203
826 Ga0105248_10005926
827 Ga0105248_10629393
828 Ga0105248_11698707
829 Ga0105237_10027830
830 Ga0105237_10401052
831 Ga0105237_10700875
832 Ga0105238_10063186
833 Ga0105238_10209961
834 Ga0105238_10305571
835 Ga0105249_10758742
836 Ga0099796_10071335
837 Ga0099796_10074025
838 Ga0105239_10005194
839 Ga0105239_11119362
840 Ga0157373_10731842
841 Ga0157371_10045805
842 Ga0157371_10112475
843 Ga0157371_10215719
844 Ga0157371_10260499
845 Ga0157371_10622661
846 Ga0157370_10075937
847 Ga0157370_10107979
848 Ga0157370_10285132
849 Ga0157370_10575659
850 Ga0157370_10671453
851 Ga0157369_10113422
852 Ga0157369_10231562
853 Ga0157369_10452998
854 Ga0157369_11186369
855 Ga0157374_10001701
856 Ga0157374_10007767
857 Ga0157374_10109309
858 Ga0157374_10120920
859 Ga0157374_10267851
860 Ga0163162_10009086
861 Ga0163162_10093381
862 Ga0157372_10007088
863 Ga0157372_10143474
864 Ga0157372_10773427
865 Ga0157375_10002801
866 Ga0157375_10012273
867 Ga0157375_10085949
868 Ga0157375_10613332
869 Ga0163163_10031632
870 Ga0157377_11051747
871 Ga0157379_10054440
872 Ga0157379_10402534
873 Ga0157376_10003209
874 Ga0157376_10433828
875 Ga0157376_10486100
876 Ga0157376_10551975
877 Ga0182007_10180941
878 Ga0163161_10554451
879 Ga0206356_10594416
880 Ga0206353_10632324
881 Ga0213876_10486145
882 Ga0209437_106313
883 Ga0209233_1000164
884 Ga0209455_1002787
885 Ga0207656_10082194
886 Ga0207692_10147847
887 Ga0207642_10118457
888 Ga0207680_10081222
889 Ga0207680_10104983
890 Ga0207680_10764844
891 Ga0207647_10006725
892 Ga0207647_10137348
893 Ga0207647_10400077
894 Ga0207685_10048167
895 Ga0207685_10098213
896 Ga0207699_10340754
897 Ga0207645_10067729
898 Ga0207705_10015766
899 Ga0207705_10029231
900 Ga0207705_10038020
901 Ga0207705_10200405
902 Ga0207705_10232487
903 Ga0207705_10240770
904 Ga0207684_10028953
905 Ga0207684_10277646
906 Ga0207684_10651896
907 Ga0207654_10494670
908 Ga0207707_10010497
909 Ga0207707_10228554
910 Ga0207695_10000680
911 Ga0207695_10000841
912 Ga0207695_10006293
913 Ga0207695_10031022
914 Ga0207695_10064995
915 Ga0207695_10196978
916 Ga0207671_10062442
917 Ga0207693_10182556
918 Ga0207660_10382368
919 Ga0207657_10017968
920 Ga0207657_10062277
921 Ga0207657_10080342
922 Ga0207657_10241887
923 Ga0207649_10032112
924 Ga0207649_10098021
925 Ga0207649_10590366
926 Ga0207652_10050098
927 Ga0207652_10085708
928 Ga0207652_10377462
929 Ga0207646_10002319
930 Ga0207646_10469455
931 Ga0207646_10900750
932 Ga0207694_10267317
933 Ga0207650_10016416
934 Ga0207650_10059600
935 Ga0207650_10129942
936 Ga0207659_10478513
937 Ga0207659_10744720
938 Ga0207687_10011495
939 Ga0207700_10057451
940 Ga0207700_10194960
941 Ga0207700_10244268
942 Ga0207700_10808530
943 Ga0207664_10257652
944 Ga0207664_10999181
945 Ga0207644_10001488
946 Ga0207644_10009642
947 Ga0207644_10013365
948 Ga0207644_10649160
949 Ga0207690_10072400
950 Ga0207690_10082924
951 Ga0207690_10102885
952 Ga0207706_10005791
953 Ga0207706_10066288
954 Ga0207706_10110603
955 Ga0207706_10535921
956 Ga0207686_10017769
957 Ga0207709_10075050
958 Ga0207669_10064585
959 Ga0207669_10237117
960 Ga0207665_10113634
961 Ga0207665_10335019
962 Ga0207691_10012580
963 Ga0207691_10019454
964 Ga0207691_10067094
965 Ga0207691_10146470
966 Ga0207691_10390489
967 Ga0207711_10000055
968 Ga0207711_10020807
969 Ga0207711_10042604
970 Ga0207711_10176285
971 Ga0207689_10194775
972 Ga0207689_10295642
973 Ga0207689_10543570
974 Ga0207689_10781644
975 Ga0207661_10049762
976 Ga0207661_10443537
977 Ga0207679_10019707
978 Ga0207679_10056312
979 Ga0207667_10009439
980 Ga0207667_10093376
981 Ga0207667_10139454
982 Ga0207667_10169445
983 Ga0207667_10230247
984 Ga0207667_10611180
985 Ga0207712_10401404
986 Ga0207668_10312227
987 Ga0207640_10290890
988 Ga0207640_11324789
989 Ga0207658_10018562
990 Ga0207658_10088852
991 Ga0207658_10286654
992 Ga0207658_10482964
993 Ga0207658_10642136
994 Ga0207703_10000142
995 Ga0207703_10035978
996 Ga0207703_10354546
997 Ga0207639_10030573
998 Ga0207639_10046953
999 Ga0207639_10234754
1000 Ga0207639_10860407
1001 Ga0207639_10866776
1002 Ga0207678_10006429
1003 Ga0207678_10016373
1004 Ga0207678_10030171
1005 Ga0207678_10236260
1006 Ga0207702_10032194
1007 Ga0207702_10032482
1008 Ga0207702_10361382
1009 Ga0207641_10022908
1010 Ga0207641_10361642
1011 Ga0207648_10041232
1012 Ga0207648_10074063
1013 Ga0207676_10005760
1014 Ga0207676_10015093
1015 Ga0207676_10304089
1016 Ga0207676_10822140
1017 Ga0207676_11593504
1018 Ga0207674_10224685
1019 Ga0207675_100139511
1020 Ga0207675_100936154
1021 Ga0207683_10000745
1022 Ga0207683_10079418
1023 Ga0207683_10097751
1024 Ga0207698_10003993
1025 Ga0207698_10004706
1026 Ga0207698_10186270
1027 Ga0207698_10310466
1028 Ga0207698_10336978
1029 Ga0207698_10995329
1030 Ga0209588_1174043
1031 Ga0268266_10000001
1032 Ga0268266_10556105
1033 Ga0268266_10612059
1034 Ga0268266_10748664
1035 Ga0268264_10609339
1036 Ga0307509_10177530
1037 Ga0307508_10008194
1038 Ga0307516_10051345
1039 Ga0307410_10369868
1040 Ga0307407_10192805
1041 Ga0307416_100903958
1042 Ga0307411_10238539
1043 Ga0307415_100140296
1044 Ga0373932_0037856
1045 Ga0373954_0273401
1046 Ga0373955_0448842
1047 Ga0373931_0052755
1048 Ga0373931_0386202
1049 Ga0373931_0789074
1050 Ga0373935_0014276
1051 Ga0373927_0315788
1052 Ga0373947_0062657
1053 Ga0395899_0012153
1054 Ga0395899_0019957
1055 Ga0395899_0039187
1056 Ga0395899_0063258
1057 Ga0395899_0078874
1058 Ga0395899_0118680
1059 Ga0395899_0238242
1060 Ga0395899_0296731
1061 Ga0395900_0000129
1062 Ga0395900_0043823
1063 Ga0395900_0211291
1064 Ga0395900_0225048
1065 Ga0395900_0231166
1066 Ga0395900_0263766
1067 Ga0395900_0376921
1068 Ga0395900_0638306
1069 Ga0395900_0944506
1070 Ga0395898_0055774
1071 Ga0395898_0121689
1072 Ga0395898_0137193
1073 Ga0395898_0139165
1074 Ga0395898_0220856
1075 Ga0395898_0225084
1076 Ga0395905_0016756
1077 Ga0395905_0081650
1078 Ga0395905_0084065
1079 Ga0395905_0103900
1080 Ga0395905_0118656
1081 Ga0395905_0165879
1082 Ga0395905_0174168
1083 Ga0395905_0314638
1084 Ga0395905_0391400
1085 Ga0395905_0608118
1086 Ga0395905_0750995
1087 Ga0395901_0000111
1088 Ga0395901_0028976
1089 Ga0395901_0099049
1090 Ga0395901_0139868
1091 Ga0395901_0176597
1092 Ga0395901_0225788
1093 Ga0395901_0315432
1094 Ga0395901_0332651
1095 Ga0395901_0430214
1096 Ga0395901_0516148
1097 Ga0395901_0521179
1098 Ga0395901_0573664
1099 Ga0436365_0595875
1100 Ga0436365_1396233
1101 Ga0436365_1629876
1102 Ga0436360_0299700
1103 Ga0436361_0901056
1104 Ga0436363_0474778
1105 Ga0436362_0799873
1106 Ga0451793_1325943
1107 Ga0451797_0762014
1108 Ga0451807_0256388
1109 Ga0451843_0824547
1110 Ga0466969_0088909
1111 Ga0466972_0105016
1112 Ga0466966_0031054
1113 Ga0466966_0427968
1114 Ga0466961_0025252
1115 Ga0466961_0043619
1116 Ga0466961_0075882
1117 Ga0466963_0043971
1118 Ga0466963_0045245
1119 Ga0466964_0014173
1120 Ga0466964_0060021
1121 Ga0466971_0181143
1122 Ga0466970_0019969
1123 Ga0466970_0097886
1124 Ga0466957_0098544
1125 Ga0466957_0302896
1126 Ga0466959_0017759
1127 Ga0466959_0087444
1128 Ga0466958_0009111
1129 Ga0466958_0017524
1130 Ga0466958_0376896
1131 Ga0466958_0474951
1132 Ga0466967_0012264
1133 Ga0466967_0036011
1134 Ga0466967_0166586
1135 Ga0466967_0414280
1136 Ga0466967_0603820
1137 Ga0466967_1689759
1138 Ga0495608_0137503
1139 Ga0495618_0080977
1140 Ga0495652_0278573
1141 Ga0495645_0336953
1142 Ga0495599_0145663
1143 Ga0495623_0153015
1144 Ga0495674_0624956
1145 Ga0495602_0495988
1146 Ga0496100_0026250
1147 Ga0496100_0219174
1148 Ga0496100_0393431
1149 Ga0496101_0019668
1150 Ga0496101_0083859
1151 Ga0496101_0110901
1152 Ga0496101_0368952
1153 Ga0496101_0732572
1154 Ga0496102_0242830
1155 Ga0496103_0434592
1156 Ga0496104_0283355
1157 Ga0496106_0002420
1158 Ga0496106_0047147
1159 Ga0496106_0832104
1160 Ga0496107_0002628
1161 Ga0496107_0012732
1162 Ga0496108_0017914
1163 Ga0496108_0048034
1164 Ga0496109_0011703
1165 Ga0496109_0021054
1166 Ga0496109_0590012
1167 Ga0496109_1322289
1168 Ga0496110_0008269
1169 Ga0496110_0019537
1170 Ga0496111_0001851
1171 Ga0496111_0350161
1172 Ga0496112_0020106
1173 Ga0496112_0147907
1174 Ga0496112_0177807
1175 Ga0496113_0005391
1176 Ga0496113_0011133
1177 Ga0496114_0000001
1178 Ga0496114_0109603
1179 Ga0496115_0000277
1180 Ga0496115_0000893
1181 Ga0496115_0162578
1182 Ga0496115_0699256
1183 Ga0496115_1015434
1184 Ga0501299_023684
1185 Ga0501032_0022474
1186 Ga0501033_0000648
1187 Ga0501033_0187145
1188 Ga0501033_0215414
1189 Ga0501034_0010499
1190 Ga0501034_0024726
1191 Ga0501034_0027777
1192 Ga0501036_0290313
1193 Ga0501036_1058375
1194 Ga0501037_0035303
1195 Ga0501037_0055482
1196 Ga0501038_0009401
1197 Ga0501038_0052805
1198 Ga0501038_0070725
1199 Ga0501039_0017676
1200 Ga0501039_0182484
1201 Ga0501040_0013411
1202 Ga0501041_0154696
1203 Ga0501042_0107895
1204 Ga0501042_0384195
1205 Ga0501043_0013291
1206 Ga0501043_0015966
1207 Ga0501043_0036726
1208 Ga0501043_0128802
1209 Ga0501046_0015614
1210 Ga0501046_0017282
1211 Ga0501046_0071270
1212 Ga0501047_0131318
1213 Ga0501047_0208098
1214 Ga0501048_0104065
1215 Ga0501067_0063710
1216 Ga0501068_0050769
1217 Ga0501068_0429217
1218 Ga0501068_0596006
1219 Ga0501069_0042848
1220 Ga0501070_0264482
1221 Ga0501070_0588883
1222 Ga0501071_0334260
1223 Ga0501071_1001005
1224 Ga0501072_0546055
1225 Ga0501073_0013235
1226 Ga0501073_0098148
1227 Ga0501073_0634747
1228 Ga0501074_0009236
1229 Ga0501076_0178236
1230 Ga0501079_0037327
1231 Ga0501079_1032681
1232 Ga0501080_0461952
1233 Ga0501080_0560046
1234 Ga0501080_0905726
1235 Ga0501081_0115943
1236 Ga0501083_0053677
1237 Ga0501035_0013435
1238 Ga0501035_0070944
1239 Ga0501035_0101727
1240 Ga0501035_0132867
1241 Ga0501044_0014392
1242 Ga0501044_0028425
1243 Ga0501044_0080244
1244 Ga0501044_0156334
1245 Ga0501044_0220439
1246 Ga0501044_0314150
1247 Ga0501044_0697362
1248 Ga0501045_0052777
1249 nmdc:mga0qj67_567810_c1
1250 nmdc:mga0n895_159614_c1
1251 nmdc:mga0n895_296465_c1
1252 Ga0500559_0034723
1253 Ga0500559_0039937
1254 Ga0500568_0000336
1255 Ga0501082_0000969
1256 Ga0501082_0009960

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.5568 1 177
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.5289 1 177
6kpc-assembly1.cif.gz_A crystal structure of an agonist bound gpcr 0.4032 2 170
8id3-assembly1.cif.gz_R cryo-em structure of the 9-hydroxystearic acid bound gpr120-gi complex 0.3908 4 160
6hd8-assembly1.cif.gz_B crystal structure of the potassium channel mttmem175 in complex with a nanobody-mbp fusion protein 0.3892 7 186
ID Description Score Start End Superfamily
af_Q6ZNB7_250_445_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6019 40 157 1.20.1070.10
af_O53173_17_119_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5897 47 166 1.20.1280.290
3ay5A02 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.5726 1 168 1.20.1410.10
af_O53173_17_119_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5637 47 166 1.20.1280.290
af_A3KNI7_157_343_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.5584 1 168 1.20.1410.10
ID Description Score Start End GO Terms
AF-W0RP19-F1-model_v4 Uncharacterized protein 0.9905 1 185 GO:0016020
AF-A0A2W5YQI8-F1-model_v4 Histidine kinase N-terminal 7TM region domain-containing protein 0.9903 1 187 GO:0016020
AF-A0A838V690-F1-model_v4 Tellurium resistance protein TerC 0.9897 1 185 GO:0016020
AF-A0A2V6HVK3-F1-model_v4 Uncharacterized protein 0.9884 1 187 GO:0016020
AF-A0A7W1KR99-F1-model_v4 Uncharacterized protein 0.986 1 187 GO:0016020

Map