F470563

General Info

Members Datasets Scaffolds Average Seq Length
627 237 626 336

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10023338|Ga0157379_100233385
Length 350
Sequence VTVAVTDHHRDNEEIGVATRVGVNGFGRIGRNFWRALAASEADLEIVAVNDLTDSKTLAHLTKYDSTHGTLAEAVSVTDDGLVVGEKTVKVLAERDPAALPWGELGVDIVIESTGRFTSKDDASKHIAAGAKKVIISAPAKGEDLTVVMGVNDGVYDPASHHVLSNASCTTNCVAPLAKVLDESFGIERGFMTTIHAYTNDQVILDFPHKDLRRARSAAQNIIPTTTGAAKATSLVLPQLKGKLDGIAMRVPVPDGSVTDLVVTLSRSASIADVNAAYQAASDGALKGYLVYTADPIVSSDIVGTAASCTFDSSLTMAAGDQVKVVGWYDNEWGYSNRLVDLTALVAAHL

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
153 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
154 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
171 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 2.23
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 2.71
Rhizosphere 95.53
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000874 3300000546 Bacteria 4930
2 JGI24736J21556_1007813 3300001904 Bacteria 1791
3 Ga0058861_11355183 3300004800 Bacteria 1841
4 Ga0058862_12028844 3300004803 Bacteria 2055
5 Ga0058862_12549041 3300004803 Bacteria 1430
6 Ga0058862_12885119 3300004803 Bacteria 1185
7 Ga0070658_10018462 3300005327 Bacteria 5584
8 Ga0070658_10019851 3300005327 Bacteria 5383
9 Ga0070658_10030799 3300005327 Bacteria 4309
10 Ga0070676_10060127 3300005328 Bacteria 2255
11 Ga0070683_100005230 3300005329 Bacteria 10800
12 Ga0070683_100007155 3300005329 Bacteria 9409
13 Ga0070683_100048839 3300005329 Bacteria 3912
14 Ga0070670_100010194 3300005331 Bacteria 8019
15 Ga0068869_100023769 3300005334 Bacteria 4239
16 Ga0070666_10086452 3300005335 Bacteria 2148
17 Ga0070680_100003825 3300005336 Bacteria 11258
18 Ga0070680_100006107 3300005336 Bacteria 9128
19 Ga0070680_100021520 3300005336 Bacteria 5127
20 Ga0070682_100032136 3300005337 Bacteria 3180
21 Ga0068868_100010500 3300005338 Bacteria 6709
22 Ga0068868_100019851 3300005338 Bacteria 5041
23 Ga0068868_100045210 3300005338 Bacteria 3445
24 Ga0068868_100111762 3300005338 Bacteria 2221
25 Ga0068868_100255573 3300005338 Bacteria 1476
26 Ga0070660_100011919 3300005339 Bacteria 6201
27 Ga0070660_100031117 3300005339 Bacteria 4006
28 Ga0070661_100005374 3300005344 Bacteria 8830
29 Ga0070675_100016747 3300005354 Bacteria 5820
30 Ga0070671_100355918 3300005355 Bacteria 1250
31 Ga0070673_100029304 3300005364 Bacteria 4104
32 Ga0070667_100059000 3300005367 Bacteria 3245
33 Ga0070713_100004985 3300005436 Bacteria 9016
34 Ga0070713_100054873 3300005436 Bacteria 3308
35 Ga0070713_100111354 3300005436 Bacteria 2387
36 Ga0070713_100371004 3300005436 Bacteria 1332
37 Ga0070711_100116018 3300005439 Bacteria 1973
38 Ga0070711_100293801 3300005439 Bacteria 1290
39 Ga0070708_100049759 3300005445 Bacteria 3708
40 Ga0070708_100120635 3300005445 Bacteria 2419
41 Ga0070708_100135715 3300005445 Bacteria 2279
42 Ga0070663_100175396 3300005455 Bacteria 1659
43 Ga0070678_100022717 3300005456 Bacteria 4163
44 Ga0070678_100047254 3300005456 Bacteria 3092
45 Ga0070662_100074876 3300005457 Bacteria 2506
46 Ga0070662_100077535 3300005457 Bacteria 2466
47 Ga0070681_10000333 3300005458 Bacteria 38332
48 Ga0070681_10000441 3300005458 Bacteria 33817
49 Ga0070681_10022911 3300005458 Bacteria 6276
50 Ga0070681_10026270 3300005458 Bacteria 5853
51 Ga0070681_10032852 3300005458 Bacteria 5209
52 Ga0070681_10080877 3300005458 Bacteria 3205
53 Ga0070681_10136350 3300005458 Bacteria 2385
54 Ga0070681_10289800 3300005458 Bacteria 1547
55 Ga0068867_100236287 3300005459 Bacteria 1480
56 Ga0070706_100000439 3300005467 Bacteria 50092
57 Ga0070706_100011468 3300005467 Bacteria 8237
58 Ga0070698_100085200 3300005471 Bacteria 3147
59 Ga0070698_100114170 3300005471 Bacteria 2666
60 Ga0070699_100005695 3300005518 Bacteria 10914
61 Ga0070679_100000177 3300005530 Bacteria 51360
62 Ga0070679_100003501 3300005530 Bacteria 14379
63 Ga0070679_100041701 3300005530 Bacteria 4568
64 Ga0070679_100053722 3300005530 Bacteria 4010
65 Ga0070679_100130959 3300005530 Bacteria 2490
66 Ga0070679_100146791 3300005530 Bacteria 2336
67 Ga0070679_100279680 3300005530 Bacteria 1622
68 Ga0070684_100000865 3300005535 Bacteria 21425
69 Ga0070684_100000871 3300005535 Bacteria 21306
70 Ga0070684_100009769 3300005535 Bacteria 7575
71 Ga0070684_100027507 3300005535 Bacteria 4801
72 Ga0070684_100058668 3300005535 Bacteria 3364
73 Ga0070684_100143288 3300005535 Bacteria 2162
74 Ga0070697_100176110 3300005536 Bacteria 1812
75 Ga0068853_100004194 3300005539 Bacteria 11116
76 Ga0068853_100023412 3300005539 Bacteria 5169
77 Ga0068853_100106429 3300005539 Bacteria 2486
78 Ga0068853_100107201 3300005539 Bacteria 2477
79 Ga0068853_100156670 3300005539 Bacteria 2052
80 Ga0068853_100165570 3300005539 Bacteria 1997
81 Ga0070672_100054808 3300005543 Bacteria 3122
82 Ga0070665_100030768 3300005548 Bacteria 5402
83 Ga0068855_100004419 3300005563 Bacteria 17180
84 Ga0068855_100006098 3300005563 Bacteria 14698
85 Ga0068855_100023898 3300005563 Bacteria 7319
86 Ga0068855_100031654 3300005563 Bacteria 6316
87 Ga0068855_100068014 3300005563 Bacteria 4148
88 Ga0068855_100105905 3300005563 Bacteria 3233
89 Ga0068855_100108298 3300005563 Bacteria 3192
90 Ga0068855_100208293 3300005563 Bacteria 2199
91 Ga0068857_100000384 3300005577 Bacteria 31047
92 Ga0068857_100022724 3300005577 Bacteria 5517
93 Ga0068857_100071170 3300005577 Bacteria 3099
94 Ga0068857_100113075 3300005577 Bacteria 2441
95 Ga0068857_100158587 3300005577 Bacteria 2052
96 Ga0068854_100054058 3300005578 Bacteria 2886
97 Ga0068854_100112762 3300005578 Bacteria 2053
98 Ga0068856_100001120 3300005614 Bacteria 28321
99 Ga0068856_100003837 3300005614 Bacteria 15081
100 Ga0068856_100004548 3300005614 Bacteria 13787
101 Ga0068856_100006800 3300005614 Bacteria 11195
102 Ga0068856_100014830 3300005614 Bacteria 7522
103 Ga0068856_100019356 3300005614 Bacteria 6609
104 Ga0068856_100118515 3300005614 Bacteria 2648
105 Ga0068852_100000373 3300005616 Bacteria 30253
106 Ga0068852_100011166 3300005616 Bacteria 6746
107 Ga0068852_100056279 3300005616 Bacteria 3398
108 Ga0068859_100007151 3300005617 Bacteria 11329
109 Ga0068859_100077156 3300005617 Bacteria 3373
110 Ga0068864_100074702 3300005618 Bacteria 2958
111 Ga0068851_10014631 3300005834 Bacteria 3726
112 Ga0068863_100130664 3300005841 Bacteria 2398
113 Ga0068858_100012332 3300005842 Bacteria 8058
114 Ga0068858_100025639 3300005842 Bacteria 5485
115 Ga0068858_100026941 3300005842 Bacteria 5339
116 Ga0068860_100183648 3300005843 Bacteria 2022
117 Ga0068860_100217267 3300005843 Bacteria 1856
118 Ga0068862_100093080 3300005844 Bacteria 2628
119 Ga0081540_1000004 3300005983 Bacteria 231552
120 Ga0081540_1001931 3300005983 Bacteria 17361
121 Ga0070717_10016838 3300006028 Bacteria 5674
122 Ga0070717_10182341 3300006028 Bacteria 1831
123 Ga0070716_100000557 3300006173 Bacteria 15604
124 Ga0070712_100054719 3300006175 Bacteria 2791
125 Ga0097621_100021772 3300006237 Bacteria 4966
126 Ga0097621_100039056 3300006237 Bacteria 3811
127 Ga0097621_100044365 3300006237 Bacteria 3587
128 Ga0097621_100177506 3300006237 Bacteria 1839
129 Ga0068871_100002427 3300006358 Bacteria 12730
130 Ga0068871_100014860 3300006358 Bacteria 5816
131 Ga0068871_100062701 3300006358 Bacteria 3039
132 Ga0068871_100244753 3300006358 Bacteria 1560
133 Ga0075433_10047976 3300006852 Bacteria 3714
134 Ga0075434_100012735 3300006871 Bacteria 7982
135 Ga0068865_100028164 3300006881 Bacteria 3718
136 Ga0075436_100000709 3300006914 Bacteria 22091
137 Ga0097620_100007151 3300006931 Bacteria 11329
138 Ga0097620_100077156 3300006931 Bacteria 3373
139 Ga0075435_100000841 3300007076 Bacteria 19159
140 Ga0105240_10000166 3300009093 Bacteria 134735
141 Ga0105240_10001971 3300009093 Bacteria 33930
142 Ga0105240_10004239 3300009093 Bacteria 21927
143 Ga0105240_10004420 3300009093 Bacteria 21434
144 Ga0105240_10080641 3300009093 Bacteria 4001
145 Ga0105240_10095574 3300009093 Bacteria 3623
146 Ga0105240_10100162 3300009093 Unclassified 3526
147 Ga0105240_10106427 3300009093 Bacteria 3402
148 Ga0105240_10318395 3300009093 Bacteria 1774
149 Ga0105240_10323592 3300009093 Bacteria 1757
150 Ga0105240_10456542 3300009093 Bacteria 1428
151 Ga0105245_10000671 3300009098 Bacteria 30977
152 Ga0105245_10063311 3300009098 Bacteria 3339
153 Ga0105245_10109275 3300009098 Bacteria 2569
154 Ga0105245_10174506 3300009098 Bacteria 2049
155 Ga0105245_10276035 3300009098 Bacteria 1641
156 Ga0105247_10028676 3300009101 Bacteria 3368
157 Ga0105243_10200380 3300009148 Bacteria 1750
158 Ga0105241_10000553 3300009174 Bacteria 28296
159 Ga0105241_10001188 3300009174 Bacteria 19894
160 Ga0105241_10001486 3300009174 Bacteria 17962
161 Ga0105241_10007979 3300009174 Bacteria 7786
162 Ga0105241_10023783 3300009174 Bacteria 4547
163 Ga0105241_10038916 3300009174 Bacteria 3586
164 Ga0105241_10095948 3300009174 Bacteria 2348
165 Ga0105242_10013404 3300009176 Bacteria 6334
166 Ga0105242_10046891 3300009176 Bacteria 3507
167 Ga0105242_10260556 3300009176 Bacteria 1566
168 Ga0105242_10268812 3300009176 Bacteria 1543
169 Ga0105242_10437609 3300009176 Bacteria 1229
170 Ga0105248_10000002 3300009177 Bacteria 1054120
171 Ga0105248_10007060 3300009177 Bacteria 12302
172 Ga0105248_10010116 3300009177 Bacteria 10389
173 Ga0105248_10057226 3300009177 Bacteria 4376
174 Ga0105248_10146834 3300009177 Bacteria 2661
175 Ga0105248_10169488 3300009177 Bacteria 2461
176 Ga0105248_10531180 3300009177 Bacteria 1327
177 Ga0105237_10003543 3300009545 Bacteria 18500
178 Ga0105237_10004054 3300009545 Bacteria 17091
179 Ga0105237_10072985 3300009545 Bacteria 3424
180 Ga0105237_10108485 3300009545 Bacteria 2767
181 Ga0105238_10001562 3300009551 Bacteria 22962
182 Ga0105238_10003866 3300009551 Bacteria 14874
183 Ga0105238_10012489 3300009551 Bacteria 8567
184 Ga0105238_10020933 3300009551 Bacteria 6663
185 Ga0105238_10045150 3300009551 Bacteria 4451
186 Ga0105238_10092362 3300009551 Bacteria 3014
187 Ga0105238_10306811 3300009551 Bacteria 1572
188 Ga0105249_10570363 3300009553 Bacteria 1184
189 Ga0105239_10012268 3300010375 Bacteria 9546
190 Ga0105239_10021981 3300010375 Bacteria 7032
191 Ga0105239_10023261 3300010375 Bacteria 6826
192 Ga0105239_10024256 3300010375 Bacteria 6680
193 Ga0105239_10044630 3300010375 Bacteria 4858
194 Ga0105246_10017863 3300011119 Bacteria 4513
195 Ga0105246_10301666 3300011119 Bacteria 1293
196 Ga0157373_10023679 3300013100 Bacteria 4451
197 Ga0157373_10123881 3300013100 Bacteria 1817
198 Ga0157371_10014264 3300013102 Bacteria 6007
199 Ga0157370_10000139 3300013104 Bacteria 87840
200 Ga0157370_10001437 3300013104 Bacteria 29538
201 Ga0157370_10018086 3300013104 Bacteria 7095
202 Ga0157370_10064648 3300013104 Bacteria 3463
203 Ga0157370_10098232 3300013104 Bacteria 2746
204 Ga0157370_10112968 3300013104 Bacteria 2539
205 Ga0157370_10181762 3300013104 Bacteria 1954
206 Ga0157370_10287851 3300013104 Bacteria 1518
207 Ga0157369_10002361 3300013105 Bacteria 22695
208 Ga0157369_10003593 3300013105 Bacteria 18420
209 Ga0157369_10019577 3300013105 Bacteria 7574
210 Ga0157369_10032703 3300013105 Bacteria 5716
211 Ga0157369_10079958 3300013105 Bacteria 3501
212 Ga0157369_10141617 3300013105 Bacteria 2544
213 Ga0157369_10408033 3300013105 Bacteria 1409
214 Ga0157374_10056171 3300013296 Bacteria 3675
215 Ga0157374_10064212 3300013296 Bacteria 3445
216 Ga0157374_10064266 3300013296 Bacteria 3443
217 Ga0157374_10085446 3300013296 Bacteria 3000
218 Ga0157374_10089937 3300013296 Bacteria 2926
219 Ga0157374_10142219 3300013296 Bacteria 2329
220 Ga0157374_10164219 3300013296 Bacteria 2164
221 Ga0157374_10212448 3300013296 Bacteria 1897
222 Ga0157374_10237586 3300013296 Bacteria 1791
223 Ga0157374_10274679 3300013296 Bacteria 1662
224 Ga0157378_10091854 3300013297 Bacteria 2761
225 Ga0157378_10151875 3300013297 Bacteria 2159
226 Ga0163162_10005588 3300013306 Bacteria 12163
227 Ga0163162_10191590 3300013306 Bacteria 2172
228 Ga0157372_10000101 3300013307 Bacteria 89344
229 Ga0157372_10001307 3300013307 Bacteria 26947
230 Ga0157372_10001909 3300013307 Bacteria 22623
231 Ga0157372_10004217 3300013307 Bacteria 15380
232 Ga0157372_10020797 3300013307 Bacteria 7086
233 Ga0157372_10022889 3300013307 Bacteria 6767
234 Ga0157372_10028847 3300013307 Bacteria 6057
235 Ga0157372_10039462 3300013307 Bacteria 5211
236 Ga0157372_10070336 3300013307 Bacteria 3937
237 Ga0157372_10081422 3300013307 Bacteria 3664
238 Ga0157372_10132993 3300013307 Bacteria 2863
239 Ga0157372_10147199 3300013307 Bacteria 2716
240 Ga0157372_10345391 3300013307 Bacteria 1734
241 Ga0157375_10091937 3300013308 Bacteria 3096
242 Ga0157375_10179812 3300013308 Bacteria 2266
243 Ga0163163_10004188 3300014325 Bacteria 12289
244 Ga0163163_10009070 3300014325 Bacteria 8865
245 Ga0163163_10036859 3300014325 Bacteria 4753
246 Ga0163163_10042477 3300014325 Bacteria 4453
247 Ga0163163_10070818 3300014325 Bacteria 3473
248 Ga0163163_10136843 3300014325 Bacteria 2491
249 Ga0157379_10023338 3300014968 Bacteria 5489
250 Ga0157379_10094945 3300014968 Bacteria 2676
251 Ga0157376_10075167 3300014969 Bacteria 2882
252 Ga0206356_11130308 3300020070 Bacteria 1128
253 Ga0206352_10672922 3300020078 Bacteria 1144
254 Ga0213872_10000931 3300021361 Bacteria 20615
255 Ga0213875_10056779 3300021388 Bacteria 1834
256 Ga0213875_10062590 3300021388 Bacteria 1740
257 Ga0213871_10002332 3300021441 Bacteria 3475
258 Ga0224712_10097399 3300022467 Bacteria 1242
259 Ga0224572_1006578 3300024225 Bacteria 2105
260 Ga0207656_10005688 3300025321 Bacteria 4429
261 Ga0207710_10000012 3300025900 Bacteria 409603
262 Ga0207680_10089838 3300025903 Bacteria 1951
263 Ga0207647_10006183 3300025904 Bacteria 8725
264 Ga0207699_10110603 3300025906 Bacteria 1760
265 Ga0207699_10117561 3300025906 Bacteria 1714
266 Ga0207699_10161700 3300025906 Bacteria 1491
267 Ga0207645_10043951 3300025907 Bacteria 2859
268 Ga0207705_10286653 3300025909 Bacteria 1261
269 Ga0207684_10001462 3300025910 Bacteria 25453
270 Ga0207684_10057684 3300025910 Bacteria 3295
271 Ga0207684_10070040 3300025910 Bacteria 2980
272 Ga0207654_10000011 3300025911 Bacteria 245470
273 Ga0207654_10000825 3300025911 Bacteria 17065
274 Ga0207654_10004247 3300025911 Bacteria 7226
275 Ga0207654_10012675 3300025911 Bacteria 4324
276 Ga0207654_10021734 3300025911 Bacteria 3415
277 Ga0207654_10035530 3300025911 Bacteria 2777
278 Ga0207654_10039766 3300025911 Bacteria 2647
279 Ga0207654_10069044 3300025911 Bacteria 2093
280 Ga0207707_10003777 3300025912 Bacteria 13419
281 Ga0207707_10005348 3300025912 Bacteria 11218
282 Ga0207707_10076970 3300025912 Bacteria 2911
283 Ga0207707_10082402 3300025912 Bacteria 2809
284 Ga0207707_10183511 3300025912 Bacteria 1826
285 Ga0207707_10454156 3300025912 Bacteria 1096
286 Ga0207695_10000028 3300025913 Bacteria 551835
287 Ga0207695_10000258 3300025913 Bacteria 134197
288 Ga0207695_10000298 3300025913 Bacteria 123027
289 Ga0207695_10001026 3300025913 Bacteria 49120
290 Ga0207695_10013148 3300025913 Bacteria 9882
291 Ga0207695_10016300 3300025913 Bacteria 8701
292 Ga0207695_10023530 3300025913 Bacteria 6956
293 Ga0207695_10030449 3300025913 Bacteria 5940
294 Ga0207695_10053452 3300025913 Bacteria 4225
295 Ga0207695_10424599 3300025913 Bacteria 1213
296 Ga0207695_10462628 3300025913 Bacteria 1151
297 Ga0207671_10000022 3300025914 Bacteria 277803
298 Ga0207671_10010667 3300025914 Bacteria 7559
299 Ga0207671_10026036 3300025914 Bacteria 4388
300 Ga0207671_10033405 3300025914 Bacteria 3828
301 Ga0207671_10053407 3300025914 Bacteria 2994
302 Ga0207671_10296615 3300025914 Bacteria 1277
303 Ga0207693_10090267 3300025915 Bacteria 2402
304 Ga0207663_10177921 3300025916 Bacteria 1516
305 Ga0207660_10001695 3300025917 Bacteria 14783
306 Ga0207660_10059127 3300025917 Bacteria 2751
307 Ga0207657_10010363 3300025919 Bacteria 9302
308 Ga0207657_10022130 3300025919 Bacteria 5964
309 Ga0207657_10148261 3300025919 Bacteria 1912
310 Ga0207649_10001509 3300025920 Bacteria 13659
311 Ga0207649_10055012 3300025920 Bacteria 2479
312 Ga0207649_10078559 3300025920 Bacteria 2130
313 Ga0207652_10004617 3300025921 Bacteria 11161
314 Ga0207652_10010084 3300025921 Bacteria 7611
315 Ga0207652_10032450 3300025921 Bacteria 4390
316 Ga0207652_10049820 3300025921 Bacteria 3587
317 Ga0207652_10193167 3300025921 Bacteria 1831
318 Ga0207652_10194944 3300025921 Bacteria 1822
319 Ga0207646_10011286 3300025922 Bacteria 8676
320 Ga0207694_10000009 3300025924 Bacteria 460687
321 Ga0207694_10000205 3300025924 Bacteria 58152
322 Ga0207694_10002043 3300025924 Bacteria 16710
323 Ga0207694_10019545 3300025924 Bacteria 5121
324 Ga0207694_10038599 3300025924 Bacteria 3672
325 Ga0207694_10074174 3300025924 Bacteria 2663
326 Ga0207694_10087370 3300025924 Bacteria 2456
327 Ga0207694_10095561 3300025924 Bacteria 2349
328 Ga0207687_10001687 3300025927 Bacteria 15216
329 Ga0207687_10064723 3300025927 Bacteria 2594
330 Ga0207687_10067402 3300025927 Bacteria 2546
331 Ga0207687_10251812 3300025927 Bacteria 1404
332 Ga0207700_10031146 3300025928 Bacteria 3786
333 Ga0207700_10144071 3300025928 Bacteria 1961
334 Ga0207700_10195364 3300025928 Bacteria 1702
335 Ga0207700_10199625 3300025928 Bacteria 1685
336 Ga0207664_10053763 3300025929 Bacteria 3189
337 Ga0207644_10017651 3300025931 Bacteria 4824
338 Ga0207706_10001914 3300025933 Bacteria 20443
339 Ga0207706_10060991 3300025933 Bacteria 3321
340 Ga0207686_10002578 3300025934 Bacteria 9853
341 Ga0207686_10012078 3300025934 Bacteria 4744
342 Ga0207686_10047084 3300025934 Bacteria 2664
343 Ga0207686_10076820 3300025934 Bacteria 2167
344 Ga0207704_10037119 3300025938 Bacteria 2812
345 Ga0207665_10001725 3300025939 Bacteria 14702
346 Ga0207691_10029114 3300025940 Bacteria 5167
347 Ga0207711_10000008 3300025941 Bacteria 597686
348 Ga0207711_10007606 3300025941 Bacteria 9063
349 Ga0207711_10029020 3300025941 Bacteria 4662
350 Ga0207711_10034371 3300025941 Bacteria 4294
351 Ga0207711_10035441 3300025941 Bacteria 4229
352 Ga0207711_10100490 3300025941 Bacteria 2558
353 Ga0207711_10156323 3300025941 Bacteria 2061
354 Ga0207711_10275181 3300025941 Bacteria 1550
355 Ga0207711_10296208 3300025941 Bacteria 1492
356 Ga0207689_10005153 3300025942 Bacteria 11742
357 Ga0207689_10030993 3300025942 Bacteria 4455
358 Ga0207661_10001417 3300025944 Bacteria 16178
359 Ga0207661_10003564 3300025944 Bacteria 10822
360 Ga0207661_10009160 3300025944 Bacteria 7098
361 Ga0207661_10013492 3300025944 Bacteria 5969
362 Ga0207661_10039247 3300025944 Bacteria 3715
363 Ga0207661_10040972 3300025944 Bacteria 3644
364 Ga0207661_10190929 3300025944 Bacteria 1796
365 Ga0207661_10246884 3300025944 Bacteria 1585
366 Ga0207679_10350759 3300025945 Bacteria 1286
367 Ga0207667_10000332 3300025949 Bacteria 64962
368 Ga0207667_10000572 3300025949 Bacteria 48053
369 Ga0207667_10003823 3300025949 Bacteria 18511
370 Ga0207667_10006307 3300025949 Bacteria 14382
371 Ga0207667_10014568 3300025949 Bacteria 8956
372 Ga0207667_10046082 3300025949 Bacteria 4616
373 Ga0207667_10062692 3300025949 Bacteria 3886
374 Ga0207667_10066366 3300025949 Bacteria 3761
375 Ga0207667_10123357 3300025949 Bacteria 2669
376 Ga0207667_10127735 3300025949 Bacteria 2619
377 Ga0207667_10488310 3300025949 Bacteria 1250
378 Ga0207651_10050893 3300025960 Bacteria 2816
379 Ga0207658_10023692 3300025986 Bacteria 4287
380 Ga0207658_10405229 3300025986 Bacteria 1199
381 Ga0207677_10000870 3300026023 Bacteria 17183
382 Ga0207677_10017267 3300026023 Bacteria 4298
383 Ga0207677_10030754 3300026023 Bacteria 3431
384 Ga0207703_10000029 3300026035 Bacteria 199952
385 Ga0207703_10015012 3300026035 Bacteria 6045
386 Ga0207703_10015217 3300026035 Bacteria 6002
387 Ga0207703_10025043 3300026035 Bacteria 4693
388 Ga0207703_10445377 3300026035 Bacteria 1209
389 Ga0207639_10000165 3300026041 Bacteria 51114
390 Ga0207639_10026735 3300026041 Bacteria 4194
391 Ga0207639_10083779 3300026041 Bacteria 2531
392 Ga0207639_10096228 3300026041 Bacteria 2381
393 Ga0207702_10001655 3300026078 Bacteria 22007
394 Ga0207702_10002342 3300026078 Bacteria 18095
395 Ga0207702_10006549 3300026078 Bacteria 10018
396 Ga0207702_10102900 3300026078 Bacteria 2525
397 Ga0207702_10110804 3300026078 Bacteria 2440
398 Ga0207702_10124551 3300026078 Bacteria 2311
399 Ga0207641_10023209 3300026088 Bacteria 5112
400 Ga0207641_10210846 3300026088 Bacteria 1796
401 Ga0207676_10015776 3300026095 Bacteria 5461
402 Ga0207676_10018973 3300026095 Bacteria 5010
403 Ga0207676_10070284 3300026095 Bacteria 2807
404 Ga0207676_10140619 3300026095 Bacteria 2066
405 Ga0207674_10000110 3300026116 Bacteria 94822
406 Ga0207674_10018247 3300026116 Bacteria 7630
407 Ga0207674_10024297 3300026116 Bacteria 6478
408 Ga0207674_10031303 3300026116 Bacteria 5590
409 Ga0207674_10280326 3300026116 Bacteria 1615
410 Ga0207683_10269099 3300026121 Bacteria 1556
411 Ga0207698_10000155 3300026142 Bacteria 44171
412 Ga0207698_10002636 3300026142 Bacteria 10655
413 Ga0207698_10004105 3300026142 Bacteria 8842
414 Ga0207698_10034050 3300026142 Bacteria 3709
415 Ga0207698_10036224 3300026142 Bacteria 3619
416 Ga0207698_10352194 3300026142 Bacteria 1391
417 Ga0268266_10033439 3300028379 Bacteria 4371
418 Ga0265318_10029902 3300028577 Bacteria 2121
419 Ga0265318_10049865 3300028577 Bacteria 1574
420 Ga0265338_10002440 3300028800 Bacteria 27933
421 Ga0265338_10013232 3300028800 Bacteria 9337
422 Ga0265338_10030651 3300028800 Bacteria 5292
423 Ga0265338_10079707 3300028800 Bacteria 2754
424 Ga0265330_10000561 3300031235 Bacteria 24185
425 Ga0265330_10000660 3300031235 Bacteria 22137
426 Ga0265330_10012487 3300031235 Bacteria 3973
427 Ga0265330_10014474 3300031235 Bacteria 3661
428 Ga0265330_10043585 3300031235 Bacteria 1984
429 Ga0265332_10019068 3300031238 Bacteria 3028
430 Ga0265332_10100934 3300031238 Bacteria 1217
431 Ga0265328_10002955 3300031239 Bacteria 7589
432 Ga0265328_10007483 3300031239 Bacteria 4549
433 Ga0265320_10006244 3300031240 Bacteria 7529
434 Ga0265325_10000082 3300031241 Bacteria 66088
435 Ga0265325_10007273 3300031241 Bacteria 6647
436 Ga0265325_10013915 3300031241 Bacteria 4565
437 Ga0265325_10014494 3300031241 Bacteria 4453
438 Ga0265325_10025041 3300031241 Bacteria 3241
439 Ga0265340_10003790 3300031247 Bacteria 8519
440 Ga0265340_10007068 3300031247 Bacteria 6120
441 Ga0265340_10012017 3300031247 Bacteria 4578
442 Ga0265340_10027525 3300031247 Bacteria 2866
443 Ga0265340_10041841 3300031247 Bacteria 2251
444 Ga0265340_10054005 3300031247 Bacteria 1938
445 Ga0265339_10000081 3300031249 Bacteria 82039
446 Ga0265339_10000866 3300031249 Bacteria 23260
447 Ga0265339_10002180 3300031249 Bacteria 14201
448 Ga0265339_10036105 3300031249 Bacteria 2767
449 Ga0265339_10049350 3300031249 Bacteria 2305
450 Ga0265339_10068921 3300031249 Bacteria 1889
451 Ga0265331_10002265 3300031250 Bacteria 13160
452 Ga0265316_10001950 3300031344 Bacteria 21676
453 Ga0265316_10010240 3300031344 Bacteria 8558
454 Ga0265316_10010460 3300031344 Bacteria 8450
455 Ga0265316_10011020 3300031344 Bacteria 8199
456 Ga0265316_10024286 3300031344 Bacteria 5085
457 Ga0265316_10028441 3300031344 Bacteria 4612
458 Ga0265316_10028701 3300031344 Bacteria 4587
459 Ga0265316_10031218 3300031344 Bacteria 4359
460 Ga0265316_10057957 3300031344 Bacteria 3019
461 Ga0265316_10085954 3300031344 Bacteria 2405
462 Ga0265316_10139327 3300031344 Bacteria 1823
463 Ga0265316_10171220 3300031344 Bacteria 1620
464 Ga0265313_10000409 3300031595 Bacteria 46080
465 Ga0265313_10003572 3300031595 Bacteria 12505
466 Ga0265313_10006669 3300031595 Bacteria 8094
467 Ga0265313_10010227 3300031595 Bacteria 5970
468 Ga0265313_10029588 3300031595 Bacteria 2832
469 Ga0265313_10045977 3300031595 Bacteria 2122
470 Ga0265314_10000090 3300031711 Bacteria 137914
471 Ga0265314_10002269 3300031711 Bacteria 19910
472 Ga0265314_10002275 3300031711 Bacteria 19888
473 Ga0265314_10002480 3300031711 Bacteria 18851
474 Ga0265314_10013248 3300031711 Bacteria 6674
475 Ga0265314_10020518 3300031711 Bacteria 5100
476 Ga0265314_10029302 3300031711 Bacteria 4093
477 Ga0265314_10119029 3300031711 Bacteria 1666
478 Ga0265342_10000636 3300031712 Bacteria 36784
479 Ga0265342_10007724 3300031712 Bacteria 7829
480 Ga0265342_10016109 3300031712 Bacteria 4892
481 Ga0265342_10055606 3300031712 Bacteria 2349
482 Ga0265342_10161427 3300031712 Bacteria 1238
483 Ga0316577_10027179 3300031733 Bacteria 3190
484 Ga0316583_10007933 3300032133 Bacteria 3828
485 Ga0316580_10019850 3300032139 Bacteria 2067
486 Ga0373926_0002943 3300035083 Bacteria 5455
487 Ga0373936_0031148 3300035113 Bacteria 2106
488 Ga0373953_0030984 3300035117 Bacteria 2078
489 Ga0373956_0020236 3300035119 Bacteria 2830
490 Ga0373943_0056817 3300035170 Bacteria 1943
491 Ga0373955_0018482 3300035172 Bacteria 3468
492 Ga0373955_0156464 3300035172 Bacteria 1343
493 Ga0373955_0243928 3300035172 Bacteria 1076
494 Ga0373931_0087369 3300035691 Bacteria 1731
495 Ga0373935_0003578 3300035692 Bacteria 9053
496 Ga0373935_0070638 3300035692 Bacteria 2251
497 Ga0373933_0021065 3300035724 Bacteria 3700
498 Ga0373933_0051124 3300035724 Bacteria 2469
499 Ga0373933_0187519 3300035724 Bacteria 1320
500 Ga0373947_0012361 3300035725 Bacteria 4892
501 Ga0373937_0007327 3300036401 Bacteria 9550
502 Ga0373937_0010670 3300036401 Bacteria 8034
503 Ga0373937_0017521 3300036401 Bacteria 6384
504 Ga0373937_0023587 3300036401 Bacteria 5542
505 Ga0373925_0001087 3300037068 Bacteria 24392
506 Ga0373925_0043887 3300037068 Bacteria 3319
507 Ga0373925_0044710 3300037068 Bacteria 3289
508 Ga0373925_0106425 3300037068 Bacteria 2162
509 Ga0373925_0182926 3300037068 Bacteria 1660
510 Ga0395898_0186959 3300037466 Bacteria 1979
511 Ga0436364_1162556 3300037853 Bacteria 3940
512 Ga0436364_1259733 3300037853 Bacteria 2172
513 Ga0395901_0242926 3300038443 Bacteria 1878
514 Ga0395901_0591552 3300038443 Bacteria 1120
515 Ga0400484_25463 3300038725 Bacteria 5726
516 Ga0400483_234207 3300039062 Bacteria 1279
517 Ga0436360_0054547 3300039438 Bacteria 7847
518 Ga0436360_0509439 3300039438 Bacteria 1764
519 Ga0436360_0608291 3300039438 Bacteria 5660
520 Ga0436361_0112257 3300039447 Bacteria 1502
521 Ga0436361_0159775 3300039447 Bacteria 2800
522 Ga0436361_0435458 3300039447 Bacteria 1913
523 Ga0436361_0488380 3300039447 Bacteria 5165
524 Ga0436361_0660005 3300039447 Bacteria 9424
525 Ga0436361_0825843 3300039447 Bacteria 8326
526 Ga0436363_1471637 3300039450 Bacteria 2459
527 Ga0451577_0000215 3300042876 Bacteria 120190
528 Ga0451577_0001235 3300042876 Bacteria 35395
529 Ga0451577_0003653 3300042876 Bacteria 16875
530 Ga0451577_0017645 3300042876 Bacteria 6591
531 Ga0453683_0007263 3300044673 Bacteria 7547
532 Ga0466965_0150377 3300044683 Bacteria 1217
533 Ga0466961_0079783 3300044693 Bacteria 2072
534 Ga0466963_0072702 3300044694 Bacteria 2317
535 Ga0466964_0043783 3300044706 Bacteria 1817
536 Ga0453684_0000545 3300044712 Bacteria 142482
537 Ga0453684_0000991 3300044712 Bacteria 92722
538 Ga0453684_0003557 3300044712 Bacteria 34857
539 Ga0453684_0005096 3300044712 Bacteria 26493
540 Ga0453684_0024795 3300044712 Bacteria 8742
541 Ga0453684_0183329 3300044712 Bacteria 2456
542 Ga0451576_0004180 3300045051 Bacteria 18992
543 Ga0451576_0049657 3300045051 Bacteria 4403
544 Ga0451576_0054488 3300045051 Bacteria 4187
545 Ga0451576_0346794 3300045051 Bacteria 1555
546 Ga0451576_0364790 3300045051 Bacteria 1513
547 Ga0466958_0109404 3300045836 Bacteria 1725
548 Ga0466967_0000669 3300045976 Bacteria 17323
549 Ga0466967_0050807 3300045976 Bacteria 3631
550 Ga0495629_0007214 3300046459 Bacteria 8186
551 Ga0495629_0046149 3300046459 Bacteria 3056
552 Ga0495651_0002873 3300046462 Bacteria 13340
553 Ga0495653_0003989 3300046463 Bacteria 11919
554 Ga0495653_0200029 3300046463 Bacteria 1357
555 Ga0495580_0018790 3300046472 Bacteria 5143
556 Ga0495580_0199670 3300046472 Bacteria 1378
557 Ga0495582_0002035 3300046473 Bacteria 11325
558 Ga0495639_0022695 3300046475 Bacteria 2754
559 Ga0495662_0117446 3300046476 Bacteria 1305
560 Ga0495608_0004504 3300046511 Bacteria 9952
561 Ga0495630_0154501 3300046517 Bacteria 1747
562 Ga0495630_0159824 3300046517 Bacteria 1716
563 Ga0495643_0023230 3300046522 Bacteria 3527
564 Ga0495652_0017158 3300046529 Bacteria 6464
565 Ga0495652_0060324 3300046529 Bacteria 3206
566 Ga0495652_0131681 3300046529 Bacteria 1979
567 Ga0495665_0001598 3300046531 Bacteria 12125
568 Ga0495640_0041648 3300046533 Bacteria 3208
569 Ga0495586_0101991 3300046535 Bacteria 1593
570 Ga0495587_0006688 3300046536 Bacteria 7510
571 Ga0495587_0015170 3300046536 Bacteria 4815
572 Ga0495587_0027192 3300046536 Bacteria 3484
573 Ga0495667_0000240 3300046559 Bacteria 35610
574 Ga0495635_0082677 3300046663 Bacteria 2198
575 Ga0495657_0008892 3300046675 Bacteria 7646
576 Ga0495599_0005127 3300046678 Bacteria 7804
577 Ga0495599_0028805 3300046678 Bacteria 3480
578 Ga0495623_0013360 3300046679 Bacteria 5325
579 Ga0495658_0014405 3300046683 Bacteria 4042
580 Ga0495669_0019362 3300046684 Bacteria 2937
581 Ga0495669_0029759 3300046684 Bacteria 2396
582 Ga0495600_0005120 3300046809 Bacteria 7879
583 Ga0495604_0004640 3300047317 Bacteria 10893
584 Ga0495672_0053265 3300047320 Bacteria 2372
585 Ga0495680_0008199 3300047322 Bacteria 9521
586 Ga0495684_0016243 3300047471 Bacteria 5732
587 Ga0495686_0003658 3300047472 Bacteria 13158
588 Ga0495602_0006144 3300048088 Bacteria 12594
589 Ga0495602_0023153 3300048088 Bacteria 6060
590 Ga0495602_0051194 3300048088 Bacteria 3681
591 Ga0495602_0073519 3300048088 Bacteria 2910
592 Ga0496104_0053794 3300048907 Bacteria 3805
593 Ga0496104_0073373 3300048907 Bacteria 3256
594 Ga0496104_0275966 3300048907 Bacteria 1594
595 Ga0496105_0036142 3300048908 Bacteria 4068
596 Ga0496105_0105132 3300048908 Bacteria 2331
597 Ga0496106_0163236 3300048909 Bacteria 1763
598 Ga0496106_0217803 3300048909 Bacteria 1522
599 Ga0496109_0198879 3300048912 Bacteria 1884
600 Ga0496110_0344228 3300048913 Bacteria 1358
601 Ga0496112_0002909 3300048915 Bacteria 13936
602 Ga0496112_0039317 3300048915 Bacteria 4622
603 Ga0496112_0233291 3300048915 Bacteria 1794
604 Ga0496115_0039432 3300048918 Bacteria 3751
605 Ga0496115_0060290 3300048918 Bacteria 3057
606 Ga0496115_0106162 3300048918 Bacteria 2305
607 Ga0496115_0177147 3300048918 Bacteria 1763
608 Ga0496115_0178262 3300048918 Bacteria 1757
609 Ga0496119_0022618 3300048922 Bacteria 4492
610 Ga0496121_0029114 3300048924 Bacteria 5119
611 Ga0501073_0081488 3300049589 Bacteria 2251
612 nmdc:mga0n895_7816_c1 3300050512 Bacteria 9214
613 nmdc:mga0rr50_18108_c1 3300050513 Bacteria 4724
614 nmdc:mga0rr50_28757_c1 3300050513 Bacteria 3911
615 nmdc:mga08x19_1649_c1 3300050514 Bacteria 13778
616 nmdc:mga0a205_75008_c1 3300050515 Bacteria 3268
617 Ga0495601_0061000 3300053077 Bacteria 2394
618 Ga0495601_0087343 3300053077 Bacteria 2005
619 Ga0500644_0010852 3300053088 Bacteria 2474
620 Ga0587073_0023529 3300059492 Bacteria 1207
621 Ga0587083_0011740 3300059505 Bacteria 1453
622 Ga0587098_004351 3300059604 Bacteria 1332
623 Ga0587122_003227 3300059628 Bacteria 1242
624 Ga0587128_009798 3300059630 Bacteria 1272
625 Ga0587075_008378 3300059644 Bacteria 1321
626 Ga0587111_0015943 3300060346 Bacteria 1381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0344228 Ga0496110_0344228_319_1251 295
2 3300006237 Ga0097621_100044365 Ga0097621_1000443654 296
3 3300038725 Ga0400484_25463 Ga0400484_25463_3207_4103 297
4 3300042876 Ga0451577_0003653 Ga0451577_0003653_15447_16451 304
5 3300042876 Ga0451577_0017645 Ga0451577_0017645_845_1849 304
6 3300044712 Ga0453684_0000991 Ga0453684_0000991_16987_17991 304
7 3300044712 Ga0453684_0024795 Ga0453684_0024795_1230_2234 304
8 3300045051 Ga0451576_0004180 Ga0451576_0004180_9176_10180 304
9 3300045051 Ga0451576_0049657 Ga0451576_0049657_2162_3166 304
10 3300035724 Ga0373933_0051124 Ga0373933_0051124_33_953 305
11 3300044706 Ga0466964_0043783 Ga0466964_0043783_839_1762 305
12 3300025941 Ga0207711_10275181 Ga0207711_102751812 314
13 3300045051 Ga0451576_0364790 Ga0451576_0364790_38_1045 321
14 3300021388 Ga0213875_10062590 Ga0213875_100625902 325
15 3300037853 Ga0436364_1259733 Ga0436364_1259733_548_1555 325
16 3300035117 Ga0373953_0030984 Ga0373953_0030984_290_1300 328
17 3300035172 Ga0373955_0243928 Ga0373955_0243928_17_1027 328
18 3300035724 Ga0373933_0187519 Ga0373933_0187519_70_1080 328
19 3300036401 Ga0373937_0007327 Ga0373937_0007327_5597_6607 328
20 3300037068 Ga0373925_0001087 Ga0373925_0001087_9219_10229 328
21 3300037068 Ga0373925_0106425 Ga0373925_0106425_1059_2069 328
22 3300045051 Ga0451576_0346794 Ga0451576_0346794_433_1440 328
23 3300046462 Ga0495651_0002873 Ga0495651_0002873_5614_6624 328
24 3300046463 Ga0495653_0003989 Ga0495653_0003989_5712_6722 328
25 3300046511 Ga0495608_0004504 Ga0495608_0004504_1207_2217 328
26 3300046529 Ga0495652_0017158 Ga0495652_0017158_1189_2199 328
27 3300046536 Ga0495587_0015170 Ga0495587_0015170_2599_3609 328
28 3300046559 Ga0495667_0000240 Ga0495667_0000240_33382_34392 328
29 3300046675 Ga0495657_0008892 Ga0495657_0008892_2523_3533 328
30 3300046678 Ga0495599_0005127 Ga0495599_0005127_4326_5336 328
31 3300046679 Ga0495623_0013360 Ga0495623_0013360_2650_3660 328
32 3300046809 Ga0495600_0005120 Ga0495600_0005120_5621_6631 328
33 3300047317 Ga0495604_0004640 Ga0495604_0004640_8087_9097 328
34 3300047322 Ga0495680_0008199 Ga0495680_0008199_6553_7563 328
35 3300047471 Ga0495684_0016243 Ga0495684_0016243_4555_5565 328
36 3300048088 Ga0495602_0023153 Ga0495602_0023153_4550_5560 328
37 iso_pu_bacteria 8056060235 8056065249 328
38 3300046533 Ga0495640_0041648 Ga0495640_0041648_1010_2023 329
39 3300046663 Ga0495635_0082677 Ga0495635_0082677_782_1783 329
40 3300044712 Ga0453684_0005096 Ga0453684_0005096_14108_15109 330
41 3300005842 Ga0068858_100025639 Ga0068858_1000256391 332
42 3300009101 Ga0105247_10028676 Ga0105247_100286763 332
43 3300014968 Ga0157379_10023338 Ga0157379_100233385 332
44 3300025900 Ga0207710_10000012 Ga0207710_10000012219 332
45 3300026035 Ga0207703_10000029 Ga0207703_100000291 332
46 3300031733 Ga0316577_10027179 Ga0316577_100271791 332
47 3300032133 Ga0316583_10007933 Ga0316583_100079334 332
48 3300032139 Ga0316580_10019850 Ga0316580_100198501 332
49 3300039062 Ga0400483_234207 Ga0400483_234207_11_1012 332
50 3300042876 Ga0451577_0001235 Ga0451577_0001235_21239_22243 332
51 3300044683 Ga0466965_0150377 Ga0466965_0150377_77_1084 332
52 3300044712 Ga0453684_0003557 Ga0453684_0003557_18440_19444 332
53 3300048909 Ga0496106_0217803 Ga0496106_0217803_378_1430 332
54 3300048922 Ga0496119_0022618 Ga0496119_0022618_1013_2065 332
55 3300048924 Ga0496121_0029114 Ga0496121_0029114_3740_4792 332
56 3300005336 Ga0070680_100003825 Ga0070680_1000038254 333
57 3300005339 Ga0070660_100031117 Ga0070660_1000311172 333
58 3300005458 Ga0070681_10000333 Ga0070681_1000033315 333
59 3300005467 Ga0070706_100000439 Ga0070706_1000004392 333
60 3300005467 Ga0070706_100011468 Ga0070706_1000114683 333
61 3300005471 Ga0070698_100085200 Ga0070698_1000852003 333
62 3300005471 Ga0070698_100114170 Ga0070698_1001141702 333
63 3300005518 Ga0070699_100005695 Ga0070699_1000056954 333
64 3300005530 Ga0070679_100000177 Ga0070679_10000017739 333
65 3300005535 Ga0070684_100000871 Ga0070684_1000008712 333
66 3300005539 Ga0068853_100107201 Ga0068853_1001072012 333
67 3300005577 Ga0068857_100000384 Ga0068857_10000038410 333
68 3300005614 Ga0068856_100001120 Ga0068856_10000112021 333
69 3300005983 Ga0081540_1000004 Ga0081540_1000004148 333
70 3300025910 Ga0207684_10001462 Ga0207684_100014622 333
71 3300025910 Ga0207684_10057684 Ga0207684_100576842 333
72 3300025910 Ga0207684_10070040 Ga0207684_100700403 333
73 3300025913 Ga0207695_10001026 Ga0207695_1000102634 333
74 3300025922 Ga0207646_10011286 Ga0207646_100112865 333
75 3300025949 Ga0207667_10000572 Ga0207667_1000057213 333
76 3300026078 Ga0207702_10001655 Ga0207702_1000165521 333
77 3300026116 Ga0207674_10000110 Ga0207674_1000011030 333
78 3300028800 Ga0265338_10030651 Ga0265338_100306513 333
79 3300035691 Ga0373931_0087369 Ga0373931_0087369_128_1135 333
80 3300046472 Ga0495580_0199670 Ga0495580_0199670_135_1139 333
81 3300000546 LJNas_1000874 LJNas_10008742 334
82 3300001904 JGI24736J21556_1007813 JGI24736J21556_10078132 334
83 3300004800 Ga0058861_11355183 Ga0058861_113551831 334
84 3300004803 Ga0058862_12028844 Ga0058862_120288441 334
85 3300004803 Ga0058862_12549041 Ga0058862_125490411 334
86 3300004803 Ga0058862_12885119 Ga0058862_128851191 334
87 3300005327 Ga0070658_10018462 Ga0070658_100184625 334
88 3300005327 Ga0070658_10019851 Ga0070658_100198515 334
89 3300005327 Ga0070658_10030799 Ga0070658_100307992 334
90 3300005328 Ga0070676_10060127 Ga0070676_100601273 334
91 3300005329 Ga0070683_100005230 Ga0070683_1000052305 334
92 3300005329 Ga0070683_100007155 Ga0070683_1000071556 334
93 3300005329 Ga0070683_100048839 Ga0070683_1000488392 334
94 3300005331 Ga0070670_100010194 Ga0070670_1000101948 334
95 3300005334 Ga0068869_100023769 Ga0068869_1000237695 334
96 3300005335 Ga0070666_10086452 Ga0070666_100864522 334
97 3300005336 Ga0070680_100006107 Ga0070680_1000061074 334
98 3300005336 Ga0070680_100021520 Ga0070680_1000215202 334
99 3300005337 Ga0070682_100032136 Ga0070682_1000321362 334
100 3300005338 Ga0068868_100010500 Ga0068868_1000105007 334
101 3300005338 Ga0068868_100019851 Ga0068868_1000198515 334
102 3300005338 Ga0068868_100045210 Ga0068868_1000452101 334
103 3300005338 Ga0068868_100111762 Ga0068868_1001117622 334
104 3300005338 Ga0068868_100255573 Ga0068868_1002555731 334
105 3300005339 Ga0070660_100011919 Ga0070660_1000119195 334
106 3300005344 Ga0070661_100005374 Ga0070661_10000537410 334
107 3300005354 Ga0070675_100016747 Ga0070675_1000167472 334
108 3300005355 Ga0070671_100355918 Ga0070671_1003559181 334
109 3300005364 Ga0070673_100029304 Ga0070673_1000293044 334
110 3300005367 Ga0070667_100059000 Ga0070667_1000590002 334
111 3300005436 Ga0070713_100004985 Ga0070713_1000049851 334
112 3300005436 Ga0070713_100054873 Ga0070713_1000548734 334
113 3300005436 Ga0070713_100111354 Ga0070713_1001113542 334
114 3300005436 Ga0070713_100371004 Ga0070713_1003710041 334
115 3300005439 Ga0070711_100116018 Ga0070711_1001160183 334
116 3300005439 Ga0070711_100293801 Ga0070711_1002938011 334
117 3300005445 Ga0070708_100049759 Ga0070708_1000497592 334
118 3300005445 Ga0070708_100120635 Ga0070708_1001206352 334
119 3300005445 Ga0070708_100135715 Ga0070708_1001357152 334
120 3300005455 Ga0070663_100175396 Ga0070663_1001753961 334
121 3300005456 Ga0070678_100022717 Ga0070678_1000227174 334
122 3300005456 Ga0070678_100047254 Ga0070678_1000472543 334
123 3300005457 Ga0070662_100074876 Ga0070662_1000748762 334
124 3300005457 Ga0070662_100077535 Ga0070662_1000775352 334
125 3300005458 Ga0070681_10000441 Ga0070681_100004415 334
126 3300005458 Ga0070681_10022911 Ga0070681_100229115 334
127 3300005458 Ga0070681_10026270 Ga0070681_100262702 334
128 3300005458 Ga0070681_10032852 Ga0070681_100328524 334
129 3300005458 Ga0070681_10080877 Ga0070681_100808772 334
130 3300005458 Ga0070681_10136350 Ga0070681_101363503 334
131 3300005458 Ga0070681_10289800 Ga0070681_102898002 334
132 3300005459 Ga0068867_100236287 Ga0068867_1002362872 334
133 3300005530 Ga0070679_100003501 Ga0070679_1000035014 334
134 3300005530 Ga0070679_100041701 Ga0070679_1000417013 334
135 3300005530 Ga0070679_100053722 Ga0070679_1000537224 334
136 3300005530 Ga0070679_100130959 Ga0070679_1001309593 334
137 3300005530 Ga0070679_100146791 Ga0070679_1001467912 334
138 3300005530 Ga0070679_100279680 Ga0070679_1002796802 334
139 3300005535 Ga0070684_100000865 Ga0070684_10000086521 334
140 3300005535 Ga0070684_100009769 Ga0070684_1000097694 334
141 3300005535 Ga0070684_100027507 Ga0070684_1000275074 334
142 3300005535 Ga0070684_100058668 Ga0070684_1000586682 334
143 3300005535 Ga0070684_100143288 Ga0070684_1001432881 334
144 3300005536 Ga0070697_100176110 Ga0070697_1001761102 334
145 3300005539 Ga0068853_100004194 Ga0068853_10000419411 334
146 3300005539 Ga0068853_100023412 Ga0068853_1000234122 334
147 3300005539 Ga0068853_100106429 Ga0068853_1001064293 334
148 3300005539 Ga0068853_100156670 Ga0068853_1001566702 334
149 3300005539 Ga0068853_100165570 Ga0068853_1001655702 334
150 3300005543 Ga0070672_100054808 Ga0070672_1000548082 334
151 3300005548 Ga0070665_100030768 Ga0070665_1000307684 334
152 3300005563 Ga0068855_100004419 Ga0068855_1000044192 334
153 3300005563 Ga0068855_100006098 Ga0068855_1000060981 334
154 3300005563 Ga0068855_100023898 Ga0068855_1000238987 334
155 3300005563 Ga0068855_100031654 Ga0068855_1000316543 334
156 3300005563 Ga0068855_100068014 Ga0068855_1000680143 334
157 3300005563 Ga0068855_100105905 Ga0068855_1001059052 334
158 3300005563 Ga0068855_100108298 Ga0068855_1001082982 334
159 3300005563 Ga0068855_100208293 Ga0068855_1002082932 334
160 3300005577 Ga0068857_100022724 Ga0068857_1000227244 334
161 3300005577 Ga0068857_100071170 Ga0068857_1000711703 334
162 3300005577 Ga0068857_100113075 Ga0068857_1001130751 334
163 3300005577 Ga0068857_100158587 Ga0068857_1001585871 334
164 3300005578 Ga0068854_100054058 Ga0068854_1000540583 334
165 3300005578 Ga0068854_100112762 Ga0068854_1001127622 334
166 3300005614 Ga0068856_100003837 Ga0068856_10000383714 334
167 3300005614 Ga0068856_100004548 Ga0068856_1000045483 334
168 3300005614 Ga0068856_100006800 Ga0068856_1000068003 334
169 3300005614 Ga0068856_100014830 Ga0068856_1000148307 334
170 3300005614 Ga0068856_100019356 Ga0068856_1000193568 334
171 3300005614 Ga0068856_100118515 Ga0068856_1001185153 334
172 3300005616 Ga0068852_100000373 Ga0068852_1000003738 334
173 3300005616 Ga0068852_100011166 Ga0068852_1000111663 334
174 3300005616 Ga0068852_100056279 Ga0068852_1000562792 334
175 3300005617 Ga0068859_100007151 Ga0068859_1000071514 334
176 3300005617 Ga0068859_100077156 Ga0068859_1000771562 334
177 3300005618 Ga0068864_100074702 Ga0068864_1000747023 334
178 3300005834 Ga0068851_10014631 Ga0068851_100146313 334
179 3300005841 Ga0068863_100130664 Ga0068863_1001306642 334
180 3300005842 Ga0068858_100012332 Ga0068858_1000123326 334
181 3300005842 Ga0068858_100026941 Ga0068858_1000269417 334
182 3300005843 Ga0068860_100183648 Ga0068860_1001836482 334
183 3300005843 Ga0068860_100217267 Ga0068860_1002172672 334
184 3300005844 Ga0068862_100093080 Ga0068862_1000930803 334
185 3300005983 Ga0081540_1001931 Ga0081540_10019316 334
186 3300006028 Ga0070717_10016838 Ga0070717_100168386 334
187 3300006028 Ga0070717_10182341 Ga0070717_101823412 334
188 3300006173 Ga0070716_100000557 Ga0070716_1000005576 334
189 3300006175 Ga0070712_100054719 Ga0070712_1000547193 334
190 3300006237 Ga0097621_100021772 Ga0097621_1000217725 334
191 3300006237 Ga0097621_100039056 Ga0097621_1000390562 334
192 3300006237 Ga0097621_100177506 Ga0097621_1001775062 334
193 3300006358 Ga0068871_100002427 Ga0068871_1000024278 334
194 3300006358 Ga0068871_100014860 Ga0068871_1000148607 334
195 3300006358 Ga0068871_100062701 Ga0068871_1000627012 334
196 3300006358 Ga0068871_100244753 Ga0068871_1002447532 334
197 3300006852 Ga0075433_10047976 Ga0075433_100479763 334
198 3300006871 Ga0075434_100012735 Ga0075434_1000127353 334
199 3300006881 Ga0068865_100028164 Ga0068865_1000281641 334
200 3300006914 Ga0075436_100000709 Ga0075436_1000007094 334
201 3300006931 Ga0097620_100007151 Ga0097620_1000071514 334
202 3300006931 Ga0097620_100077156 Ga0097620_1000771562 334
203 3300007076 Ga0075435_100000841 Ga0075435_10000084120 334
204 3300009093 Ga0105240_10000166 Ga0105240_100001661 334
205 3300009093 Ga0105240_10001971 Ga0105240_100019719 334
206 3300009093 Ga0105240_10004239 Ga0105240_1000423913 334
207 3300009093 Ga0105240_10004420 Ga0105240_1000442015 334
208 3300009093 Ga0105240_10080641 Ga0105240_100806412 334
209 3300009093 Ga0105240_10095574 Ga0105240_100955743 334
210 3300009093 Ga0105240_10100162 Ga0105240_101001624 334
211 3300009093 Ga0105240_10106427 Ga0105240_101064274 334
212 3300009093 Ga0105240_10318395 Ga0105240_103183952 334
213 3300009093 Ga0105240_10323592 Ga0105240_103235921 334
214 3300009093 Ga0105240_10456542 Ga0105240_104565421 334
215 3300009098 Ga0105245_10000671 Ga0105245_1000067118 334
216 3300009098 Ga0105245_10063311 Ga0105245_100633112 334
217 3300009098 Ga0105245_10109275 Ga0105245_101092751 334
218 3300009098 Ga0105245_10174506 Ga0105245_101745062 334
219 3300009098 Ga0105245_10276035 Ga0105245_102760352 334
220 3300009148 Ga0105243_10200380 Ga0105243_102003801 334
221 3300009174 Ga0105241_10000553 Ga0105241_100005537 334
222 3300009174 Ga0105241_10001188 Ga0105241_100011887 334
223 3300009174 Ga0105241_10001486 Ga0105241_100014866 334
224 3300009174 Ga0105241_10007979 Ga0105241_100079794 334
225 3300009174 Ga0105241_10023783 Ga0105241_100237836 334
226 3300009174 Ga0105241_10038916 Ga0105241_100389163 334
227 3300009174 Ga0105241_10095948 Ga0105241_100959481 334
228 3300009176 Ga0105242_10013404 Ga0105242_100134042 334
229 3300009176 Ga0105242_10046891 Ga0105242_100468913 334
230 3300009176 Ga0105242_10260556 Ga0105242_102605561 334
231 3300009176 Ga0105242_10268812 Ga0105242_102688122 334
232 3300009176 Ga0105242_10437609 Ga0105242_104376092 334
233 3300009177 Ga0105248_10000002 Ga0105248_10000002949 334
234 3300009177 Ga0105248_10007060 Ga0105248_1000706010 334
235 3300009177 Ga0105248_10010116 Ga0105248_100101168 334
236 3300009177 Ga0105248_10057226 Ga0105248_100572264 334
237 3300009177 Ga0105248_10146834 Ga0105248_101468343 334
238 3300009177 Ga0105248_10169488 Ga0105248_101694882 334
239 3300009177 Ga0105248_10531180 Ga0105248_105311801 334
240 3300009545 Ga0105237_10003543 Ga0105237_1000354315 334
241 3300009545 Ga0105237_10004054 Ga0105237_100040548 334
242 3300009545 Ga0105237_10072985 Ga0105237_100729852 334
243 3300009545 Ga0105237_10108485 Ga0105237_101084853 334
244 3300009551 Ga0105238_10001562 Ga0105238_1000156214 334
245 3300009551 Ga0105238_10003866 Ga0105238_100038665 334
246 3300009551 Ga0105238_10012489 Ga0105238_100124896 334
247 3300009551 Ga0105238_10020933 Ga0105238_100209336 334
248 3300009551 Ga0105238_10045150 Ga0105238_100451504 334
249 3300009551 Ga0105238_10092362 Ga0105238_100923621 334
250 3300009551 Ga0105238_10306811 Ga0105238_103068111 334
251 3300009553 Ga0105249_10570363 Ga0105249_105703632 334
252 3300010375 Ga0105239_10012268 Ga0105239_100122683 334
253 3300010375 Ga0105239_10021981 Ga0105239_100219817 334
254 3300010375 Ga0105239_10023261 Ga0105239_100232615 334
255 3300010375 Ga0105239_10024256 Ga0105239_100242568 334
256 3300010375 Ga0105239_10044630 Ga0105239_100446305 334
257 3300011119 Ga0105246_10017863 Ga0105246_100178633 334
258 3300011119 Ga0105246_10301666 Ga0105246_103016661 334
259 3300013100 Ga0157373_10023679 Ga0157373_100236794 334
260 3300013100 Ga0157373_10123881 Ga0157373_101238812 334
261 3300013102 Ga0157371_10014264 Ga0157371_100142645 334
262 3300013104 Ga0157370_10000139 Ga0157370_100001392 334
263 3300013104 Ga0157370_10001437 Ga0157370_1000143720 334
264 3300013104 Ga0157370_10018086 Ga0157370_100180865 334
265 3300013104 Ga0157370_10064648 Ga0157370_100646484 334
266 3300013104 Ga0157370_10098232 Ga0157370_100982323 334
267 3300013104 Ga0157370_10112968 Ga0157370_101129682 334
268 3300013104 Ga0157370_10181762 Ga0157370_101817621 334
269 3300013104 Ga0157370_10287851 Ga0157370_102878511 334
270 3300013105 Ga0157369_10002361 Ga0157369_100023615 334
271 3300013105 Ga0157369_10003593 Ga0157369_100035936 334
272 3300013105 Ga0157369_10019577 Ga0157369_100195772 334
273 3300013105 Ga0157369_10032703 Ga0157369_100327032 334
274 3300013105 Ga0157369_10079958 Ga0157369_100799584 334
275 3300013105 Ga0157369_10141617 Ga0157369_101416172 334
276 3300013105 Ga0157369_10408033 Ga0157369_104080332 334
277 3300013296 Ga0157374_10056171 Ga0157374_100561713 334
278 3300013296 Ga0157374_10064212 Ga0157374_100642122 334
279 3300013296 Ga0157374_10064266 Ga0157374_100642662 334
280 3300013296 Ga0157374_10085446 Ga0157374_100854462 334
281 3300013296 Ga0157374_10089937 Ga0157374_100899371 334
282 3300013296 Ga0157374_10142219 Ga0157374_101422192 334
283 3300013296 Ga0157374_10164219 Ga0157374_101642191 334
284 3300013296 Ga0157374_10212448 Ga0157374_102124482 334
285 3300013296 Ga0157374_10237586 Ga0157374_102375861 334
286 3300013296 Ga0157374_10274679 Ga0157374_102746791 334
287 3300013297 Ga0157378_10091854 Ga0157378_100918543 334
288 3300013297 Ga0157378_10151875 Ga0157378_101518751 334
289 3300013306 Ga0163162_10005588 Ga0163162_100055884 334
290 3300013306 Ga0163162_10191590 Ga0163162_101915903 334
291 3300013307 Ga0157372_10000101 Ga0157372_100001014 334
292 3300013307 Ga0157372_10001307 Ga0157372_100013072 334
293 3300013307 Ga0157372_10001909 Ga0157372_100019097 334
294 3300013307 Ga0157372_10004217 Ga0157372_1000421715 334
295 3300013307 Ga0157372_10020797 Ga0157372_100207972 334
296 3300013307 Ga0157372_10022889 Ga0157372_100228894 334
297 3300013307 Ga0157372_10028847 Ga0157372_100288472 334
298 3300013307 Ga0157372_10039462 Ga0157372_100394626 334
299 3300013307 Ga0157372_10070336 Ga0157372_100703363 334
300 3300013307 Ga0157372_10081422 Ga0157372_100814222 334
301 3300013307 Ga0157372_10132993 Ga0157372_101329933 334
302 3300013307 Ga0157372_10147199 Ga0157372_101471992 334
303 3300013307 Ga0157372_10345391 Ga0157372_103453912 334
304 3300013308 Ga0157375_10091937 Ga0157375_100919371 334
305 3300013308 Ga0157375_10179812 Ga0157375_101798122 334
306 3300014325 Ga0163163_10004188 Ga0163163_100041884 334
307 3300014325 Ga0163163_10009070 Ga0163163_100090705 334
308 3300014325 Ga0163163_10036859 Ga0163163_100368593 334
309 3300014325 Ga0163163_10042477 Ga0163163_100424773 334
310 3300014325 Ga0163163_10070818 Ga0163163_100708182 334
311 3300014325 Ga0163163_10136843 Ga0163163_101368432 334
312 3300014968 Ga0157379_10094945 Ga0157379_100949451 334
313 3300014969 Ga0157376_10075167 Ga0157376_100751673 334
314 3300020070 Ga0206356_11130308 Ga0206356_111303081 334
315 3300020078 Ga0206352_10672922 Ga0206352_106729221 334
316 3300021361 Ga0213872_10000931 Ga0213872_1000093112 334
317 3300021388 Ga0213875_10056779 Ga0213875_100567792 334
318 3300021441 Ga0213871_10002332 Ga0213871_100023323 334
319 3300022467 Ga0224712_10097399 Ga0224712_100973991 334
320 3300024225 Ga0224572_1006578 Ga0224572_10065782 334
321 3300025321 Ga0207656_10005688 Ga0207656_100056884 334
322 3300025903 Ga0207680_10089838 Ga0207680_100898381 334
323 3300025904 Ga0207647_10006183 Ga0207647_100061837 334
324 3300025906 Ga0207699_10110603 Ga0207699_101106032 334
325 3300025906 Ga0207699_10117561 Ga0207699_101175611 334
326 3300025906 Ga0207699_10161700 Ga0207699_101617002 334
327 3300025907 Ga0207645_10043951 Ga0207645_100439511 334
328 3300025909 Ga0207705_10286653 Ga0207705_102866532 334
329 3300025911 Ga0207654_10000011 Ga0207654_10000011163 334
330 3300025911 Ga0207654_10000825 Ga0207654_1000082514 334
331 3300025911 Ga0207654_10004247 Ga0207654_100042476 334
332 3300025911 Ga0207654_10012675 Ga0207654_100126751 334
333 3300025911 Ga0207654_10021734 Ga0207654_100217342 334
334 3300025911 Ga0207654_10035530 Ga0207654_100355302 334
335 3300025911 Ga0207654_10039766 Ga0207654_100397662 334
336 3300025911 Ga0207654_10069044 Ga0207654_100690443 334
337 3300025912 Ga0207707_10003777 Ga0207707_100037777 334
338 3300025912 Ga0207707_10005348 Ga0207707_100053487 334
339 3300025912 Ga0207707_10076970 Ga0207707_100769702 334
340 3300025912 Ga0207707_10082402 Ga0207707_100824024 334
341 3300025912 Ga0207707_10183511 Ga0207707_101835112 334
342 3300025912 Ga0207707_10454156 Ga0207707_104541561 334
343 3300025913 Ga0207695_10000028 Ga0207695_10000028367 334
344 3300025913 Ga0207695_10000258 Ga0207695_1000025865 334
345 3300025913 Ga0207695_10000298 Ga0207695_1000029886 334
346 3300025913 Ga0207695_10013148 Ga0207695_100131482 334
347 3300025913 Ga0207695_10016300 Ga0207695_100163003 334
348 3300025913 Ga0207695_10023530 Ga0207695_100235307 334
349 3300025913 Ga0207695_10030449 Ga0207695_100304493 334
350 3300025913 Ga0207695_10053452 Ga0207695_100534524 334
351 3300025913 Ga0207695_10424599 Ga0207695_104245991 334
352 3300025913 Ga0207695_10462628 Ga0207695_104626281 334
353 3300025914 Ga0207671_10000022 Ga0207671_1000002258 334
354 3300025914 Ga0207671_10010667 Ga0207671_100106673 334
355 3300025914 Ga0207671_10026036 Ga0207671_100260362 334
356 3300025914 Ga0207671_10033405 Ga0207671_100334053 334
357 3300025914 Ga0207671_10053407 Ga0207671_100534072 334
358 3300025914 Ga0207671_10296615 Ga0207671_102966152 334
359 3300025915 Ga0207693_10090267 Ga0207693_100902672 334
360 3300025916 Ga0207663_10177921 Ga0207663_101779211 334
361 3300025917 Ga0207660_10001695 Ga0207660_1000169511 334
362 3300025917 Ga0207660_10059127 Ga0207660_100591271 334
363 3300025919 Ga0207657_10010363 Ga0207657_100103637 334
364 3300025919 Ga0207657_10022130 Ga0207657_100221303 334
365 3300025919 Ga0207657_10148261 Ga0207657_101482612 334
366 3300025920 Ga0207649_10001509 Ga0207649_1000150912 334
367 3300025920 Ga0207649_10055012 Ga0207649_100550123 334
368 3300025920 Ga0207649_10078559 Ga0207649_100785592 334
369 3300025921 Ga0207652_10004617 Ga0207652_100046178 334
370 3300025921 Ga0207652_10010084 Ga0207652_100100845 334
371 3300025921 Ga0207652_10032450 Ga0207652_100324504 334
372 3300025921 Ga0207652_10049820 Ga0207652_100498204 334
373 3300025921 Ga0207652_10193167 Ga0207652_101931672 334
374 3300025921 Ga0207652_10194944 Ga0207652_101949441 334
375 3300025924 Ga0207694_10000009 Ga0207694_10000009224 334
376 3300025924 Ga0207694_10000205 Ga0207694_100002057 334
377 3300025924 Ga0207694_10002043 Ga0207694_1000204310 334
378 3300025924 Ga0207694_10019545 Ga0207694_100195454 334
379 3300025924 Ga0207694_10038599 Ga0207694_100385992 334
380 3300025924 Ga0207694_10074174 Ga0207694_100741742 334
381 3300025924 Ga0207694_10087370 Ga0207694_100873702 334
382 3300025924 Ga0207694_10095561 Ga0207694_100955612 334
383 3300025927 Ga0207687_10001687 Ga0207687_1000168712 334
384 3300025927 Ga0207687_10064723 Ga0207687_100647232 334
385 3300025927 Ga0207687_10067402 Ga0207687_100674022 334
386 3300025927 Ga0207687_10251812 Ga0207687_102518121 334
387 3300025928 Ga0207700_10031146 Ga0207700_100311463 334
388 3300025928 Ga0207700_10144071 Ga0207700_101440712 334
389 3300025928 Ga0207700_10195364 Ga0207700_101953642 334
390 3300025928 Ga0207700_10199625 Ga0207700_101996252 334
391 3300025929 Ga0207664_10053763 Ga0207664_100537631 334
392 3300025931 Ga0207644_10017651 Ga0207644_100176514 334
393 3300025933 Ga0207706_10001914 Ga0207706_1000191412 334
394 3300025933 Ga0207706_10060991 Ga0207706_100609912 334
395 3300025934 Ga0207686_10002578 Ga0207686_100025782 334
396 3300025934 Ga0207686_10012078 Ga0207686_100120782 334
397 3300025934 Ga0207686_10047084 Ga0207686_100470842 334
398 3300025934 Ga0207686_10076820 Ga0207686_100768202 334
399 3300025938 Ga0207704_10037119 Ga0207704_100371191 334
400 3300025939 Ga0207665_10001725 Ga0207665_100017254 334
401 3300025940 Ga0207691_10029114 Ga0207691_100291144 334
402 3300025941 Ga0207711_10000008 Ga0207711_1000000873 334
403 3300025941 Ga0207711_10007606 Ga0207711_100076068 334
404 3300025941 Ga0207711_10029020 Ga0207711_100290202 334
405 3300025941 Ga0207711_10034371 Ga0207711_100343715 334
406 3300025941 Ga0207711_10035441 Ga0207711_100354412 334
407 3300025941 Ga0207711_10100490 Ga0207711_101004902 334
408 3300025941 Ga0207711_10156323 Ga0207711_101563232 334
409 3300025941 Ga0207711_10296208 Ga0207711_102962081 334
410 3300025942 Ga0207689_10005153 Ga0207689_100051539 334
411 3300025942 Ga0207689_10030993 Ga0207689_100309935 334
412 3300025944 Ga0207661_10001417 Ga0207661_1000141711 334
413 3300025944 Ga0207661_10003564 Ga0207661_1000356410 334
414 3300025944 Ga0207661_10009160 Ga0207661_100091605 334
415 3300025944 Ga0207661_10013492 Ga0207661_100134925 334
416 3300025944 Ga0207661_10039247 Ga0207661_100392472 334
417 3300025944 Ga0207661_10040972 Ga0207661_100409723 334
418 3300025944 Ga0207661_10190929 Ga0207661_101909292 334
419 3300025944 Ga0207661_10246884 Ga0207661_102468841 334
420 3300025945 Ga0207679_10350759 Ga0207679_103507591 334
421 3300025949 Ga0207667_10000332 Ga0207667_1000033231 334
422 3300025949 Ga0207667_10003823 Ga0207667_1000382317 334
423 3300025949 Ga0207667_10006307 Ga0207667_100063079 334
424 3300025949 Ga0207667_10014568 Ga0207667_100145682 334
425 3300025949 Ga0207667_10046082 Ga0207667_100460823 334
426 3300025949 Ga0207667_10062692 Ga0207667_100626923 334
427 3300025949 Ga0207667_10066366 Ga0207667_100663661 334
428 3300025949 Ga0207667_10123357 Ga0207667_101233571 334
429 3300025949 Ga0207667_10127735 Ga0207667_101277352 334
430 3300025949 Ga0207667_10488310 Ga0207667_104883102 334
431 3300025960 Ga0207651_10050893 Ga0207651_100508932 334
432 3300025986 Ga0207658_10023692 Ga0207658_100236921 334
433 3300025986 Ga0207658_10405229 Ga0207658_104052291 334
434 3300026023 Ga0207677_10000870 Ga0207677_100008709 334
435 3300026023 Ga0207677_10017267 Ga0207677_100172672 334
436 3300026023 Ga0207677_10030754 Ga0207677_100307541 334
437 3300026035 Ga0207703_10015012 Ga0207703_100150127 334
438 3300026035 Ga0207703_10015217 Ga0207703_100152175 334
439 3300026035 Ga0207703_10025043 Ga0207703_100250433 334
440 3300026035 Ga0207703_10445377 Ga0207703_104453772 334
441 3300026041 Ga0207639_10000165 Ga0207639_1000016511 334
442 3300026041 Ga0207639_10026735 Ga0207639_100267354 334
443 3300026041 Ga0207639_10083779 Ga0207639_100837791 334
444 3300026041 Ga0207639_10096228 Ga0207639_100962282 334
445 3300026078 Ga0207702_10002342 Ga0207702_100023422 334
446 3300026078 Ga0207702_10006549 Ga0207702_100065496 334
447 3300026078 Ga0207702_10102900 Ga0207702_101029001 334
448 3300026078 Ga0207702_10110804 Ga0207702_101108041 334
449 3300026078 Ga0207702_10124551 Ga0207702_101245512 334
450 3300026088 Ga0207641_10023209 Ga0207641_100232092 334
451 3300026088 Ga0207641_10210846 Ga0207641_102108462 334
452 3300026095 Ga0207676_10015776 Ga0207676_100157761 334
453 3300026095 Ga0207676_10018973 Ga0207676_100189735 334
454 3300026095 Ga0207676_10070284 Ga0207676_100702842 334
455 3300026095 Ga0207676_10140619 Ga0207676_101406192 334
456 3300026116 Ga0207674_10018247 Ga0207674_100182476 334
457 3300026116 Ga0207674_10024297 Ga0207674_100242977 334
458 3300026116 Ga0207674_10031303 Ga0207674_100313034 334
459 3300026116 Ga0207674_10280326 Ga0207674_102803262 334
460 3300026121 Ga0207683_10269099 Ga0207683_102690991 334
461 3300026142 Ga0207698_10000155 Ga0207698_100001552 334
462 3300026142 Ga0207698_10002636 Ga0207698_100026364 334
463 3300026142 Ga0207698_10004105 Ga0207698_100041052 334
464 3300026142 Ga0207698_10034050 Ga0207698_100340502 334
465 3300026142 Ga0207698_10036224 Ga0207698_100362241 334
466 3300026142 Ga0207698_10352194 Ga0207698_103521942 334
467 3300028379 Ga0268266_10033439 Ga0268266_100334393 334
468 3300028577 Ga0265318_10029902 Ga0265318_100299021 334
469 3300028577 Ga0265318_10049865 Ga0265318_100498652 334
470 3300028800 Ga0265338_10002440 Ga0265338_1000244021 334
471 3300028800 Ga0265338_10013232 Ga0265338_100132322 334
472 3300028800 Ga0265338_10079707 Ga0265338_100797072 334
473 3300031235 Ga0265330_10000561 Ga0265330_100005619 334
474 3300031235 Ga0265330_10000660 Ga0265330_1000066013 334
475 3300031235 Ga0265330_10012487 Ga0265330_100124872 334
476 3300031235 Ga0265330_10014474 Ga0265330_100144741 334
477 3300031235 Ga0265330_10043585 Ga0265330_100435852 334
478 3300031238 Ga0265332_10019068 Ga0265332_100190681 334
479 3300031238 Ga0265332_10100934 Ga0265332_101009341 334
480 3300031239 Ga0265328_10002955 Ga0265328_100029555 334
481 3300031239 Ga0265328_10007483 Ga0265328_100074832 334
482 3300031240 Ga0265320_10006244 Ga0265320_100062446 334
483 3300031241 Ga0265325_10000082 Ga0265325_1000008210 334
484 3300031241 Ga0265325_10007273 Ga0265325_100072734 334
485 3300031241 Ga0265325_10013915 Ga0265325_100139152 334
486 3300031241 Ga0265325_10014494 Ga0265325_100144944 334
487 3300031241 Ga0265325_10025041 Ga0265325_100250413 334
488 3300031247 Ga0265340_10003790 Ga0265340_100037908 334
489 3300031247 Ga0265340_10007068 Ga0265340_100070682 334
490 3300031247 Ga0265340_10012017 Ga0265340_100120172 334
491 3300031247 Ga0265340_10027525 Ga0265340_100275252 334
492 3300031247 Ga0265340_10041841 Ga0265340_100418412 334
493 3300031247 Ga0265340_10054005 Ga0265340_100540052 334
494 3300031249 Ga0265339_10000081 Ga0265339_1000008158 334
495 3300031249 Ga0265339_10000866 Ga0265339_1000086611 334
496 3300031249 Ga0265339_10002180 Ga0265339_1000218011 334
497 3300031249 Ga0265339_10036105 Ga0265339_100361053 334
498 3300031249 Ga0265339_10049350 Ga0265339_100493503 334
499 3300031249 Ga0265339_10068921 Ga0265339_100689212 334
500 3300031250 Ga0265331_10002265 Ga0265331_100022657 334
501 3300031344 Ga0265316_10001950 Ga0265316_100019505 334
502 3300031344 Ga0265316_10010240 Ga0265316_100102403 334
503 3300031344 Ga0265316_10010460 Ga0265316_100104603 334
504 3300031344 Ga0265316_10011020 Ga0265316_100110209 334
505 3300031344 Ga0265316_10024286 Ga0265316_100242864 334
506 3300031344 Ga0265316_10028441 Ga0265316_100284412 334
507 3300031344 Ga0265316_10028701 Ga0265316_100287012 334
508 3300031344 Ga0265316_10031218 Ga0265316_100312186 334
509 3300031344 Ga0265316_10057957 Ga0265316_100579572 334
510 3300031344 Ga0265316_10085954 Ga0265316_100859541 334
511 3300031344 Ga0265316_10139327 Ga0265316_101393272 334
512 3300031344 Ga0265316_10171220 Ga0265316_101712202 334
513 3300031595 Ga0265313_10000409 Ga0265313_100004093 334
514 3300031595 Ga0265313_10003572 Ga0265313_100035726 334
515 3300031595 Ga0265313_10006669 Ga0265313_100066696 334
516 3300031595 Ga0265313_10010227 Ga0265313_100102273 334
517 3300031595 Ga0265313_10029588 Ga0265313_100295883 334
518 3300031595 Ga0265313_10045977 Ga0265313_100459772 334
519 3300031711 Ga0265314_10000090 Ga0265314_1000009098 334
520 3300031711 Ga0265314_10002269 Ga0265314_100022696 334
521 3300031711 Ga0265314_10002275 Ga0265314_100022754 334
522 3300031711 Ga0265314_10002480 Ga0265314_100024804 334
523 3300031711 Ga0265314_10013248 Ga0265314_100132483 334
524 3300031711 Ga0265314_10020518 Ga0265314_100205181 334
525 3300031711 Ga0265314_10029302 Ga0265314_100293026 334
526 3300031711 Ga0265314_10119029 Ga0265314_101190292 334
527 3300031712 Ga0265342_10000636 Ga0265342_100006363 334
528 3300031712 Ga0265342_10007724 Ga0265342_100077242 334
529 3300031712 Ga0265342_10016109 Ga0265342_100161093 334
530 3300031712 Ga0265342_10055606 Ga0265342_100556062 334
531 3300031712 Ga0265342_10161427 Ga0265342_101614271 334
532 3300035083 Ga0373926_0002943 Ga0373926_0002943_3529_4536 334
533 3300035113 Ga0373936_0031148 Ga0373936_0031148_682_1689 334
534 3300035119 Ga0373956_0020236 Ga0373956_0020236_332_1339 334
535 3300035170 Ga0373943_0056817 Ga0373943_0056817_245_1252 334
536 3300035172 Ga0373955_0018482 Ga0373955_0018482_2133_3137 334
537 3300035172 Ga0373955_0156464 Ga0373955_0156464_157_1167 334
538 3300035692 Ga0373935_0003578 Ga0373935_0003578_2405_3412 334
539 3300035692 Ga0373935_0070638 Ga0373935_0070638_31_1038 334
540 3300035724 Ga0373933_0021065 Ga0373933_0021065_833_1840 334
541 3300035725 Ga0373947_0012361 Ga0373947_0012361_1504_2511 334
542 3300036401 Ga0373937_0010670 Ga0373937_0010670_2132_3136 334
543 3300036401 Ga0373937_0017521 Ga0373937_0017521_3587_4597 334
544 3300036401 Ga0373937_0023587 Ga0373937_0023587_2426_3433 334
545 3300037068 Ga0373925_0043887 Ga0373925_0043887_1489_2496 334
546 3300037068 Ga0373925_0044710 Ga0373925_0044710_236_1243 334
547 3300037068 Ga0373925_0182926 Ga0373925_0182926_643_1647 334
548 3300037466 Ga0395898_0186959 Ga0395898_0186959_753_1757 334
549 3300037853 Ga0436364_1162556 Ga0436364_1162556_2780_3787 334
550 3300038443 Ga0395901_0242926 Ga0395901_0242926_540_1544 334
551 3300038443 Ga0395901_0591552 Ga0395901_0591552_24_1031 334
552 3300039438 Ga0436360_0054547 Ga0436360_0054547_834_1838 334
553 3300039438 Ga0436360_0509439 Ga0436360_0509439_41_1045 334
554 3300039438 Ga0436360_0608291 Ga0436360_0608291_1901_2905 334
555 3300039447 Ga0436361_0112257 Ga0436361_0112257_54_1058 334
556 3300039447 Ga0436361_0159775 Ga0436361_0159775_415_1419 334
557 3300039447 Ga0436361_0435458 Ga0436361_0435458_56_1060 334
558 3300039447 Ga0436361_0488380 Ga0436361_0488380_3356_4363 334
559 3300039447 Ga0436361_0660005 Ga0436361_0660005_3702_4706 334
560 3300039447 Ga0436361_0825843 Ga0436361_0825843_5976_6980 334
561 3300039450 Ga0436363_1471637 Ga0436363_1471637_536_1543 334
562 3300042876 Ga0451577_0000215 Ga0451577_0000215_89895_90905 334
563 3300044673 Ga0453683_0007263 Ga0453683_0007263_2712_3722 334
564 3300044693 Ga0466961_0079783 Ga0466961_0079783_607_1617 334
565 3300044694 Ga0466963_0072702 Ga0466963_0072702_757_1764 334
566 3300044712 Ga0453684_0000545 Ga0453684_0000545_130643_131653 334
567 3300044712 Ga0453684_0183329 Ga0453684_0183329_1175_2185 334
568 3300045051 Ga0451576_0054488 Ga0451576_0054488_2879_3889 334
569 3300045836 Ga0466958_0109404 Ga0466958_0109404_151_1158 334
570 3300045976 Ga0466967_0000669 Ga0466967_0000669_5082_6089 334
571 3300045976 Ga0466967_0050807 Ga0466967_0050807_1350_2354 334
572 3300046459 Ga0495629_0007214 Ga0495629_0007214_4683_5687 334
573 3300046459 Ga0495629_0046149 Ga0495629_0046149_38_1042 334
574 3300046463 Ga0495653_0200029 Ga0495653_0200029_19_1023 334
575 3300046472 Ga0495580_0018790 Ga0495580_0018790_1359_2366 334
576 3300046473 Ga0495582_0002035 Ga0495582_0002035_2554_3561 334
577 3300046475 Ga0495639_0022695 Ga0495639_0022695_1391_2398 334
578 3300046476 Ga0495662_0117446 Ga0495662_0117446_275_1279 334
579 3300046517 Ga0495630_0154501 Ga0495630_0154501_560_1567 334
580 3300046517 Ga0495630_0159824 Ga0495630_0159824_346_1353 334
581 3300046522 Ga0495643_0023230 Ga0495643_0023230_2169_3173 334
582 3300046529 Ga0495652_0060324 Ga0495652_0060324_1864_2868 334
583 3300046529 Ga0495652_0131681 Ga0495652_0131681_634_1644 334
584 3300046531 Ga0495665_0001598 Ga0495665_0001598_8490_9497 334
585 3300046535 Ga0495586_0101991 Ga0495586_0101991_466_1473 334
586 3300046536 Ga0495587_0006688 Ga0495587_0006688_3211_4296 334
587 3300046536 Ga0495587_0027192 Ga0495587_0027192_46_1050 334
588 3300046678 Ga0495599_0028805 Ga0495599_0028805_1739_2749 334
589 3300046683 Ga0495658_0014405 Ga0495658_0014405_125_1132 334
590 3300046684 Ga0495669_0019362 Ga0495669_0019362_528_1538 334
591 3300046684 Ga0495669_0029759 Ga0495669_0029759_1296_2303 334
592 3300047320 Ga0495672_0053265 Ga0495672_0053265_187_1194 334
593 3300047472 Ga0495686_0003658 Ga0495686_0003658_3155_4162 334
594 3300048088 Ga0495602_0006144 Ga0495602_0006144_781_1866 334
595 3300048088 Ga0495602_0051194 Ga0495602_0051194_291_1295 334
596 3300048088 Ga0495602_0073519 Ga0495602_0073519_52_1059 334
597 3300048907 Ga0496104_0053794 Ga0496104_0053794_431_1435 334
598 3300048907 Ga0496104_0073373 Ga0496104_0073373_1148_2152 334
599 3300048907 Ga0496104_0275966 Ga0496104_0275966_380_1390 334
600 3300048908 Ga0496105_0036142 Ga0496105_0036142_1611_2615 334
601 3300048908 Ga0496105_0105132 Ga0496105_0105132_1254_2258 334
602 3300048909 Ga0496106_0163236 Ga0496106_0163236_581_1591 334
603 3300048912 Ga0496109_0198879 Ga0496109_0198879_746_1750 334
604 3300048915 Ga0496112_0002909 Ga0496112_0002909_4393_5400 334
605 3300048915 Ga0496112_0039317 Ga0496112_0039317_3151_4161 334
606 3300048915 Ga0496112_0233291 Ga0496112_0233291_278_1282 334
607 3300048918 Ga0496115_0039432 Ga0496115_0039432_1506_2510 334
608 3300048918 Ga0496115_0060290 Ga0496115_0060290_1876_2880 334
609 3300048918 Ga0496115_0106162 Ga0496115_0106162_644_1648 334
610 3300048918 Ga0496115_0177147 Ga0496115_0177147_448_1452 334
611 3300048918 Ga0496115_0178262 Ga0496115_0178262_313_1323 334
612 3300049589 Ga0501073_0081488 Ga0501073_0081488_1170_2180 334
613 3300050512 nmdc:mga0n895_7816_c1 nmdc:mga0n895_7816_c1_7123_8133 334
614 3300050513 nmdc:mga0rr50_18108_c1 nmdc:mga0rr50_18108_c1_83_1090 334
615 3300050513 nmdc:mga0rr50_28757_c1 nmdc:mga0rr50_28757_c1_42_1052 334
616 3300050514 nmdc:mga08x19_1649_c1 nmdc:mga08x19_1649_c1_10427_11434 334
617 3300050515 nmdc:mga0a205_75008_c1 nmdc:mga0a205_75008_c1_1832_2842 334
618 3300053077 Ga0495601_0061000 Ga0495601_0061000_393_1397 334
619 3300053077 Ga0495601_0087343 Ga0495601_0087343_48_1052 334
620 3300053088 Ga0500644_0010852 Ga0500644_0010852_1259_2263 334
621 3300059492 Ga0587073_0023529 Ga0587073_0023529_114_1118 334
622 3300059505 Ga0587083_0011740 Ga0587083_0011740_371_1375 334
623 3300059604 Ga0587098_004351 Ga0587098_004351_239_1243 334
624 3300059628 Ga0587122_003227 Ga0587122_003227_149_1153 334
625 3300059630 Ga0587128_009798 Ga0587128_009798_90_1094 334
626 3300059644 Ga0587075_008378 Ga0587075_008378_90_1094 334
627 3300060346 Ga0587111_0015943 Ga0587111_0015943_198_1202 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02800

Gp_dh_C

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain

174

329

0.99

PF00044

Gp_dh_N

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain

19

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dib-assembly1.cif.gz_E the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9647 3 332
4dib-assembly2.cif.gz_C the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9636 3 332
4dib-assembly1.cif.gz_D the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9626 3 332
4dib-assembly2.cif.gz_G the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9597 3 332
4dib-assembly1.cif.gz_F the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9576 3 332
ID Description Score Start End Superfamily
1hdgO01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9628 3 149 3.40.50.720
af_Q2G032_1_148_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9591 1 149 3.40.50.720
af_Q4E4E5_8_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.958 2 149 3.40.50.720
4dibE02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9562 151 313 3.30.360.10
af_F1M004_3_96_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9557 235 313 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A3B0PZZ1-F1-model_v4 Glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12) 0.988 2 85 GO:0004365
GO:0051287
AF-A0A3B9M0A1-F1-model_v4 Type I glyceraldehyde-3-phosphate dehydrogenase 0.9875 1 185 GO:0005737
GO:0006096
GO:0016620
GO:0051287
AF-A0A357V737-F1-model_v4 Erythrose-4-phosphate dehydrogenase (EC 1.2.1.12) 0.9874 233 321 GO:0004365
AF-A0A6J7NT40-F1-model_v4 Unannotated protein 0.9859 224 332 GO:0016620
AF-A0A6L7E3H5-F1-model_v4 deleted 0.9844 1 170

Feature Viewer

pLDDT pTM Quality
92.71 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map