F470554
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 627 | 376 | 598 | 74 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10093926|Ga0105244_100939262 |
| Length | 78 |
| Sequence | MMVATVTDVYLNPHQARRRPPTQFEDLLGDSIERAYAAGIHELGALVAHLNRTGPSCPYNAGVWTEANYQEEIARLAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 2 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 3 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 9 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 10 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 11 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 12 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 13 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 14 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 15 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 16 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 17 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 18 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 19 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 20 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 21 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 22 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 23 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 24 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 25 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 26 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 27 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 28 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 29 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 30 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 31 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 32 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 33 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 34 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 35 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 36 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 37 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 38 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 39 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 40 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 41 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 42 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 49 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 50 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 53 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 56 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 62 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 138 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 202 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 203 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 223 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 224 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 225 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 226 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 227 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 228 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 233 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 234 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 235 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 236 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 237 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 238 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 239 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 240 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 241 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 242 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 243 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 244 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 245 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 246 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 247 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 248 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 249 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 250 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 251 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 252 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 253 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 254 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 255 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 332 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 333 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 336 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 347 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 350 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 351 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 352 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 354 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 355 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 356 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 358 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 360 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 361 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 362 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 364 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 365 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 371 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 374 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 375 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.74 |
| Metatranscriptomes | 0.64 |
| Isolates | 4.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.88 |
| Nodule | 0.64 |
| Rhizoplane | 5.26 |
| Rhizosphere | 59.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10045454 | 3300001989 | Bacteria | 1441 |
| 2 | JGI25152J39213_1006739 | 3300002773 | Bacteria | 3063 |
| 3 | JGI25152J39213_1007757 | 3300002773 | Bacteria | 2744 |
| 4 | JGI25150J39212_1004124 | 3300002774 | Bacteria | 3278 |
| 5 | JGI25159J45721_1027654 | 3300002987 | Bacteria | 959 |
| 6 | JGI25151J46595_10021272 | 3300003187 | Bacteria | 2718 |
| 7 | JGI25151J46595_10050715 | 3300003187 | Bacteria | 1411 |
| 8 | JGI25153J46596_10008164 | 3300003215 | Bacteria | 5043 |
| 9 | JGI25153J46596_10038933 | 3300003215 | Bacteria | 1491 |
| 10 | rootH1_10023287 | 3300003316 | Bacteria | 1483 |
| 11 | rootH2_10201511 | 3300003320 | Bacteria | 1693 |
| 12 | rootH1_10010296 | 3300003323 | Bacteria | 2569 |
| 13 | JGI25160J50197_1014803 | 3300003354 | Bacteria | 2589 |
| 14 | JGI25160J50197_1018904 | 3300003354 | Bacteria | 2132 |
| 15 | JGI25161J50226_1001166 | 3300003374 | Bacteria | 8720 |
| 16 | JGI25161J50226_1011488 | 3300003374 | Bacteria | 1110 |
| 17 | JGI25161J50226_1013391 | 3300003374 | Bacteria | 951 |
| 18 | Ga0006562J51391_1081046 | 3300003578 | Bacteria | 1500 |
| 19 | Ga0006562J51391_1081047 | 3300003578 | Bacteria | 680 |
| 20 | Ga0006562J51391_1118556 | 3300003578 | Bacteria | 3380 |
| 21 | Ga0006562J51391_1118558 | 3300003578 | Bacteria | 1230 |
| 22 | Ga0055527_1010495 | 3300003760 | Bacteria | 1068 |
| 23 | Ga0055535_1001794 | 3300003761 | Bacteria | 9420 |
| 24 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 25 | Ga0055542_1004738 | 3300003762 | Bacteria | 3210 |
| 26 | Ga0055526_1010824 | 3300003771 | Bacteria | 4194 |
| 27 | Ga0055526_1020299 | 3300003771 | Bacteria | 2372 |
| 28 | Ga0055537_1004186 | 3300003773 | Bacteria | 4194 |
| 29 | Ga0055537_1008545 | 3300003773 | Bacteria | 2352 |
| 30 | Ga0055524_1016108 | 3300003775 | Bacteria | 2697 |
| 31 | Ga0055536_1009558 | 3300003781 | Bacteria | 3988 |
| 32 | Ga0055536_1010487 | 3300003781 | Bacteria | 3667 |
| 33 | Ga0055536_1050417 | 3300003781 | Bacteria | 918 |
| 34 | Ga0055534_1007036 | 3300003784 | Bacteria | 2743 |
| 35 | Ga0055534_1007579 | 3300003784 | Bacteria | 2568 |
| 36 | Ga0055528_1015854 | 3300003790 | Bacteria | 2697 |
| 37 | Ga0055528_1026689 | 3300003790 | Bacteria | 1649 |
| 38 | Ga0055530_10002962 | 3300003791 | Bacteria | 10231 |
| 39 | Ga0055530_10013054 | 3300003791 | Bacteria | 2857 |
| 40 | Ga0055540_1002232 | 3300003792 | Bacteria | 10483 |
| 41 | Ga0055540_1009260 | 3300003792 | Bacteria | 3422 |
| 42 | Ga0055540_1010547 | 3300003792 | Bacteria | 3066 |
| 43 | Ga0055540_1011999 | 3300003792 | Bacteria | 2750 |
| 44 | Ga0055540_1015561 | 3300003792 | Bacteria | 2205 |
| 45 | Ga0055531_10006424 | 3300003794 | Bacteria | 6677 |
| 46 | Ga0055531_10015624 | 3300003794 | Bacteria | 3331 |
| 47 | Ga0055531_10017837 | 3300003794 | Bacteria | 2968 |
| 48 | Ga0055531_10065334 | 3300003794 | Bacteria | 865 |
| 49 | Ga0055543_1001238 | 3300004625 | Bacteria | 10652 |
| 50 | Ga0055543_1006692 | 3300004625 | Bacteria | 2750 |
| 51 | Ga0065165_1003020 | 3300005262 | Bacteria | 12691 |
| 52 | Ga0065165_1032362 | 3300005262 | Bacteria | 1640 |
| 53 | Ga0065714_10099269 | 3300005288 | Bacteria | 1649 |
| 54 | Ga0065714_10218370 | 3300005288 | Bacteria | 845 |
| 55 | Ga0065704_10155066 | 3300005289 | Bacteria | 1397 |
| 56 | Ga0070658_10293938 | 3300005327 | Bacteria | 1385 |
| 57 | Ga0070670_100816493 | 3300005331 | Bacteria | 843 |
| 58 | Ga0070677_10545674 | 3300005333 | Bacteria | 635 |
| 59 | Ga0068869_100864523 | 3300005334 | Bacteria | 781 |
| 60 | Ga0070660_100722101 | 3300005339 | Bacteria | 836 |
| 61 | Ga0070660_101246555 | 3300005339 | Bacteria | 631 |
| 62 | Ga0070668_100756240 | 3300005347 | Bacteria | 861 |
| 63 | Ga0070669_100071932 | 3300005353 | Bacteria | 2559 |
| 64 | Ga0070669_101521397 | 3300005353 | Bacteria | 582 |
| 65 | Ga0070675_101623028 | 3300005354 | Bacteria | 597 |
| 66 | Ga0070671_100659816 | 3300005355 | Bacteria | 906 |
| 67 | Ga0070674_100062602 | 3300005356 | Bacteria | 2600 |
| 68 | Ga0070674_102206699 | 3300005356 | Bacteria | 503 |
| 69 | Ga0070673_100391687 | 3300005364 | Bacteria | 1241 |
| 70 | Ga0070673_101996013 | 3300005364 | Bacteria | 551 |
| 71 | Ga0070688_101510865 | 3300005365 | Bacteria | 547 |
| 72 | Ga0070659_100052983 | 3300005366 | Bacteria | 3193 |
| 73 | Ga0070667_100015926 | 3300005367 | Bacteria | 6220 |
| 74 | Ga0070667_101401403 | 3300005367 | Bacteria | 656 |
| 75 | Ga0070711_100961617 | 3300005439 | Bacteria | 731 |
| 76 | Ga0070708_100535277 | 3300005445 | Bacteria | 1105 |
| 77 | Ga0070678_100664812 | 3300005456 | Bacteria | 936 |
| 78 | Ga0070678_101112639 | 3300005456 | Bacteria | 730 |
| 79 | Ga0070662_100018544 | 3300005457 | Bacteria | 4709 |
| 80 | Ga0068867_100673506 | 3300005459 | Bacteria | 910 |
| 81 | Ga0070685_10269930 | 3300005466 | Bacteria | 1135 |
| 82 | Ga0068853_100030557 | 3300005539 | Bacteria | 4551 |
| 83 | Ga0068853_100078751 | 3300005539 | Bacteria | 2881 |
| 84 | Ga0070672_100117095 | 3300005543 | Bacteria | 2178 |
| 85 | Ga0070672_100491209 | 3300005543 | Bacteria | 1061 |
| 86 | Ga0070665_100074476 | 3300005548 | Bacteria | 3401 |
| 87 | Ga0070665_100083840 | 3300005548 | Bacteria | 3192 |
| 88 | Ga0070665_100320732 | 3300005548 | Bacteria | 1554 |
| 89 | Ga0070665_101816039 | 3300005548 | Bacteria | 616 |
| 90 | Ga0068855_100033501 | 3300005563 | Bacteria | 6130 |
| 91 | Ga0070664_100267954 | 3300005564 | Bacteria | 1538 |
| 92 | Ga0068857_100141486 | 3300005577 | Bacteria | 2175 |
| 93 | Ga0068854_100000568 | 3300005578 | Bacteria | 22144 |
| 94 | Ga0068854_100415950 | 3300005578 | Bacteria | 1116 |
| 95 | Ga0068854_102220245 | 3300005578 | Bacteria | 508 |
| 96 | Ga0068856_100579232 | 3300005614 | Bacteria | 1143 |
| 97 | Ga0068852_101011222 | 3300005616 | Bacteria | 850 |
| 98 | Ga0068852_102143051 | 3300005616 | Bacteria | 581 |
| 99 | Ga0068851_10011467 | 3300005834 | Bacteria | 4159 |
| 100 | Ga0068851_10442209 | 3300005834 | Bacteria | 771 |
| 101 | Ga0068851_10482818 | 3300005834 | Bacteria | 741 |
| 102 | Ga0068870_10455324 | 3300005840 | Bacteria | 844 |
| 103 | Ga0068863_100700414 | 3300005841 | Bacteria | 1007 |
| 104 | Ga0068860_100333651 | 3300005843 | Bacteria | 1490 |
| 105 | Ga0075368_10119415 | 3300006042 | Bacteria | 1091 |
| 106 | Ga0075363_100291663 | 3300006048 | Bacteria | 945 |
| 107 | Ga0075363_100464406 | 3300006048 | Bacteria | 749 |
| 108 | Ga0075364_10841759 | 3300006051 | Bacteria | 625 |
| 109 | Ga0075432_10013889 | 3300006058 | Bacteria | 2740 |
| 110 | Ga0070715_10891459 | 3300006163 | Bacteria | 547 |
| 111 | Ga0075362_10045591 | 3300006177 | Bacteria | 1948 |
| 112 | Ga0075367_10217421 | 3300006178 | Bacteria | 1195 |
| 113 | Ga0075369_10027031 | 3300006186 | Bacteria | 2396 |
| 114 | Ga0075366_10092471 | 3300006195 | Bacteria | 1812 |
| 115 | Ga0075366_10335309 | 3300006195 | Bacteria | 927 |
| 116 | Ga0075366_10596656 | 3300006195 | Bacteria | 685 |
| 117 | Ga0097621_101038054 | 3300006237 | Bacteria | 768 |
| 118 | Ga0097621_101467662 | 3300006237 | Bacteria | 647 |
| 119 | Ga0097621_101662662 | 3300006237 | Bacteria | 608 |
| 120 | Ga0075370_10002278 | 3300006353 | Bacteria | 8848 |
| 121 | Ga0075370_10011877 | 3300006353 | Bacteria | 4586 |
| 122 | Ga0075370_10125617 | 3300006353 | Bacteria | 1495 |
| 123 | Ga0075370_10449209 | 3300006353 | Bacteria | 776 |
| 124 | Ga0075370_10725932 | 3300006353 | Bacteria | 604 |
| 125 | Ga0068871_101641375 | 3300006358 | Bacteria | 609 |
| 126 | Ga0068871_101769182 | 3300006358 | Bacteria | 587 |
| 127 | Ga0068865_100327046 | 3300006881 | Bacteria | 1235 |
| 128 | Ga0068865_101528475 | 3300006881 | Bacteria | 599 |
| 129 | Ga0079104_1000226 | 3300006946 | Bacteria | 77894 |
| 130 | Ga0105244_10001011 | 3300009036 | Bacteria | 23532 |
| 131 | Ga0105244_10093926 | 3300009036 | Bacteria | 1473 |
| 132 | Ga0105250_10000526 | 3300009092 | Bacteria | 26634 |
| 133 | Ga0105240_10660297 | 3300009093 | Bacteria | 1145 |
| 134 | Ga0105240_10665814 | 3300009093 | Bacteria | 1139 |
| 135 | Ga0105245_10541256 | 3300009098 | Bacteria | 1185 |
| 136 | Ga0105247_11541446 | 3300009101 | Bacteria | 543 |
| 137 | Ga0105243_10002414 | 3300009148 | Bacteria | 15651 |
| 138 | Ga0105243_10007533 | 3300009148 | Bacteria | 8370 |
| 139 | Ga0105243_10011391 | 3300009148 | Bacteria | 6729 |
| 140 | Ga0105243_12532994 | 3300009148 | Bacteria | 552 |
| 141 | Ga0105241_10212738 | 3300009174 | Bacteria | 1621 |
| 142 | Ga0105242_10375552 | 3300009176 | Bacteria | 1320 |
| 143 | Ga0105242_10888457 | 3300009176 | Bacteria | 890 |
| 144 | Ga0105242_13037632 | 3300009176 | Bacteria | 520 |
| 145 | Ga0105248_10754013 | 3300009177 | Bacteria | 1098 |
| 146 | Ga0105248_12106155 | 3300009177 | Bacteria | 641 |
| 147 | Ga0105237_10023997 | 3300009545 | Bacteria | 6240 |
| 148 | Ga0105237_11023700 | 3300009545 | Bacteria | 833 |
| 149 | Ga0105238_10000065 | 3300009551 | Bacteria | 121196 |
| 150 | Ga0105238_10413950 | 3300009551 | Bacteria | 1342 |
| 151 | Ga0105238_10613020 | 3300009551 | Bacteria | 1097 |
| 152 | Ga0105249_10492504 | 3300009553 | Bacteria | 1270 |
| 153 | Ga0105249_12897325 | 3300009553 | Bacteria | 551 |
| 154 | Ga0105239_10086610 | 3300010375 | Bacteria | 3453 |
| 155 | Ga0105239_10669925 | 3300010375 | Bacteria | 1185 |
| 156 | Ga0105246_10224283 | 3300011119 | Bacteria | 1475 |
| 157 | Ga0105246_10243772 | 3300011119 | Bacteria | 1422 |
| 158 | Ga0157328_1007993 | 3300012478 | Bacteria | 682 |
| 159 | Ga0157373_10039688 | 3300013100 | Bacteria | 3370 |
| 160 | Ga0157373_10135247 | 3300013100 | Bacteria | 1733 |
| 161 | Ga0157371_10161421 | 3300013102 | Bacteria | 1601 |
| 162 | Ga0157371_10591359 | 3300013102 | Bacteria | 825 |
| 163 | Ga0157370_10111341 | 3300013104 | Bacteria | 2559 |
| 164 | Ga0157370_10678162 | 3300013104 | Bacteria | 941 |
| 165 | Ga0157370_11047683 | 3300013104 | Bacteria | 738 |
| 166 | Ga0157369_10451678 | 3300013105 | Bacteria | 1331 |
| 167 | Ga0157378_11621535 | 3300013297 | Bacteria | 693 |
| 168 | Ga0157378_12372341 | 3300013297 | Bacteria | 582 |
| 169 | Ga0163162_10004924 | 3300013306 | Bacteria | 12876 |
| 170 | Ga0163162_10578215 | 3300013306 | Bacteria | 1250 |
| 171 | Ga0163162_10655089 | 3300013306 | Bacteria | 1174 |
| 172 | Ga0157372_10718220 | 3300013307 | Bacteria | 1162 |
| 173 | Ga0157375_10947170 | 3300013308 | Bacteria | 1003 |
| 174 | Ga0157380_10424451 | 3300014326 | Bacteria | 1269 |
| 175 | Ga0182008_10005597 | 3300014497 | Bacteria | 7121 |
| 176 | Ga0182008_10013054 | 3300014497 | Bacteria | 4370 |
| 177 | Ga0182008_10098018 | 3300014497 | Bacteria | 1447 |
| 178 | Ga0182008_10100052 | 3300014497 | Bacteria | 1432 |
| 179 | Ga0157379_11500668 | 3300014968 | Bacteria | 656 |
| 180 | Ga0157376_10108399 | 3300014969 | Bacteria | 2440 |
| 181 | Ga0157376_10613890 | 3300014969 | Bacteria | 1084 |
| 182 | Ga0157376_11484102 | 3300014969 | Bacteria | 711 |
| 183 | Ga0182006_1000955 | 3300015261 | Bacteria | 19201 |
| 184 | Ga0182006_1016469 | 3300015261 | Bacteria | 3153 |
| 185 | Ga0182006_1099154 | 3300015261 | Bacteria | 1036 |
| 186 | Ga0182006_1104965 | 3300015261 | Bacteria | 998 |
| 187 | Ga0182007_10000617 | 3300015262 | Bacteria | 20740 |
| 188 | Ga0182007_10003714 | 3300015262 | Bacteria | 7132 |
| 189 | Ga0182005_1027596 | 3300015265 | Bacteria | 1548 |
| 190 | Ga0182005_1049536 | 3300015265 | Bacteria | 1142 |
| 191 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 192 | Ga0163161_10058522 | 3300017792 | Bacteria | 2801 |
| 193 | Ga0163161_10085194 | 3300017792 | Bacteria | 2331 |
| 194 | Ga0163161_10128840 | 3300017792 | Bacteria | 1907 |
| 195 | Ga0163161_10142788 | 3300017792 | Bacteria | 1814 |
| 196 | Ga0163161_11478487 | 3300017792 | Unclassified | 596 |
| 197 | Ga0213872_10000365 | 3300021361 | Bacteria | 38169 |
| 198 | Ga0213872_10006128 | 3300021361 | Bacteria | 6079 |
| 199 | Ga0209436_105799 | 3300025208 | Bacteria | 2786 |
| 200 | Ga0209436_123283 | 3300025208 | Bacteria | 780 |
| 201 | Ga0209672_103958 | 3300025228 | Bacteria | 2887 |
| 202 | Ga0209147_102289 | 3300025229 | Bacteria | 4993 |
| 203 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 204 | Ga0207425_1000138 | 3300025245 | Bacteria | 65477 |
| 205 | Ga0207425_1003117 | 3300025245 | Bacteria | 5463 |
| 206 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 207 | Ga0209148_1002495 | 3300025254 | Bacteria | 6234 |
| 208 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 209 | Ga0209129_1002257 | 3300025258 | Bacteria | 9620 |
| 210 | Ga0209565_1000649 | 3300025263 | Bacteria | 22398 |
| 211 | Ga0209565_1002144 | 3300025263 | Bacteria | 7444 |
| 212 | Ga0209673_1001445 | 3300025273 | Bacteria | 22547 |
| 213 | Ga0209673_1001448 | 3300025273 | Bacteria | 22538 |
| 214 | Ga0209673_1089706 | 3300025273 | Bacteria | 683 |
| 215 | Ga0209130_1000222 | 3300025284 | Bacteria | 74607 |
| 216 | Ga0209130_1001231 | 3300025284 | Bacteria | 17981 |
| 217 | Ga0209130_1002576 | 3300025284 | Bacteria | 8828 |
| 218 | Ga0209675_1002241 | 3300025291 | Bacteria | 10106 |
| 219 | Ga0209675_1002494 | 3300025291 | Bacteria | 9420 |
| 220 | Ga0209675_1028618 | 3300025291 | Bacteria | 1352 |
| 221 | Ga0209675_1029948 | 3300025291 | Bacteria | 1304 |
| 222 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 223 | Ga0209676_1001320 | 3300025292 | Bacteria | 25099 |
| 224 | Ga0209676_1001396 | 3300025292 | Bacteria | 23358 |
| 225 | Ga0209676_1008874 | 3300025292 | Bacteria | 4419 |
| 226 | Ga0209676_1043989 | 3300025292 | Bacteria | 1228 |
| 227 | Ga0209676_1056145 | 3300025292 | Bacteria | 1004 |
| 228 | Ga0209025_1000096 | 3300025294 | Bacteria | 239153 |
| 229 | Ga0209025_1000476 | 3300025294 | Bacteria | 77754 |
| 230 | Ga0209025_1016183 | 3300025294 | Bacteria | 4426 |
| 231 | Ga0209025_1039904 | 3300025294 | Bacteria | 2040 |
| 232 | Ga0209564_1000400 | 3300025295 | Bacteria | 77039 |
| 233 | Ga0209564_1001357 | 3300025295 | Bacteria | 25809 |
| 234 | Ga0209758_1000064 | 3300025297 | Bacteria | 311812 |
| 235 | Ga0209758_1013125 | 3300025297 | Bacteria | 4551 |
| 236 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 237 | Ga0209050_1002090 | 3300025298 | Bacteria | 18300 |
| 238 | Ga0209050_1019537 | 3300025298 | Bacteria | 2567 |
| 239 | Ga0209256_1000038 | 3300025299 | Bacteria | 375225 |
| 240 | Ga0209256_1000115 | 3300025299 | Bacteria | 173607 |
| 241 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 242 | Ga0207426_1000090 | 3300025302 | Bacteria | 280662 |
| 243 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 244 | Ga0209051_1000092 | 3300025303 | Bacteria | 170056 |
| 245 | Ga0209051_1000490 | 3300025303 | Bacteria | 51070 |
| 246 | Ga0209051_1000944 | 3300025303 | Bacteria | 28691 |
| 247 | Ga0209051_1008125 | 3300025303 | Bacteria | 5608 |
| 248 | Ga0209051_1089675 | 3300025303 | Bacteria | 859 |
| 249 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 250 | Ga0209257_1000508 | 3300025304 | Bacteria | 68156 |
| 251 | Ga0209257_1014189 | 3300025304 | Bacteria | 3449 |
| 252 | Ga0209257_1018534 | 3300025304 | Bacteria | 2673 |
| 253 | Ga0209257_1041264 | 3300025304 | Bacteria | 1370 |
| 254 | Ga0207656_10019771 | 3300025321 | Bacteria | 2667 |
| 255 | Ga0207656_10330909 | 3300025321 | Bacteria | 758 |
| 256 | Ga0207696_1001349 | 3300025711 | Bacteria | 13489 |
| 257 | Ga0207655_1018003 | 3300025728 | Bacteria | 3777 |
| 258 | Ga0207655_1152847 | 3300025728 | Bacteria | 728 |
| 259 | Ga0207682_10418857 | 3300025893 | Bacteria | 633 |
| 260 | Ga0207688_10789298 | 3300025901 | Bacteria | 602 |
| 261 | Ga0207680_10317254 | 3300025903 | Bacteria | 1089 |
| 262 | Ga0207645_10549202 | 3300025907 | Bacteria | 784 |
| 263 | Ga0207705_10273087 | 3300025909 | Bacteria | 1293 |
| 264 | Ga0207654_11432739 | 3300025911 | Bacteria | 504 |
| 265 | Ga0207695_10022412 | 3300025913 | Bacteria | 7169 |
| 266 | Ga0207695_10405134 | 3300025913 | Bacteria | 1248 |
| 267 | Ga0207671_10016759 | 3300025914 | Bacteria | 5682 |
| 268 | Ga0207663_11224479 | 3300025916 | Bacteria | 604 |
| 269 | Ga0207657_10145664 | 3300025919 | Bacteria | 1932 |
| 270 | Ga0207681_10275401 | 3300025923 | Bacteria | 1323 |
| 271 | Ga0207681_10499487 | 3300025923 | Bacteria | 996 |
| 272 | Ga0207694_10000286 | 3300025924 | Bacteria | 47592 |
| 273 | Ga0207694_10214173 | 3300025924 | Bacteria | 1570 |
| 274 | Ga0207694_10769101 | 3300025924 | Bacteria | 813 |
| 275 | Ga0207694_11891379 | 3300025924 | Unclassified | 501 |
| 276 | Ga0207650_10448127 | 3300025925 | Bacteria | 1074 |
| 277 | Ga0207659_10083753 | 3300025926 | Bacteria | 2365 |
| 278 | Ga0207687_10530706 | 3300025927 | Bacteria | 985 |
| 279 | Ga0207690_10031808 | 3300025932 | Bacteria | 3380 |
| 280 | Ga0207706_10088954 | 3300025933 | Bacteria | 2715 |
| 281 | Ga0207686_10271816 | 3300025934 | Bacteria | 1247 |
| 282 | Ga0207709_10000165 | 3300025935 | Bacteria | 90586 |
| 283 | Ga0207709_10000785 | 3300025935 | Bacteria | 24867 |
| 284 | Ga0207709_10001556 | 3300025935 | Bacteria | 15728 |
| 285 | Ga0207709_10036159 | 3300025935 | Bacteria | 2926 |
| 286 | Ga0207709_10987384 | 3300025935 | Bacteria | 688 |
| 287 | Ga0207669_10104817 | 3300025937 | Bacteria | 1879 |
| 288 | Ga0207669_11283052 | 3300025937 | Bacteria | 622 |
| 289 | Ga0207704_10464657 | 3300025938 | Bacteria | 1013 |
| 290 | Ga0207704_10612965 | 3300025938 | Bacteria | 892 |
| 291 | Ga0207691_10116568 | 3300025940 | Bacteria | 2370 |
| 292 | Ga0207691_10511664 | 3300025940 | Bacteria | 1019 |
| 293 | Ga0207711_11823222 | 3300025941 | Bacteria | 551 |
| 294 | Ga0207689_10289125 | 3300025942 | Bacteria | 1358 |
| 295 | Ga0207679_10048660 | 3300025945 | Bacteria | 3088 |
| 296 | Ga0207651_10093314 | 3300025960 | Bacteria | 2210 |
| 297 | Ga0207712_10592789 | 3300025961 | Bacteria | 958 |
| 298 | Ga0207712_11118598 | 3300025961 | Bacteria | 701 |
| 299 | Ga0207668_10297978 | 3300025972 | Bacteria | 1330 |
| 300 | Ga0207668_10404364 | 3300025972 | Bacteria | 1155 |
| 301 | Ga0207640_10028597 | 3300025981 | Bacteria | 3410 |
| 302 | Ga0207640_10531019 | 3300025981 | Bacteria | 985 |
| 303 | Ga0207658_10224090 | 3300025986 | Bacteria | 1583 |
| 304 | Ga0207639_10004693 | 3300026041 | Bacteria | 9197 |
| 305 | Ga0207639_10084577 | 3300026041 | Bacteria | 2521 |
| 306 | Ga0207639_10916502 | 3300026041 | Bacteria | 819 |
| 307 | Ga0207639_12229242 | 3300026041 | Bacteria | 509 |
| 308 | Ga0207678_11632663 | 3300026067 | Bacteria | 567 |
| 309 | Ga0207641_10853664 | 3300026088 | Bacteria | 903 |
| 310 | Ga0207648_10387349 | 3300026089 | Bacteria | 1265 |
| 311 | Ga0207648_10443011 | 3300026089 | Bacteria | 1182 |
| 312 | Ga0207674_10215482 | 3300026116 | Bacteria | 1869 |
| 313 | Ga0207674_10385264 | 3300026116 | Bacteria | 1355 |
| 314 | Ga0207683_10144960 | 3300026121 | Bacteria | 2141 |
| 315 | Ga0207683_10188260 | 3300026121 | Bacteria | 1873 |
| 316 | Ga0207683_10271434 | 3300026121 | Bacteria | 1549 |
| 317 | Ga0207683_10546233 | 3300026121 | Bacteria | 1071 |
| 318 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 319 | Ga0268266_10114756 | 3300028379 | Bacteria | 2390 |
| 320 | Ga0268266_10127516 | 3300028379 | Bacteria | 2272 |
| 321 | Ga0268266_11526741 | 3300028379 | Bacteria | 643 |
| 322 | Ga0268264_12530875 | 3300028381 | Bacteria | 518 |
| 323 | Ga0307515_10001264 | 3300028794 | Bacteria | 57666 |
| 324 | Ga0314311_1001570 | 3300030733 | Bacteria | 609 |
| 325 | Ga0316183_1120504 | 3300030742 | Bacteria | 655 |
| 326 | Ga0316182_1306980 | 3300030745 | Bacteria | 957 |
| 327 | Ga0265327_10000465 | 3300031251 | Bacteria | 72062 |
| 328 | Ga0265327_10022499 | 3300031251 | Bacteria | 3766 |
| 329 | Ga0265327_10135056 | 3300031251 | Bacteria | 1157 |
| 330 | Ga0307513_10277026 | 3300031456 | Bacteria | 1457 |
| 331 | Ga0307408_100013471 | 3300031548 | Bacteria | 5428 |
| 332 | Ga0307408_100044752 | 3300031548 | Bacteria | 3156 |
| 333 | Ga0307408_100143042 | 3300031548 | Bacteria | 1879 |
| 334 | Ga0307408_100573053 | 3300031548 | Bacteria | 999 |
| 335 | Ga0307514_10001952 | 3300031649 | Bacteria | 22533 |
| 336 | Ga0307405_10023219 | 3300031731 | Bacteria | 3521 |
| 337 | Ga0307405_10087425 | 3300031731 | Bacteria | 2054 |
| 338 | Ga0307405_10259331 | 3300031731 | Bacteria | 1297 |
| 339 | Ga0307405_11082653 | 3300031731 | Bacteria | 688 |
| 340 | Ga0307405_11362662 | 3300031731 | Bacteria | 619 |
| 341 | Ga0307406_10000194 | 3300031901 | Bacteria | 36252 |
| 342 | Ga0307406_10282340 | 3300031901 | Bacteria | 1267 |
| 343 | Ga0307406_11893398 | 3300031901 | Bacteria | 532 |
| 344 | Ga0307412_10005778 | 3300031911 | Bacteria | 6957 |
| 345 | Ga0307412_10015702 | 3300031911 | Bacteria | 4495 |
| 346 | Ga0307412_10298548 | 3300031911 | Bacteria | 1272 |
| 347 | Ga0307412_10737881 | 3300031911 | Bacteria | 849 |
| 348 | Ga0307416_100123854 | 3300032002 | Bacteria | 2311 |
| 349 | Ga0307416_100135504 | 3300032002 | Bacteria | 2226 |
| 350 | Ga0307416_102371027 | 3300032002 | Bacteria | 630 |
| 351 | Ga0307414_10651544 | 3300032004 | Bacteria | 949 |
| 352 | Ga0307414_11150471 | 3300032004 | Bacteria | 718 |
| 353 | Ga0307414_12229461 | 3300032004 | Bacteria | 511 |
| 354 | Ga0307411_10150192 | 3300032005 | Bacteria | 1730 |
| 355 | Ga0307411_10597496 | 3300032005 | Bacteria | 948 |
| 356 | Ga0307411_11784866 | 3300032005 | Bacteria | 571 |
| 357 | Ga0373961_0443146 | 3300035241 | Bacteria | 505 |
| 358 | Ga0373935_1095415 | 3300035692 | Bacteria | 593 |
| 359 | Ga0395899_0001705 | 3300037312 | Bacteria | 18309 |
| 360 | Ga0395900_0001713 | 3300037418 | Bacteria | 25348 |
| 361 | Ga0395898_0011212 | 3300037466 | Bacteria | 9329 |
| 362 | Ga0395905_0000144 | 3300037471 | Bacteria | 117622 |
| 363 | Ga0395905_0320914 | 3300037471 | Bacteria | 1438 |
| 364 | Ga0395905_0637097 | 3300037471 | Bacteria | 968 |
| 365 | Ga0395905_0953744 | 3300037471 | Bacteria | 761 |
| 366 | Ga0395901_0004147 | 3300038443 | Bacteria | 14621 |
| 367 | Ga0436361_0139980 | 3300039447 | Bacteria | 21951 |
| 368 | Ga0436361_0408019 | 3300039447 | Bacteria | 3912 |
| 369 | Ga0436361_0602324 | 3300039447 | Bacteria | 38715 |
| 370 | Ga0436361_1187046 | 3300039447 | Bacteria | 1772 |
| 371 | Ga0439436_0003275 | 3300041404 | Bacteria | 4911 |
| 372 | Ga0439436_0013836 | 3300041404 | Bacteria | 2438 |
| 373 | Ga0439438_001381 | 3300041405 | Bacteria | 10707 |
| 374 | Ga0439438_011801 | 3300041405 | Bacteria | 2704 |
| 375 | Ga0439439_0029943 | 3300041406 | Bacteria | 1382 |
| 376 | Ga0439447_001131 | 3300041407 | Bacteria | 9710 |
| 377 | Ga0439447_032405 | 3300041407 | Bacteria | 1306 |
| 378 | Ga0439447_051043 | 3300041407 | Bacteria | 988 |
| 379 | Ga0439461_0052777 | 3300041410 | Bacteria | 905 |
| 380 | Ga0439466_0008829 | 3300041411 | Bacteria | 3791 |
| 381 | Ga0439466_0036039 | 3300041411 | Bacteria | 1671 |
| 382 | Ga0451791_1414600 | 3300041451 | Bacteria | 557 |
| 383 | Ga0451793_0940603 | 3300041452 | Bacteria | 796 |
| 384 | Ga0451795_0585879 | 3300041456 | Bacteria | 1043 |
| 385 | Ga0451795_1554129 | 3300041456 | Bacteria | 636 |
| 386 | Ga0451807_0295848 | 3300041486 | Bacteria | 567 |
| 387 | Ga0451807_0385540 | 3300041486 | Bacteria | 546 |
| 388 | Ga0451807_2171065 | 3300041486 | Bacteria | 583 |
| 389 | Ga0451841_0777977 | 3300041498 | Bacteria | 521 |
| 390 | Ga0451853_1953379 | 3300041512 | Bacteria | 544 |
| 391 | Ga0439431_0241727 | 3300041997 | Bacteria | 534 |
| 392 | Ga0439433_0034065 | 3300041999 | Bacteria | 1171 |
| 393 | Ga0439442_031559 | 3300042002 | Bacteria | 1107 |
| 394 | Ga0439432_004127 | 3300042006 | Bacteria | 5308 |
| 395 | Ga0439432_004182 | 3300042006 | Bacteria | 5278 |
| 396 | Ga0439449_0007495 | 3300042007 | Bacteria | 4146 |
| 397 | Ga0439452_002519 | 3300042010 | Bacteria | 6738 |
| 398 | Ga0439452_008408 | 3300042010 | Bacteria | 3107 |
| 399 | Ga0439455_0175266 | 3300042012 | Bacteria | 617 |
| 400 | Ga0439462_0007505 | 3300042015 | Bacteria | 2731 |
| 401 | Ga0450911_012040 | 3300042115 | Bacteria | 1172 |
| 402 | Ga0450923_004077 | 3300042125 | Bacteria | 2268 |
| 403 | Ga0450897_002620 | 3300042128 | Bacteria | 1370 |
| 404 | Ga0450894_003677 | 3300042131 | Bacteria | 2003 |
| 405 | Ga0450896_014769 | 3300042133 | Bacteria | 1115 |
| 406 | Ga0450898_016955 | 3300042134 | Bacteria | 1248 |
| 407 | Ga0450898_018735 | 3300042134 | Bacteria | 1202 |
| 408 | Ga0450899_004960 | 3300042135 | Bacteria | 1427 |
| 409 | Ga0450906_013193 | 3300042145 | Bacteria | 1527 |
| 410 | Ga0450910_017831 | 3300042147 | Bacteria | 1058 |
| 411 | Ga0439446_0002193 | 3300042156 | Bacteria | 4652 |
| 412 | Ga0439446_0188892 | 3300042156 | Bacteria | 691 |
| 413 | Ga0450908_003708 | 3300042184 | Bacteria | 2963 |
| 414 | Ga0450909_001072 | 3300042185 | Bacteria | 3767 |
| 415 | Ga0439434_0001685 | 3300042435 | Bacteria | 6404 |
| 416 | Ga0439434_0001880 | 3300042435 | Bacteria | 6104 |
| 417 | Ga0450893_0019801 | 3300042532 | Bacteria | 1153 |
| 418 | Ga0466970_0001601 | 3300044765 | Bacteria | 10920 |
| 419 | Ga0466957_0012882 | 3300044842 | Bacteria | 4847 |
| 420 | Ga0466957_0301481 | 3300044842 | Bacteria | 1077 |
| 421 | Ga0466960_0077707 | 3300044901 | Bacteria | 1665 |
| 422 | Ga0466959_0026452 | 3300045049 | Bacteria | 4300 |
| 423 | Ga0495627_057006 | 3300046453 | Bacteria | 1163 |
| 424 | Ga0495592_0879393 | 3300046454 | Bacteria | 528 |
| 425 | Ga0495603_0586667 | 3300046455 | Bacteria | 638 |
| 426 | Ga0495629_0071622 | 3300046459 | Bacteria | 2419 |
| 427 | Ga0495629_0319809 | 3300046459 | Bacteria | 1061 |
| 428 | Ga0495638_0130536 | 3300046460 | Bacteria | 1476 |
| 429 | Ga0495651_0244418 | 3300046462 | Bacteria | 1229 |
| 430 | Ga0495650_0019956 | 3300046471 | Bacteria | 3281 |
| 431 | Ga0495582_0349743 | 3300046473 | Bacteria | 851 |
| 432 | Ga0495639_0002606 | 3300046475 | Bacteria | 7848 |
| 433 | Ga0495607_0031268 | 3300046501 | Bacteria | 3259 |
| 434 | Ga0495606_0117860 | 3300046507 | Bacteria | 1593 |
| 435 | Ga0495608_0344204 | 3300046511 | Bacteria | 918 |
| 436 | Ga0495610_0034593 | 3300046512 | Bacteria | 2601 |
| 437 | Ga0495616_0022482 | 3300046513 | Bacteria | 3406 |
| 438 | Ga0495618_0362552 | 3300046514 | Bacteria | 892 |
| 439 | Ga0495618_0404188 | 3300046514 | Bacteria | 835 |
| 440 | Ga0495620_0188437 | 3300046515 | Bacteria | 796 |
| 441 | Ga0495628_0276025 | 3300046516 | Bacteria | 1249 |
| 442 | Ga0495631_0004180 | 3300046518 | Bacteria | 7726 |
| 443 | Ga0495632_0001429 | 3300046519 | Bacteria | 19891 |
| 444 | Ga0495643_0002080 | 3300046522 | Bacteria | 16559 |
| 445 | Ga0495644_0354482 | 3300046523 | Bacteria | 578 |
| 446 | Ga0495663_0083933 | 3300046525 | Bacteria | 1029 |
| 447 | Ga0495666_0162654 | 3300046526 | Bacteria | 1035 |
| 448 | Ga0495642_0259121 | 3300046528 | Bacteria | 760 |
| 449 | Ga0495652_0504102 | 3300046529 | Bacteria | 839 |
| 450 | Ga0495654_0000307 | 3300046530 | Bacteria | 43179 |
| 451 | Ga0495654_0108283 | 3300046530 | Bacteria | 1270 |
| 452 | Ga0495640_0139290 | 3300046533 | Bacteria | 1565 |
| 453 | Ga0495586_0163708 | 3300046535 | Bacteria | 1255 |
| 454 | Ga0495587_0437486 | 3300046536 | Bacteria | 725 |
| 455 | Ga0495621_0008890 | 3300046539 | Bacteria | 3028 |
| 456 | Ga0495621_0064111 | 3300046539 | Bacteria | 1340 |
| 457 | Ga0495621_0502267 | 3300046539 | Bacteria | 523 |
| 458 | Ga0495622_0247180 | 3300046557 | Bacteria | 785 |
| 459 | Ga0495622_0427722 | 3300046557 | Bacteria | 569 |
| 460 | Ga0495656_0006966 | 3300046615 | Bacteria | 3979 |
| 461 | Ga0495656_0650503 | 3300046615 | Bacteria | 566 |
| 462 | Ga0495625_0239607 | 3300046660 | Bacteria | 1181 |
| 463 | Ga0495635_0165803 | 3300046663 | Bacteria | 1503 |
| 464 | Ga0495635_0271597 | 3300046663 | Bacteria | 1140 |
| 465 | Ga0495659_0223485 | 3300046664 | Bacteria | 778 |
| 466 | Ga0495661_0001352 | 3300046665 | Bacteria | 20780 |
| 467 | Ga0495588_0123969 | 3300046674 | Bacteria | 1362 |
| 468 | Ga0495588_0189141 | 3300046674 | Bacteria | 1087 |
| 469 | Ga0495588_0382270 | 3300046674 | Bacteria | 739 |
| 470 | Ga0495657_0419608 | 3300046675 | Bacteria | 786 |
| 471 | Ga0495599_0312125 | 3300046678 | Bacteria | 948 |
| 472 | Ga0495623_0609066 | 3300046679 | Bacteria | 567 |
| 473 | Ga0495658_0265295 | 3300046683 | Bacteria | 1081 |
| 474 | Ga0495624_0278647 | 3300046690 | Bacteria | 1010 |
| 475 | Ga0495624_0335929 | 3300046690 | Bacteria | 909 |
| 476 | Ga0495670_0022371 | 3300046691 | Bacteria | 3122 |
| 477 | Ga0495670_0025111 | 3300046691 | Bacteria | 2947 |
| 478 | Ga0495670_0205712 | 3300046691 | Bacteria | 1043 |
| 479 | Ga0495671_0093915 | 3300046692 | Bacteria | 1468 |
| 480 | Ga0495600_0051794 | 3300046809 | Bacteria | 2680 |
| 481 | Ga0495600_0579526 | 3300046809 | Bacteria | 683 |
| 482 | Ga0495600_0680218 | 3300046809 | Bacteria | 620 |
| 483 | Ga0495604_0709894 | 3300047317 | Bacteria | 638 |
| 484 | Ga0495672_0107161 | 3300047320 | Bacteria | 1505 |
| 485 | Ga0495676_0231657 | 3300047321 | Bacteria | 1268 |
| 486 | Ga0495676_0317534 | 3300047321 | Bacteria | 1047 |
| 487 | Ga0495680_0690500 | 3300047322 | Bacteria | 675 |
| 488 | Ga0495677_0004045 | 3300047445 | Bacteria | 5659 |
| 489 | Ga0495686_0478029 | 3300047472 | Bacteria | 659 |
| 490 | Ga0495593_0079212 | 3300047673 | Bacteria | 1700 |
| 491 | Ga0495602_0795634 | 3300048088 | Bacteria | 635 |
| 492 | Ga0495614_0143376 | 3300048089 | Bacteria | 1062 |
| 493 | Ga0495615_0002030 | 3300048090 | Bacteria | 3155 |
| 494 | Ga0495626_0002678 | 3300048091 | Bacteria | 12044 |
| 495 | Ga0496100_0014235 | 3300048903 | Bacteria | 4613 |
| 496 | Ga0496101_0004822 | 3300048904 | Bacteria | 8557 |
| 497 | Ga0496102_0027383 | 3300048905 | Bacteria | 5090 |
| 498 | Ga0496102_0195534 | 3300048905 | Bacteria | 1906 |
| 499 | Ga0496103_0026228 | 3300048906 | Bacteria | 3528 |
| 500 | Ga0496104_0027034 | 3300048907 | Bacteria | 5305 |
| 501 | Ga0496105_0001248 | 3300048908 | Bacteria | 17765 |
| 502 | Ga0496105_1116673 | 3300048908 | Bacteria | 584 |
| 503 | Ga0496106_0218221 | 3300048909 | Bacteria | 1520 |
| 504 | Ga0496106_0563630 | 3300048909 | Bacteria | 914 |
| 505 | Ga0496107_0023692 | 3300048910 | Bacteria | 4339 |
| 506 | Ga0496107_0846812 | 3300048910 | Bacteria | 668 |
| 507 | Ga0496108_0184649 | 3300048911 | Bacteria | 1806 |
| 508 | Ga0496109_0060743 | 3300048912 | Bacteria | 3454 |
| 509 | Ga0496110_0343761 | 3300048913 | Bacteria | 1359 |
| 510 | Ga0496110_0492361 | 3300048913 | Bacteria | 1116 |
| 511 | Ga0496110_0561720 | 3300048913 | Bacteria | 1037 |
| 512 | Ga0496110_1412608 | 3300048913 | Bacteria | 605 |
| 513 | Ga0496111_0087566 | 3300048914 | Bacteria | 2279 |
| 514 | Ga0496111_0714059 | 3300048914 | Bacteria | 728 |
| 515 | Ga0496114_0192344 | 3300048917 | Bacteria | 1785 |
| 516 | Ga0496114_1119673 | 3300048917 | Bacteria | 672 |
| 517 | Ga0496115_1030729 | 3300048918 | Bacteria | 627 |
| 518 | Ga0496116_0014246 | 3300048919 | Bacteria | 6360 |
| 519 | Ga0496116_0030472 | 3300048919 | Bacteria | 3874 |
| 520 | Ga0496117_0035438 | 3300048920 | Bacteria | 3745 |
| 521 | Ga0496117_0037362 | 3300048920 | Bacteria | 3619 |
| 522 | Ga0496117_0256910 | 3300048920 | Bacteria | 949 |
| 523 | Ga0496118_0041873 | 3300048921 | Bacteria | 3620 |
| 524 | Ga0496118_0141949 | 3300048921 | Bacteria | 1520 |
| 525 | Ga0496120_0187145 | 3300048923 | Bacteria | 1012 |
| 526 | Ga0496121_0042532 | 3300048924 | Bacteria | 3949 |
| 527 | Ga0496121_0046495 | 3300048924 | Bacteria | 3714 |
| 528 | Ga0496121_0081078 | 3300048924 | Bacteria | 2570 |
| 529 | Ga0496121_0128980 | 3300048924 | Bacteria | 1896 |
| 530 | Ga0496122_0081081 | 3300048925 | Bacteria | 2260 |
| 531 | Ga0496122_0182470 | 3300048925 | Bacteria | 1250 |
| 532 | Ga0496122_0251477 | 3300048925 | Bacteria | 988 |
| 533 | Ga0496122_0281222 | 3300048925 | Bacteria | 909 |
| 534 | Ga0496122_0387402 | 3300048925 | Bacteria | 715 |
| 535 | Ga0496123_0061048 | 3300048926 | Bacteria | 2426 |
| 536 | Ga0496123_0134951 | 3300048926 | Bacteria | 1360 |
| 537 | Ga0496123_0158164 | 3300048926 | Bacteria | 1212 |
| 538 | Ga0496123_0197740 | 3300048926 | Bacteria | 1033 |
| 539 | Ga0496123_0422433 | 3300048926 | Bacteria | 601 |
| 540 | Ga0496124_0126873 | 3300048927 | Bacteria | 2031 |
| 541 | Ga0496124_0136856 | 3300048927 | Bacteria | 1938 |
| 542 | Ga0496124_0205958 | 3300048927 | Bacteria | 1492 |
| 543 | Ga0496125_0023627 | 3300048928 | Bacteria | 5669 |
| 544 | Ga0496125_0087011 | 3300048928 | Bacteria | 2361 |
| 545 | Ga0496125_0245385 | 3300048928 | Bacteria | 1134 |
| 546 | Ga0496125_0271219 | 3300048928 | Bacteria | 1057 |
| 547 | Ga0496125_0280281 | 3300048928 | Bacteria | 1033 |
| 548 | Ga0496125_0351585 | 3300048928 | Bacteria | 880 |
| 549 | Ga0496126_0068212 | 3300048929 | Bacteria | 3176 |
| 550 | Ga0496126_0255434 | 3300048929 | Bacteria | 1459 |
| 551 | Ga0496126_0266135 | 3300048929 | Bacteria | 1424 |
| 552 | Ga0496126_0470131 | 3300048929 | Bacteria | 1009 |
| 553 | Ga0501032_0020271 | 3300049569 | Bacteria | 4634 |
| 554 | Ga0501034_0081791 | 3300049571 | Bacteria | 3232 |
| 555 | Ga0501037_0206066 | 3300049573 | Bacteria | 1388 |
| 556 | Ga0501039_0054624 | 3300049575 | Bacteria | 3092 |
| 557 | nmdc:mga03683_13376_c1 | 3300050489 | Bacteria | 3019 |
| 558 | nmdc:mga03683_18969_c1 | 3300050489 | Bacteria | 2621 |
| 559 | nmdc:mga03n38_54909_c1 | 3300050490 | Bacteria | 1792 |
| 560 | nmdc:mga0k408_212978_c1 | 3300050493 | Bacteria | 1154 |
| 561 | nmdc:mga0k408_814591_c1 | 3300050493 | Bacteria | 544 |
| 562 | nmdc:mga07m45_14964_c1 | 3300050496 | Bacteria | 4141 |
| 563 | nmdc:mga07m45_275492_c1 | 3300050496 | Bacteria | 979 |
| 564 | nmdc:mga07m45_341351_c1 | 3300050496 | Bacteria | 870 |
| 565 | nmdc:mga07m45_590719_c1 | 3300050496 | Bacteria | 641 |
| 566 | nmdc:mga07m45_87206_c1 | 3300050496 | Bacteria | 1786 |
| 567 | nmdc:mga07m45_875220_c1 | 3300050496 | Bacteria | 514 |
| 568 | Ga0495612_0231383 | 3300053078 | Bacteria | 820 |
| 569 | Ga0500635_0357873 | 3300053080 | Bacteria | 578 |
| 570 | Ga0500578_0719592 | 3300053086 | Bacteria | 535 |
| 571 | Ga0500643_004493 | 3300053087 | Bacteria | 6286 |
| 572 | Ga0500644_0034887 | 3300053088 | Bacteria | 1626 |
| 573 | Ga0500646_0332937 | 3300053090 | Bacteria | 550 |
| 574 | Ga0500651_0000038 | 3300053093 | Bacteria | 101707 |
| 575 | Ga0500562_015907 | 3300053108 | Bacteria | 1932 |
| 576 | Ga0500571_000054 | 3300053110 | Bacteria | 35459 |
| 577 | Ga0500594_0022279 | 3300053118 | Bacteria | 1596 |
| 578 | Ga0500597_014935 | 3300053120 | Bacteria | 2924 |
| 579 | Ga0500607_060588 | 3300053121 | Bacteria | 1984 |
| 580 | Ga0500608_082273 | 3300053122 | Bacteria | 1517 |
| 581 | Ga0500614_217130 | 3300053123 | Bacteria | 592 |
| 582 | Ga0500618_039485 | 3300053125 | Bacteria | 1087 |
| 583 | Ga0500626_019208 | 3300053128 | Bacteria | 3030 |
| 584 | Ga0500655_000123 | 3300053133 | Bacteria | 19862 |
| 585 | Ga0500658_0000237 | 3300053134 | Bacteria | 25766 |
| 586 | Ga0500658_0000266 | 3300053134 | Bacteria | 23921 |
| 587 | Ga0500559_0008198 | 3300053136 | Bacteria | 4594 |
| 588 | Ga0500564_024230 | 3300053138 | Bacteria | 2785 |
| 589 | Ga0500568_0049520 | 3300053139 | Bacteria | 1657 |
| 590 | Ga0500574_027974 | 3300053141 | Bacteria | 1491 |
| 591 | Ga0500577_0395232 | 3300053142 | Bacteria | 605 |
| 592 | Ga0500604_0177287 | 3300053151 | Bacteria | 730 |
| 593 | Ga0500616_0030516 | 3300053153 | Bacteria | 2960 |
| 594 | Ga0500616_0037987 | 3300053153 | Bacteria | 2603 |
| 595 | Ga0500619_134753 | 3300053154 | Bacteria | 842 |
| 596 | Ga0500638_015691 | 3300053162 | Bacteria | 3481 |
| 597 | Ga0500636_0254058 | 3300053177 | Bacteria | 894 |
| 598 | Ga0500609_052525 | 3300053731 | Bacteria | 567 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2599185214 | 2599624721 | 70 |
| 2 | iso_pu_bacteria | 2599185226 | 2599672417 | 70 |
| 3 | iso_pu_bacteria | 2599185227 | 2599685001 | 70 |
| 4 | iso_pu_bacteria | 2599185229 | 2599694026 | 70 |
| 5 | iso_pu_bacteria | 2818991446 | 2819596099 | 70 |
| 6 | iso_pu_bacteria | 2831265667 | 2831270589 | 70 |
| 7 | iso_pu_bacteria | 2838054893 | 2838056813 | 70 |
| 8 | iso_pu_bacteria | 2857537821 | 2857541983 | 70 |
| 9 | iso_pu_bacteria | 2885198086 | 2885201160 | 70 |
| 10 | iso_pu_bacteria | 2885211737 | 2885214800 | 70 |
| 11 | iso_pu_bacteria | 2899924645 | 2899925450 | 70 |
| 12 | iso_pu_bacteria | 2928037797 | 2928038435 | 70 |
| 13 | iso_pu_bacteria | 2928044640 | 2928045959 | 70 |
| 14 | iso_pu_bacteria | 2928051484 | 2928053640 | 70 |
| 15 | iso_pu_bacteria | 2928064002 | 2928067187 | 70 |
| 16 | iso_pu_bacteria | 2928070936 | 2928076149 | 70 |
| 17 | iso_pu_bacteria | 2928084124 | 2928085132 | 70 |
| 18 | 3300046501 | Ga0495607_0031268 | Ga0495607_0031268_1627_1848 | 71 |
| 19 | 3300046519 | Ga0495632_0001429 | Ga0495632_0001429_9588_9812 | 71 |
| 20 | 3300046522 | Ga0495643_0002080 | Ga0495643_0002080_2295_2519 | 71 |
| 21 | 3300046665 | Ga0495661_0001352 | Ga0495661_0001352_3840_4061 | 71 |
| 22 | 3300047320 | Ga0495672_0107161 | Ga0495672_0107161_924_1181 | 71 |
| 23 | 3300047445 | Ga0495677_0004045 | Ga0495677_0004045_2422_2646 | 71 |
| 24 | 3300048091 | Ga0495626_0002678 | Ga0495626_0002678_4074_4298 | 71 |
| 25 | 3300048929 | Ga0496126_0068212 | Ga0496126_0068212_2818_3036 | 71 |
| 26 | 3300048929 | Ga0496126_0266135 | Ga0496126_0266135_98_316 | 71 |
| 27 | 3300003316 | rootH1_10023287 | rootH1_100232872 | 72 |
| 28 | 3300003762 | Ga0055542_1004738 | Ga0055542_10047383 | 72 |
| 29 | 3300003781 | Ga0055536_1050417 | Ga0055536_10504172 | 72 |
| 30 | 3300005327 | Ga0070658_10293938 | Ga0070658_102939382 | 72 |
| 31 | 3300005331 | Ga0070670_100816493 | Ga0070670_1008164932 | 72 |
| 32 | 3300005333 | Ga0070677_10545674 | Ga0070677_105456741 | 72 |
| 33 | 3300005339 | Ga0070660_100722101 | Ga0070660_1007221012 | 72 |
| 34 | 3300005347 | Ga0070668_100756240 | Ga0070668_1007562402 | 72 |
| 35 | 3300005353 | Ga0070669_101521397 | Ga0070669_1015213971 | 72 |
| 36 | 3300005354 | Ga0070675_101623028 | Ga0070675_1016230281 | 72 |
| 37 | 3300005355 | Ga0070671_100659816 | Ga0070671_1006598162 | 72 |
| 38 | 3300005356 | Ga0070674_102206699 | Ga0070674_1022066991 | 72 |
| 39 | 3300005364 | Ga0070673_100391687 | Ga0070673_1003916872 | 72 |
| 40 | 3300005364 | Ga0070673_101996013 | Ga0070673_1019960132 | 72 |
| 41 | 3300005365 | Ga0070688_101510865 | Ga0070688_1015108651 | 72 |
| 42 | 3300005367 | Ga0070667_100015926 | Ga0070667_1000159263 | 72 |
| 43 | 3300005367 | Ga0070667_101401403 | Ga0070667_1014014031 | 72 |
| 44 | 3300005456 | Ga0070678_100664812 | Ga0070678_1006648122 | 72 |
| 45 | 3300005466 | Ga0070685_10269930 | Ga0070685_102699302 | 72 |
| 46 | 3300005543 | Ga0070672_100117095 | Ga0070672_1001170953 | 72 |
| 47 | 3300005548 | Ga0070665_100074476 | Ga0070665_1000744762 | 72 |
| 48 | 3300005548 | Ga0070665_100083840 | Ga0070665_1000838403 | 72 |
| 49 | 3300005548 | Ga0070665_101816039 | Ga0070665_1018160392 | 72 |
| 50 | 3300005563 | Ga0068855_100033501 | Ga0068855_1000335016 | 72 |
| 51 | 3300005578 | Ga0068854_100000568 | Ga0068854_1000005689 | 72 |
| 52 | 3300005616 | Ga0068852_101011222 | Ga0068852_1010112222 | 72 |
| 53 | 3300005834 | Ga0068851_10442209 | Ga0068851_104422092 | 72 |
| 54 | 3300005841 | Ga0068863_100700414 | Ga0068863_1007004142 | 72 |
| 55 | 3300005843 | Ga0068860_100333651 | Ga0068860_1003336512 | 72 |
| 56 | 3300006163 | Ga0070715_10891459 | Ga0070715_108914592 | 72 |
| 57 | 3300006237 | Ga0097621_101038054 | Ga0097621_1010380542 | 72 |
| 58 | 3300006237 | Ga0097621_101467662 | Ga0097621_1014676622 | 72 |
| 59 | 3300006237 | Ga0097621_101662662 | Ga0097621_1016626622 | 72 |
| 60 | 3300006881 | Ga0068865_101528475 | Ga0068865_1015284752 | 72 |
| 61 | 3300009036 | Ga0105244_10093926 | Ga0105244_100939262 | 72 |
| 62 | 3300009093 | Ga0105240_10665814 | Ga0105240_106658143 | 72 |
| 63 | 3300009101 | Ga0105247_11541446 | Ga0105247_115414462 | 72 |
| 64 | 3300009545 | Ga0105237_10023997 | Ga0105237_100239975 | 72 |
| 65 | 3300009551 | Ga0105238_10000065 | Ga0105238_1000006595 | 72 |
| 66 | 3300009551 | Ga0105238_10613020 | Ga0105238_106130202 | 72 |
| 67 | 3300009553 | Ga0105249_10492504 | Ga0105249_104925042 | 72 |
| 68 | 3300010375 | Ga0105239_10086610 | Ga0105239_100866104 | 72 |
| 69 | 3300013104 | Ga0157370_11047683 | Ga0157370_110476832 | 72 |
| 70 | 3300014497 | Ga0182008_10005597 | Ga0182008_100055975 | 72 |
| 71 | 3300015261 | Ga0182006_1000955 | Ga0182006_10009559 | 72 |
| 72 | 3300015261 | Ga0182006_1104965 | Ga0182006_11049652 | 72 |
| 73 | 3300015262 | Ga0182007_10000617 | Ga0182007_100006179 | 72 |
| 74 | 3300015265 | Ga0182005_1027596 | Ga0182005_10275962 | 72 |
| 75 | 3300015683 | Ga0183362_10001 | Ga0183362_100011675 | 72 |
| 76 | 3300017792 | Ga0163161_10085194 | Ga0163161_100851943 | 72 |
| 77 | 3300017792 | Ga0163161_10128840 | Ga0163161_101288402 | 72 |
| 78 | 3300017792 | Ga0163161_10142788 | Ga0163161_101427882 | 72 |
| 79 | 3300017792 | Ga0163161_11478487 | Ga0163161_114784871 | 72 |
| 80 | 3300021361 | Ga0213872_10000365 | Ga0213872_1000036516 | 72 |
| 81 | 3300021361 | Ga0213872_10006128 | Ga0213872_100061283 | 72 |
| 82 | 3300025254 | Ga0209148_1002495 | Ga0209148_10024955 | 72 |
| 83 | 3300025273 | Ga0209673_1089706 | Ga0209673_10897062 | 72 |
| 84 | 3300025284 | Ga0209130_1002576 | Ga0209130_10025765 | 72 |
| 85 | 3300025291 | Ga0209675_1028618 | Ga0209675_10286183 | 72 |
| 86 | 3300025292 | Ga0209676_1043989 | Ga0209676_10439892 | 72 |
| 87 | 3300025304 | Ga0209257_1041264 | Ga0209257_10412641 | 72 |
| 88 | 3300025321 | Ga0207656_10330909 | Ga0207656_103309092 | 72 |
| 89 | 3300025728 | Ga0207655_1152847 | Ga0207655_11528472 | 72 |
| 90 | 3300025903 | Ga0207680_10317254 | Ga0207680_103172542 | 72 |
| 91 | 3300025907 | Ga0207645_10549202 | Ga0207645_105492022 | 72 |
| 92 | 3300025909 | Ga0207705_10273087 | Ga0207705_102730872 | 72 |
| 93 | 3300025913 | Ga0207695_10022412 | Ga0207695_100224122 | 72 |
| 94 | 3300025914 | Ga0207671_10016759 | Ga0207671_100167596 | 72 |
| 95 | 3300025919 | Ga0207657_10145664 | Ga0207657_101456642 | 72 |
| 96 | 3300025923 | Ga0207681_10499487 | Ga0207681_104994872 | 72 |
| 97 | 3300025924 | Ga0207694_10000286 | Ga0207694_1000028640 | 72 |
| 98 | 3300025924 | Ga0207694_10214173 | Ga0207694_102141733 | 72 |
| 99 | 3300025924 | Ga0207694_11891379 | Ga0207694_118913792 | 72 |
| 100 | 3300025926 | Ga0207659_10083753 | Ga0207659_100837532 | 72 |
| 101 | 3300025934 | Ga0207686_10271816 | Ga0207686_102718162 | 72 |
| 102 | 3300025937 | Ga0207669_11283052 | Ga0207669_112830522 | 72 |
| 103 | 3300025938 | Ga0207704_10612965 | Ga0207704_106129652 | 72 |
| 104 | 3300025940 | Ga0207691_10116568 | Ga0207691_101165683 | 72 |
| 105 | 3300025941 | Ga0207711_11823222 | Ga0207711_118232222 | 72 |
| 106 | 3300025960 | Ga0207651_10093314 | Ga0207651_100933143 | 72 |
| 107 | 3300025961 | Ga0207712_10592789 | Ga0207712_105927892 | 72 |
| 108 | 3300025961 | Ga0207712_11118598 | Ga0207712_111185982 | 72 |
| 109 | 3300025972 | Ga0207668_10404364 | Ga0207668_104043642 | 72 |
| 110 | 3300025981 | Ga0207640_10028597 | Ga0207640_100285975 | 72 |
| 111 | 3300025986 | Ga0207658_10224090 | Ga0207658_102240902 | 72 |
| 112 | 3300026041 | Ga0207639_12229242 | Ga0207639_122292422 | 72 |
| 113 | 3300026088 | Ga0207641_10853664 | Ga0207641_108536642 | 72 |
| 114 | 3300026089 | Ga0207648_10443011 | Ga0207648_104430112 | 72 |
| 115 | 3300026121 | Ga0207683_10188260 | Ga0207683_101882602 | 72 |
| 116 | 3300026121 | Ga0207683_10546233 | Ga0207683_105462331 | 72 |
| 117 | 3300028379 | Ga0268266_10127516 | Ga0268266_101275162 | 72 |
| 118 | 3300028379 | Ga0268266_11526741 | Ga0268266_115267412 | 72 |
| 119 | 3300028381 | Ga0268264_12530875 | Ga0268264_125308752 | 72 |
| 120 | 3300031251 | Ga0265327_10000465 | Ga0265327_1000046555 | 72 |
| 121 | 3300031251 | Ga0265327_10022499 | Ga0265327_100224994 | 72 |
| 122 | 3300031251 | Ga0265327_10135056 | Ga0265327_101350562 | 72 |
| 123 | 3300031731 | Ga0307405_11362662 | Ga0307405_113626622 | 72 |
| 124 | 3300031901 | Ga0307406_11893398 | Ga0307406_118933982 | 72 |
| 125 | 3300035692 | Ga0373935_1095415 | Ga0373935_1095415_38_259 | 72 |
| 126 | 3300037471 | Ga0395905_0000144 | Ga0395905_0000144_103523_103750 | 72 |
| 127 | 3300037471 | Ga0395905_0953744 | Ga0395905_0953744_164_403 | 72 |
| 128 | 3300039447 | Ga0436361_0139980 | Ga0436361_0139980_2428_2664 | 72 |
| 129 | 3300041404 | Ga0439436_0013836 | Ga0439436_0013836_328_561 | 72 |
| 130 | 3300041405 | Ga0439438_001381 | Ga0439438_001381_4358_4591 | 72 |
| 131 | 3300041407 | Ga0439447_001131 | Ga0439447_001131_2446_2679 | 72 |
| 132 | 3300041411 | Ga0439466_0036039 | Ga0439466_0036039_404_637 | 72 |
| 133 | 3300041486 | Ga0451807_2171065 | Ga0451807_2171065_212_433 | 72 |
| 134 | 3300041512 | Ga0451853_1953379 | Ga0451853_1953379_29_250 | 72 |
| 135 | 3300042006 | Ga0439432_004182 | Ga0439432_004182_4358_4591 | 72 |
| 136 | 3300042010 | Ga0439452_002519 | Ga0439452_002519_1521_1754 | 72 |
| 137 | 3300042115 | Ga0450911_012040 | Ga0450911_012040_691_924 | 72 |
| 138 | 3300042156 | Ga0439446_0002193 | Ga0439446_0002193_1826_2059 | 72 |
| 139 | 3300042435 | Ga0439434_0001685 | Ga0439434_0001685_2130_2363 | 72 |
| 140 | 3300044765 | Ga0466970_0001601 | Ga0466970_0001601_7213_7443 | 72 |
| 141 | 3300044842 | Ga0466957_0012882 | Ga0466957_0012882_1410_1628 | 72 |
| 142 | 3300045049 | Ga0466959_0026452 | Ga0466959_0026452_561_791 | 72 |
| 143 | 3300046471 | Ga0495650_0019956 | Ga0495650_0019956_2394_2621 | 72 |
| 144 | 3300046514 | Ga0495618_0362552 | Ga0495618_0362552_639_857 | 72 |
| 145 | 3300046529 | Ga0495652_0504102 | Ga0495652_0504102_347_580 | 72 |
| 146 | 3300046664 | Ga0495659_0223485 | Ga0495659_0223485_392_616 | 72 |
| 147 | 3300046675 | Ga0495657_0419608 | Ga0495657_0419608_46_264 | 72 |
| 148 | 3300046678 | Ga0495599_0312125 | Ga0495599_0312125_523_741 | 72 |
| 149 | 3300046809 | Ga0495600_0579526 | Ga0495600_0579526_275_493 | 72 |
| 150 | 3300046809 | Ga0495600_0680218 | Ga0495600_0680218_330_548 | 72 |
| 151 | 3300048924 | Ga0496121_0081078 | Ga0496121_0081078_1367_1603 | 72 |
| 152 | 3300048926 | Ga0496123_0422433 | Ga0496123_0422433_123_359 | 72 |
| 153 | 3300048929 | Ga0496126_0255434 | Ga0496126_0255434_207_428 | 72 |
| 154 | 3300049569 | Ga0501032_0020271 | Ga0501032_0020271_2015_2248 | 72 |
| 155 | 3300049571 | Ga0501034_0081791 | Ga0501034_0081791_67_300 | 72 |
| 156 | 3300049573 | Ga0501037_0206066 | Ga0501037_0206066_525_758 | 72 |
| 157 | 3300049575 | Ga0501039_0054624 | Ga0501039_0054624_107_340 | 72 |
| 158 | 3300053080 | Ga0500635_0357873 | Ga0500635_0357873_195_416 | 72 |
| 159 | 3300053142 | Ga0500577_0395232 | Ga0500577_0395232_271_489 | 72 |
| 160 | 3300053151 | Ga0500604_0177287 | Ga0500604_0177287_255_476 | 72 |
| 161 | 3300053731 | Ga0500609_052525 | Ga0500609_052525_300_521 | 72 |
| 162 | iso_pu_bacteria | 2511231026 | 2511383270 | 72 |
| 163 | iso_pu_bacteria | 2521172590 | 2521557417 | 72 |
| 164 | iso_pu_bacteria | 2551306416 | 2553005235 | 72 |
| 165 | iso_pu_bacteria | 2839094727 | 2839098841 | 72 |
| 166 | iso_pu_bacteria | 2904439833 | 2904439844 | 72 |
| 167 | iso_pu_bacteria | 2904530477 | 2904531204 | 72 |
| 168 | iso_pu_bacteria | 2904584206 | 2904587141 | 72 |
| 169 | iso_pu_bacteria | 2904589729 | 2904592825 | 72 |
| 170 | iso_pu_bacteria | 2904601388 | 2904604402 | 72 |
| 171 | iso_pu_bacteria | 2919046199 | 2919050161 | 72 |
| 172 | iso_pu_bacteria | 2919079590 | 2919082214 | 72 |
| 173 | iso_pu_bacteria | 2923510766 | 2923516080 | 72 |
| 174 | 3300003578 | Ga0006562J51391_1118556 | Ga0006562J51391_11185562 | 73 |
| 175 | 3300003578 | Ga0006562J51391_1118558 | Ga0006562J51391_11185582 | 73 |
| 176 | 3300003781 | Ga0055536_1009558 | Ga0055536_10095582 | 73 |
| 177 | 3300003791 | Ga0055530_10013054 | Ga0055530_100130542 | 73 |
| 178 | 3300003792 | Ga0055540_1002232 | Ga0055540_100223211 | 73 |
| 179 | 3300003792 | Ga0055540_1009260 | Ga0055540_10092602 | 73 |
| 180 | 3300003792 | Ga0055540_1010547 | Ga0055540_10105474 | 73 |
| 181 | 3300003794 | Ga0055531_10006424 | Ga0055531_100064242 | 73 |
| 182 | 3300003794 | Ga0055531_10065334 | Ga0055531_100653341 | 73 |
| 183 | 3300005288 | Ga0065714_10099269 | Ga0065714_100992691 | 73 |
| 184 | 3300005288 | Ga0065714_10218370 | Ga0065714_102183702 | 73 |
| 185 | 3300005289 | Ga0065704_10155066 | Ga0065704_101550662 | 73 |
| 186 | 3300005339 | Ga0070660_101246555 | Ga0070660_1012465551 | 73 |
| 187 | 3300005366 | Ga0070659_100052983 | Ga0070659_1000529831 | 73 |
| 188 | 3300005445 | Ga0070708_100535277 | Ga0070708_1005352772 | 73 |
| 189 | 3300005457 | Ga0070662_100018544 | Ga0070662_1000185444 | 73 |
| 190 | 3300005539 | Ga0068853_100078751 | Ga0068853_1000787512 | 73 |
| 191 | 3300005564 | Ga0070664_100267954 | Ga0070664_1002679542 | 73 |
| 192 | 3300005577 | Ga0068857_100141486 | Ga0068857_1001414862 | 73 |
| 193 | 3300005578 | Ga0068854_102220245 | Ga0068854_1022202452 | 73 |
| 194 | 3300005834 | Ga0068851_10482818 | Ga0068851_104828181 | 73 |
| 195 | 3300005840 | Ga0068870_10455324 | Ga0068870_104553242 | 73 |
| 196 | 3300006042 | Ga0075368_10119415 | Ga0075368_101194151 | 73 |
| 197 | 3300006048 | Ga0075363_100291663 | Ga0075363_1002916632 | 73 |
| 198 | 3300006048 | Ga0075363_100464406 | Ga0075363_1004644062 | 73 |
| 199 | 3300006058 | Ga0075432_10013889 | Ga0075432_100138892 | 73 |
| 200 | 3300006177 | Ga0075362_10045591 | Ga0075362_100455912 | 73 |
| 201 | 3300006178 | Ga0075367_10217421 | Ga0075367_102174212 | 73 |
| 202 | 3300006186 | Ga0075369_10027031 | Ga0075369_100270312 | 73 |
| 203 | 3300006195 | Ga0075366_10092471 | Ga0075366_100924713 | 73 |
| 204 | 3300006195 | Ga0075366_10596656 | Ga0075366_105966561 | 73 |
| 205 | 3300006353 | Ga0075370_10002278 | Ga0075370_100022785 | 73 |
| 206 | 3300006353 | Ga0075370_10011877 | Ga0075370_100118772 | 73 |
| 207 | 3300006353 | Ga0075370_10725932 | Ga0075370_107259322 | 73 |
| 208 | 3300006358 | Ga0068871_101769182 | Ga0068871_1017691821 | 73 |
| 209 | 3300006881 | Ga0068865_100327046 | Ga0068865_1003270462 | 73 |
| 210 | 3300006946 | Ga0079104_1000226 | Ga0079104_10002268 | 73 |
| 211 | 3300009036 | Ga0105244_10001011 | Ga0105244_1000101116 | 73 |
| 212 | 3300009092 | Ga0105250_10000526 | Ga0105250_1000052618 | 73 |
| 213 | 3300009098 | Ga0105245_10541256 | Ga0105245_105412562 | 73 |
| 214 | 3300009148 | Ga0105243_10002414 | Ga0105243_1000241415 | 73 |
| 215 | 3300009148 | Ga0105243_10007533 | Ga0105243_100075335 | 73 |
| 216 | 3300009148 | Ga0105243_10011391 | Ga0105243_100113913 | 73 |
| 217 | 3300009174 | Ga0105241_10212738 | Ga0105241_102127382 | 73 |
| 218 | 3300009176 | Ga0105242_10375552 | Ga0105242_103755522 | 73 |
| 219 | 3300009545 | Ga0105237_11023700 | Ga0105237_110237002 | 73 |
| 220 | 3300009551 | Ga0105238_10413950 | Ga0105238_104139502 | 73 |
| 221 | 3300011119 | Ga0105246_10243772 | Ga0105246_102437722 | 73 |
| 222 | 3300012478 | Ga0157328_1007993 | Ga0157328_10079932 | 73 |
| 223 | 3300013100 | Ga0157373_10039688 | Ga0157373_100396884 | 73 |
| 224 | 3300013100 | Ga0157373_10135247 | Ga0157373_101352473 | 73 |
| 225 | 3300013102 | Ga0157371_10591359 | Ga0157371_105913591 | 73 |
| 226 | 3300013104 | Ga0157370_10111341 | Ga0157370_101113413 | 73 |
| 227 | 3300013105 | Ga0157369_10451678 | Ga0157369_104516782 | 73 |
| 228 | 3300013306 | Ga0163162_10655089 | Ga0163162_106550892 | 73 |
| 229 | 3300014497 | Ga0182008_10013054 | Ga0182008_100130542 | 73 |
| 230 | 3300014497 | Ga0182008_10098018 | Ga0182008_100980182 | 73 |
| 231 | 3300014497 | Ga0182008_10100052 | Ga0182008_101000522 | 73 |
| 232 | 3300014969 | Ga0157376_10108399 | Ga0157376_101083993 | 73 |
| 233 | 3300015261 | Ga0182006_1016469 | Ga0182006_10164694 | 73 |
| 234 | 3300015261 | Ga0182006_1099154 | Ga0182006_10991542 | 73 |
| 235 | 3300015262 | Ga0182007_10003714 | Ga0182007_100037145 | 73 |
| 236 | 3300015265 | Ga0182005_1049536 | Ga0182005_10495362 | 73 |
| 237 | 3300025292 | Ga0209676_1001320 | Ga0209676_10013206 | 73 |
| 238 | 3300025292 | Ga0209676_1001396 | Ga0209676_10013967 | 73 |
| 239 | 3300025294 | Ga0209025_1000096 | Ga0209025_100009634 | 73 |
| 240 | 3300025298 | Ga0209050_1002090 | Ga0209050_10020904 | 73 |
| 241 | 3300025303 | Ga0209051_1000092 | Ga0209051_1000092142 | 73 |
| 242 | 3300025303 | Ga0209051_1000490 | Ga0209051_100049043 | 73 |
| 243 | 3300025303 | Ga0209051_1000944 | Ga0209051_10009447 | 73 |
| 244 | 3300025304 | Ga0209257_1000508 | Ga0209257_100050853 | 73 |
| 245 | 3300025304 | Ga0209257_1018534 | Ga0209257_10185343 | 73 |
| 246 | 3300025711 | Ga0207696_1001349 | Ga0207696_100134910 | 73 |
| 247 | 3300025728 | Ga0207655_1018003 | Ga0207655_10180032 | 73 |
| 248 | 3300025901 | Ga0207688_10789298 | Ga0207688_107892982 | 73 |
| 249 | 3300025911 | Ga0207654_11432739 | Ga0207654_114327391 | 73 |
| 250 | 3300025924 | Ga0207694_10769101 | Ga0207694_107691011 | 73 |
| 251 | 3300025925 | Ga0207650_10448127 | Ga0207650_104481272 | 73 |
| 252 | 3300025927 | Ga0207687_10530706 | Ga0207687_105307062 | 73 |
| 253 | 3300025932 | Ga0207690_10031808 | Ga0207690_100318084 | 73 |
| 254 | 3300025933 | Ga0207706_10088954 | Ga0207706_100889542 | 73 |
| 255 | 3300025935 | Ga0207709_10000165 | Ga0207709_1000016531 | 73 |
| 256 | 3300025935 | Ga0207709_10000785 | Ga0207709_100007855 | 73 |
| 257 | 3300025935 | Ga0207709_10001556 | Ga0207709_1000155614 | 73 |
| 258 | 3300025935 | Ga0207709_10036159 | Ga0207709_100361592 | 73 |
| 259 | 3300025935 | Ga0207709_10987384 | Ga0207709_109873842 | 73 |
| 260 | 3300025938 | Ga0207704_10464657 | Ga0207704_104646572 | 73 |
| 261 | 3300025942 | Ga0207689_10289125 | Ga0207689_102891252 | 73 |
| 262 | 3300025945 | Ga0207679_10048660 | Ga0207679_100486604 | 73 |
| 263 | 3300025972 | Ga0207668_10297978 | Ga0207668_102979781 | 73 |
| 264 | 3300026041 | Ga0207639_10084577 | Ga0207639_100845772 | 73 |
| 265 | 3300026041 | Ga0207639_10916502 | Ga0207639_109165022 | 73 |
| 266 | 3300026067 | Ga0207678_11632663 | Ga0207678_116326632 | 73 |
| 267 | 3300026116 | Ga0207674_10215482 | Ga0207674_102154822 | 73 |
| 268 | 3300026116 | Ga0207674_10385264 | Ga0207674_103852642 | 73 |
| 269 | 3300026121 | Ga0207683_10144960 | Ga0207683_101449602 | 73 |
| 270 | 3300027111 | Ga0209281_1000002 | Ga0209281_1000002220 | 73 |
| 271 | 3300028794 | Ga0307515_10001264 | Ga0307515_1000126443 | 73 |
| 272 | 3300030733 | Ga0314311_1001570 | Ga0314311_10015702 | 73 |
| 273 | 3300031456 | Ga0307513_10277026 | Ga0307513_102770262 | 73 |
| 274 | 3300031548 | Ga0307408_100013471 | Ga0307408_1000134712 | 73 |
| 275 | 3300031548 | Ga0307408_100044752 | Ga0307408_1000447523 | 73 |
| 276 | 3300031548 | Ga0307408_100143042 | Ga0307408_1001430421 | 73 |
| 277 | 3300031548 | Ga0307408_100573053 | Ga0307408_1005730532 | 73 |
| 278 | 3300031649 | Ga0307514_10001952 | Ga0307514_100019526 | 73 |
| 279 | 3300031731 | Ga0307405_10023219 | Ga0307405_100232194 | 73 |
| 280 | 3300031731 | Ga0307405_10087425 | Ga0307405_100874252 | 73 |
| 281 | 3300031731 | Ga0307405_10259331 | Ga0307405_102593311 | 73 |
| 282 | 3300031731 | Ga0307405_11082653 | Ga0307405_110826532 | 73 |
| 283 | 3300031901 | Ga0307406_10000194 | Ga0307406_1000019416 | 73 |
| 284 | 3300031901 | Ga0307406_10282340 | Ga0307406_102823402 | 73 |
| 285 | 3300031911 | Ga0307412_10005778 | Ga0307412_100057783 | 73 |
| 286 | 3300031911 | Ga0307412_10015702 | Ga0307412_100157025 | 73 |
| 287 | 3300031911 | Ga0307412_10298548 | Ga0307412_102985482 | 73 |
| 288 | 3300031911 | Ga0307412_10737881 | Ga0307412_107378812 | 73 |
| 289 | 3300032002 | Ga0307416_100123854 | Ga0307416_1001238543 | 73 |
| 290 | 3300032002 | Ga0307416_100135504 | Ga0307416_1001355043 | 73 |
| 291 | 3300032002 | Ga0307416_102371027 | Ga0307416_1023710272 | 73 |
| 292 | 3300032004 | Ga0307414_10651544 | Ga0307414_106515442 | 73 |
| 293 | 3300032004 | Ga0307414_11150471 | Ga0307414_111504712 | 73 |
| 294 | 3300032004 | Ga0307414_12229461 | Ga0307414_122294611 | 73 |
| 295 | 3300032005 | Ga0307411_10150192 | Ga0307411_101501922 | 73 |
| 296 | 3300032005 | Ga0307411_10597496 | Ga0307411_105974962 | 73 |
| 297 | 3300037471 | Ga0395905_0320914 | Ga0395905_0320914_1045_1281 | 73 |
| 298 | 3300037471 | Ga0395905_0637097 | Ga0395905_0637097_673_909 | 73 |
| 299 | 3300039447 | Ga0436361_0408019 | Ga0436361_0408019_2125_2346 | 73 |
| 300 | 3300041404 | Ga0439436_0003275 | Ga0439436_0003275_1305_1526 | 73 |
| 301 | 3300041405 | Ga0439438_011801 | Ga0439438_011801_444_665 | 73 |
| 302 | 3300041406 | Ga0439439_0029943 | Ga0439439_0029943_119_340 | 73 |
| 303 | 3300041407 | Ga0439447_032405 | Ga0439447_032405_579_800 | 73 |
| 304 | 3300041407 | Ga0439447_051043 | Ga0439447_051043_496_717 | 73 |
| 305 | 3300041410 | Ga0439461_0052777 | Ga0439461_0052777_60_281 | 73 |
| 306 | 3300041411 | Ga0439466_0008829 | Ga0439466_0008829_865_1086 | 73 |
| 307 | 3300041451 | Ga0451791_1414600 | Ga0451791_1414600_75_296 | 73 |
| 308 | 3300041456 | Ga0451795_1554129 | Ga0451795_1554129_337_558 | 73 |
| 309 | 3300041486 | Ga0451807_0385540 | Ga0451807_0385540_215_439 | 73 |
| 310 | 3300041997 | Ga0439431_0241727 | Ga0439431_0241727_260_481 | 73 |
| 311 | 3300041999 | Ga0439433_0034065 | Ga0439433_0034065_461_682 | 73 |
| 312 | 3300042002 | Ga0439442_031559 | Ga0439442_031559_855_1076 | 73 |
| 313 | 3300042006 | Ga0439432_004127 | Ga0439432_004127_2919_3140 | 73 |
| 314 | 3300042007 | Ga0439449_0007495 | Ga0439449_0007495_1040_1261 | 73 |
| 315 | 3300042010 | Ga0439452_008408 | Ga0439452_008408_53_274 | 73 |
| 316 | 3300042012 | Ga0439455_0175266 | Ga0439455_0175266_53_274 | 73 |
| 317 | 3300042015 | Ga0439462_0007505 | Ga0439462_0007505_1890_2111 | 73 |
| 318 | 3300042125 | Ga0450923_004077 | Ga0450923_004077_726_947 | 73 |
| 319 | 3300042128 | Ga0450897_002620 | Ga0450897_002620_689_910 | 73 |
| 320 | 3300042131 | Ga0450894_003677 | Ga0450894_003677_1358_1579 | 73 |
| 321 | 3300042133 | Ga0450896_014769 | Ga0450896_014769_370_591 | 73 |
| 322 | 3300042134 | Ga0450898_016955 | Ga0450898_016955_599_820 | 73 |
| 323 | 3300042135 | Ga0450899_004960 | Ga0450899_004960_290_511 | 73 |
| 324 | 3300042145 | Ga0450906_013193 | Ga0450906_013193_644_865 | 73 |
| 325 | 3300042147 | Ga0450910_017831 | Ga0450910_017831_278_499 | 73 |
| 326 | 3300042156 | Ga0439446_0188892 | Ga0439446_0188892_248_469 | 73 |
| 327 | 3300042184 | Ga0450908_003708 | Ga0450908_003708_2061_2282 | 73 |
| 328 | 3300042185 | Ga0450909_001072 | Ga0450909_001072_1990_2211 | 73 |
| 329 | 3300042435 | Ga0439434_0001880 | Ga0439434_0001880_2916_3137 | 73 |
| 330 | 3300042532 | Ga0450893_0019801 | Ga0450893_0019801_517_738 | 73 |
| 331 | 3300044842 | Ga0466957_0301481 | Ga0466957_0301481_624_845 | 73 |
| 332 | 3300044901 | Ga0466960_0077707 | Ga0466960_0077707_317_541 | 73 |
| 333 | 3300046453 | Ga0495627_057006 | Ga0495627_057006_699_920 | 73 |
| 334 | 3300046507 | Ga0495606_0117860 | Ga0495606_0117860_879_1100 | 73 |
| 335 | 3300046514 | Ga0495618_0404188 | Ga0495618_0404188_500_721 | 73 |
| 336 | 3300046530 | Ga0495654_0000307 | Ga0495654_0000307_37800_38021 | 73 |
| 337 | 3300046674 | Ga0495588_0123969 | Ga0495588_0123969_532_753 | 73 |
| 338 | 3300046692 | Ga0495671_0093915 | Ga0495671_0093915_74_307 | 73 |
| 339 | 3300048905 | Ga0496102_0195534 | Ga0496102_0195534_579_800 | 73 |
| 340 | 3300048919 | Ga0496116_0014246 | Ga0496116_0014246_365_586 | 73 |
| 341 | 3300048920 | Ga0496117_0256910 | Ga0496117_0256910_76_297 | 73 |
| 342 | 3300048921 | Ga0496118_0141949 | Ga0496118_0141949_1038_1259 | 73 |
| 343 | 3300048924 | Ga0496121_0046495 | Ga0496121_0046495_3217_3438 | 73 |
| 344 | 3300048925 | Ga0496122_0081081 | Ga0496122_0081081_58_279 | 73 |
| 345 | 3300048925 | Ga0496122_0251477 | Ga0496122_0251477_321_542 | 73 |
| 346 | 3300048926 | Ga0496123_0197740 | Ga0496123_0197740_586_807 | 73 |
| 347 | 3300048927 | Ga0496124_0136856 | Ga0496124_0136856_291_512 | 73 |
| 348 | 3300048927 | Ga0496124_0205958 | Ga0496124_0205958_265_486 | 73 |
| 349 | 3300048928 | Ga0496125_0023627 | Ga0496125_0023627_4070_4291 | 73 |
| 350 | 3300048928 | Ga0496125_0245385 | Ga0496125_0245385_278_499 | 73 |
| 351 | 3300048928 | Ga0496125_0271219 | Ga0496125_0271219_485_706 | 73 |
| 352 | 3300050489 | nmdc:mga03683_13376_c1 | nmdc:mga03683_13376_c1_1348_1569 | 73 |
| 353 | 3300050489 | nmdc:mga03683_18969_c1 | nmdc:mga03683_18969_c1_377_598 | 73 |
| 354 | 3300050490 | nmdc:mga03n38_54909_c1 | nmdc:mga03n38_54909_c1_1412_1633 | 73 |
| 355 | 3300050493 | nmdc:mga0k408_212978_c1 | nmdc:mga0k408_212978_c1_330_551 | 73 |
| 356 | 3300050493 | nmdc:mga0k408_814591_c1 | nmdc:mga0k408_814591_c1_160_381 | 73 |
| 357 | 3300050496 | nmdc:mga07m45_14964_c1 | nmdc:mga07m45_14964_c1_1059_1280 | 73 |
| 358 | 3300050496 | nmdc:mga07m45_275492_c1 | nmdc:mga07m45_275492_c1_67_288 | 73 |
| 359 | 3300050496 | nmdc:mga07m45_341351_c1 | nmdc:mga07m45_341351_c1_305_529 | 73 |
| 360 | 3300050496 | nmdc:mga07m45_87206_c1 | nmdc:mga07m45_87206_c1_1031_1252 | 73 |
| 361 | 3300053088 | Ga0500644_0034887 | Ga0500644_0034887_922_1146 | 73 |
| 362 | 3300053090 | Ga0500646_0332937 | Ga0500646_0332937_259_489 | 73 |
| 363 | 3300053108 | Ga0500562_015907 | Ga0500562_015907_212_436 | 73 |
| 364 | 3300053121 | Ga0500607_060588 | Ga0500607_060588_1268_1489 | 73 |
| 365 | 3300053153 | Ga0500616_0030516 | Ga0500616_0030516_1346_1570 | 73 |
| 366 | 3300001989 | JGI24739J22299_10045454 | JGI24739J22299_100454542 | 74 |
| 367 | 3300002773 | JGI25152J39213_1006739 | JGI25152J39213_10067393 | 74 |
| 368 | 3300002773 | JGI25152J39213_1007757 | JGI25152J39213_10077572 | 74 |
| 369 | 3300002774 | JGI25150J39212_1004124 | JGI25150J39212_10041244 | 74 |
| 370 | 3300002987 | JGI25159J45721_1027654 | JGI25159J45721_10276542 | 74 |
| 371 | 3300003187 | JGI25151J46595_10021272 | JGI25151J46595_100212722 | 74 |
| 372 | 3300003187 | JGI25151J46595_10050715 | JGI25151J46595_100507152 | 74 |
| 373 | 3300003215 | JGI25153J46596_10008164 | JGI25153J46596_100081643 | 74 |
| 374 | 3300003215 | JGI25153J46596_10038933 | JGI25153J46596_100389332 | 74 |
| 375 | 3300003320 | rootH2_10201511 | rootH2_102015112 | 74 |
| 376 | 3300003323 | rootH1_10010296 | rootH1_100102962 | 74 |
| 377 | 3300003354 | JGI25160J50197_1014803 | JGI25160J50197_10148032 | 74 |
| 378 | 3300003354 | JGI25160J50197_1018904 | JGI25160J50197_10189042 | 74 |
| 379 | 3300003374 | JGI25161J50226_1001166 | JGI25161J50226_10011662 | 74 |
| 380 | 3300003374 | JGI25161J50226_1011488 | JGI25161J50226_10114882 | 74 |
| 381 | 3300003374 | JGI25161J50226_1013391 | JGI25161J50226_10133912 | 74 |
| 382 | 3300003578 | Ga0006562J51391_1081046 | Ga0006562J51391_10810462 | 74 |
| 383 | 3300003578 | Ga0006562J51391_1081047 | Ga0006562J51391_10810472 | 74 |
| 384 | 3300003760 | Ga0055527_1010495 | Ga0055527_10104952 | 74 |
| 385 | 3300003761 | Ga0055535_1001794 | Ga0055535_10017945 | 74 |
| 386 | 3300003762 | Ga0055542_1000004 | Ga0055542_1000004301 | 74 |
| 387 | 3300003771 | Ga0055526_1010824 | Ga0055526_10108242 | 74 |
| 388 | 3300003771 | Ga0055526_1020299 | Ga0055526_10202992 | 74 |
| 389 | 3300003773 | Ga0055537_1004186 | Ga0055537_10041862 | 74 |
| 390 | 3300003773 | Ga0055537_1008545 | Ga0055537_10085453 | 74 |
| 391 | 3300003775 | Ga0055524_1016108 | Ga0055524_10161082 | 74 |
| 392 | 3300003781 | Ga0055536_1010487 | Ga0055536_10104872 | 74 |
| 393 | 3300003784 | Ga0055534_1007036 | Ga0055534_10070362 | 74 |
| 394 | 3300003784 | Ga0055534_1007579 | Ga0055534_10075793 | 74 |
| 395 | 3300003790 | Ga0055528_1015854 | Ga0055528_10158542 | 74 |
| 396 | 3300003790 | Ga0055528_1026689 | Ga0055528_10266892 | 74 |
| 397 | 3300003791 | Ga0055530_10002962 | Ga0055530_100029625 | 74 |
| 398 | 3300003792 | Ga0055540_1011999 | Ga0055540_10119992 | 74 |
| 399 | 3300003792 | Ga0055540_1015561 | Ga0055540_10155611 | 74 |
| 400 | 3300003794 | Ga0055531_10015624 | Ga0055531_100156242 | 74 |
| 401 | 3300003794 | Ga0055531_10017837 | Ga0055531_100178372 | 74 |
| 402 | 3300004625 | Ga0055543_1001238 | Ga0055543_10012387 | 74 |
| 403 | 3300004625 | Ga0055543_1006692 | Ga0055543_10066922 | 74 |
| 404 | 3300005262 | Ga0065165_1003020 | Ga0065165_10030206 | 74 |
| 405 | 3300005262 | Ga0065165_1032362 | Ga0065165_10323622 | 74 |
| 406 | 3300005334 | Ga0068869_100864523 | Ga0068869_1008645231 | 74 |
| 407 | 3300005353 | Ga0070669_100071932 | Ga0070669_1000719322 | 74 |
| 408 | 3300005356 | Ga0070674_100062602 | Ga0070674_1000626021 | 74 |
| 409 | 3300005439 | Ga0070711_100961617 | Ga0070711_1009616172 | 74 |
| 410 | 3300005456 | Ga0070678_101112639 | Ga0070678_1011126392 | 74 |
| 411 | 3300005459 | Ga0068867_100673506 | Ga0068867_1006735062 | 74 |
| 412 | 3300005539 | Ga0068853_100030557 | Ga0068853_1000305574 | 74 |
| 413 | 3300005543 | Ga0070672_100491209 | Ga0070672_1004912092 | 74 |
| 414 | 3300005548 | Ga0070665_100320732 | Ga0070665_1003207322 | 74 |
| 415 | 3300005578 | Ga0068854_100415950 | Ga0068854_1004159502 | 74 |
| 416 | 3300005614 | Ga0068856_100579232 | Ga0068856_1005792322 | 74 |
| 417 | 3300005616 | Ga0068852_102143051 | Ga0068852_1021430512 | 74 |
| 418 | 3300005834 | Ga0068851_10011467 | Ga0068851_100114673 | 74 |
| 419 | 3300006051 | Ga0075364_10841759 | Ga0075364_108417591 | 74 |
| 420 | 3300006195 | Ga0075366_10335309 | Ga0075366_103353092 | 74 |
| 421 | 3300006353 | Ga0075370_10125617 | Ga0075370_101256173 | 74 |
| 422 | 3300006353 | Ga0075370_10449209 | Ga0075370_104492092 | 74 |
| 423 | 3300006358 | Ga0068871_101641375 | Ga0068871_1016413752 | 74 |
| 424 | 3300009093 | Ga0105240_10660297 | Ga0105240_106602972 | 74 |
| 425 | 3300009148 | Ga0105243_12532994 | Ga0105243_125329942 | 74 |
| 426 | 3300009176 | Ga0105242_10888457 | Ga0105242_108884572 | 74 |
| 427 | 3300009176 | Ga0105242_13037632 | Ga0105242_130376322 | 74 |
| 428 | 3300009177 | Ga0105248_10754013 | Ga0105248_107540133 | 74 |
| 429 | 3300009177 | Ga0105248_12106155 | Ga0105248_121061552 | 74 |
| 430 | 3300009553 | Ga0105249_12897325 | Ga0105249_128973252 | 74 |
| 431 | 3300010375 | Ga0105239_10669925 | Ga0105239_106699252 | 74 |
| 432 | 3300011119 | Ga0105246_10224283 | Ga0105246_102242832 | 74 |
| 433 | 3300013102 | Ga0157371_10161421 | Ga0157371_101614212 | 74 |
| 434 | 3300013104 | Ga0157370_10678162 | Ga0157370_106781622 | 74 |
| 435 | 3300013297 | Ga0157378_11621535 | Ga0157378_116215351 | 74 |
| 436 | 3300013297 | Ga0157378_12372341 | Ga0157378_123723412 | 74 |
| 437 | 3300013306 | Ga0163162_10004924 | Ga0163162_1000492410 | 74 |
| 438 | 3300013306 | Ga0163162_10578215 | Ga0163162_105782152 | 74 |
| 439 | 3300013307 | Ga0157372_10718220 | Ga0157372_107182202 | 74 |
| 440 | 3300013308 | Ga0157375_10947170 | Ga0157375_109471701 | 74 |
| 441 | 3300014326 | Ga0157380_10424451 | Ga0157380_104244511 | 74 |
| 442 | 3300014968 | Ga0157379_11500668 | Ga0157379_115006682 | 74 |
| 443 | 3300014969 | Ga0157376_10613890 | Ga0157376_106138902 | 74 |
| 444 | 3300014969 | Ga0157376_11484102 | Ga0157376_114841022 | 74 |
| 445 | 3300017792 | Ga0163161_10058522 | Ga0163161_100585223 | 74 |
| 446 | 3300025208 | Ga0209436_105799 | Ga0209436_1057993 | 74 |
| 447 | 3300025208 | Ga0209436_123283 | Ga0209436_1232832 | 74 |
| 448 | 3300025228 | Ga0209672_103958 | Ga0209672_1039582 | 74 |
| 449 | 3300025229 | Ga0209147_102289 | Ga0209147_1022893 | 74 |
| 450 | 3300025242 | Ga0209258_100022 | Ga0209258_100022302 | 74 |
| 451 | 3300025245 | Ga0207425_1000138 | Ga0207425_10001387 | 74 |
| 452 | 3300025245 | Ga0207425_1003117 | Ga0207425_10031174 | 74 |
| 453 | 3300025254 | Ga0209148_1000034 | Ga0209148_1000034302 | 74 |
| 454 | 3300025258 | Ga0209129_1000023 | Ga0209129_1000023375 | 74 |
| 455 | 3300025258 | Ga0209129_1002257 | Ga0209129_10022577 | 74 |
| 456 | 3300025263 | Ga0209565_1000649 | Ga0209565_10006497 | 74 |
| 457 | 3300025263 | Ga0209565_1002144 | Ga0209565_10021442 | 74 |
| 458 | 3300025273 | Ga0209673_1001445 | Ga0209673_100144516 | 74 |
| 459 | 3300025273 | Ga0209673_1001448 | Ga0209673_10014487 | 74 |
| 460 | 3300025284 | Ga0209130_1000222 | Ga0209130_100022256 | 74 |
| 461 | 3300025284 | Ga0209130_1001231 | Ga0209130_10012312 | 74 |
| 462 | 3300025291 | Ga0209675_1002241 | Ga0209675_10022415 | 74 |
| 463 | 3300025291 | Ga0209675_1002494 | Ga0209675_10024945 | 74 |
| 464 | 3300025291 | Ga0209675_1029948 | Ga0209675_10299482 | 74 |
| 465 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005422 | 74 |
| 466 | 3300025292 | Ga0209676_1008874 | Ga0209676_10088743 | 74 |
| 467 | 3300025292 | Ga0209676_1056145 | Ga0209676_10561452 | 74 |
| 468 | 3300025294 | Ga0209025_1000476 | Ga0209025_100047620 | 74 |
| 469 | 3300025294 | Ga0209025_1016183 | Ga0209025_10161832 | 74 |
| 470 | 3300025294 | Ga0209025_1039904 | Ga0209025_10399042 | 74 |
| 471 | 3300025295 | Ga0209564_1000400 | Ga0209564_100040016 | 74 |
| 472 | 3300025295 | Ga0209564_1001357 | Ga0209564_10013577 | 74 |
| 473 | 3300025297 | Ga0209758_1000064 | Ga0209758_1000064276 | 74 |
| 474 | 3300025297 | Ga0209758_1013125 | Ga0209758_10131252 | 74 |
| 475 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007675 | 74 |
| 476 | 3300025298 | Ga0209050_1019537 | Ga0209050_10195373 | 74 |
| 477 | 3300025299 | Ga0209256_1000038 | Ga0209256_1000038288 | 74 |
| 478 | 3300025299 | Ga0209256_1000115 | Ga0209256_100011521 | 74 |
| 479 | 3300025302 | Ga0207426_1000001 | Ga0207426_10000011283 | 74 |
| 480 | 3300025302 | Ga0207426_1000090 | Ga0207426_1000090239 | 74 |
| 481 | 3300025303 | Ga0209051_1000009 | Ga0209051_1000009422 | 74 |
| 482 | 3300025303 | Ga0209051_1008125 | Ga0209051_10081252 | 74 |
| 483 | 3300025303 | Ga0209051_1089675 | Ga0209051_10896752 | 74 |
| 484 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011396 | 74 |
| 485 | 3300025304 | Ga0209257_1014189 | Ga0209257_10141892 | 74 |
| 486 | 3300025321 | Ga0207656_10019771 | Ga0207656_100197713 | 74 |
| 487 | 3300025893 | Ga0207682_10418857 | Ga0207682_104188572 | 74 |
| 488 | 3300025913 | Ga0207695_10405134 | Ga0207695_104051342 | 74 |
| 489 | 3300025916 | Ga0207663_11224479 | Ga0207663_112244791 | 74 |
| 490 | 3300025923 | Ga0207681_10275401 | Ga0207681_102754012 | 74 |
| 491 | 3300025937 | Ga0207669_10104817 | Ga0207669_101048173 | 74 |
| 492 | 3300025940 | Ga0207691_10511664 | Ga0207691_105116642 | 74 |
| 493 | 3300025981 | Ga0207640_10531019 | Ga0207640_105310192 | 74 |
| 494 | 3300026041 | Ga0207639_10004693 | Ga0207639_100046934 | 74 |
| 495 | 3300026089 | Ga0207648_10387349 | Ga0207648_103873492 | 74 |
| 496 | 3300026121 | Ga0207683_10271434 | Ga0207683_102714342 | 74 |
| 497 | 3300028379 | Ga0268266_10114756 | Ga0268266_101147562 | 74 |
| 498 | 3300030742 | Ga0316183_1120504 | Ga0316183_11205042 | 74 |
| 499 | 3300030745 | Ga0316182_1306980 | Ga0316182_13069802 | 74 |
| 500 | 3300032005 | Ga0307411_11784866 | Ga0307411_117848661 | 74 |
| 501 | 3300035241 | Ga0373961_0443146 | Ga0373961_0443146_138_395 | 74 |
| 502 | 3300037312 | Ga0395899_0001705 | Ga0395899_0001705_10697_10921 | 74 |
| 503 | 3300037418 | Ga0395900_0001713 | Ga0395900_0001713_7264_7488 | 74 |
| 504 | 3300037466 | Ga0395898_0011212 | Ga0395898_0011212_1717_1941 | 74 |
| 505 | 3300038443 | Ga0395901_0004147 | Ga0395901_0004147_7389_7613 | 74 |
| 506 | 3300039447 | Ga0436361_0602324 | Ga0436361_0602324_20179_20409 | 74 |
| 507 | 3300039447 | Ga0436361_1187046 | Ga0436361_1187046_41_265 | 74 |
| 508 | 3300041452 | Ga0451793_0940603 | Ga0451793_0940603_227_451 | 74 |
| 509 | 3300041456 | Ga0451795_0585879 | Ga0451795_0585879_102_332 | 74 |
| 510 | 3300041486 | Ga0451807_0295848 | Ga0451807_0295848_170_400 | 74 |
| 511 | 3300041498 | Ga0451841_0777977 | Ga0451841_0777977_203_433 | 74 |
| 512 | 3300042134 | Ga0450898_018735 | Ga0450898_018735_828_1052 | 74 |
| 513 | 3300046454 | Ga0495592_0879393 | Ga0495592_0879393_59_283 | 74 |
| 514 | 3300046455 | Ga0495603_0586667 | Ga0495603_0586667_185_415 | 74 |
| 515 | 3300046459 | Ga0495629_0071622 | Ga0495629_0071622_1244_1474 | 74 |
| 516 | 3300046459 | Ga0495629_0319809 | Ga0495629_0319809_390_614 | 74 |
| 517 | 3300046460 | Ga0495638_0130536 | Ga0495638_0130536_834_1058 | 74 |
| 518 | 3300046462 | Ga0495651_0244418 | Ga0495651_0244418_854_1084 | 74 |
| 519 | 3300046473 | Ga0495582_0349743 | Ga0495582_0349743_608_838 | 74 |
| 520 | 3300046475 | Ga0495639_0002606 | Ga0495639_0002606_6883_7113 | 74 |
| 521 | 3300046511 | Ga0495608_0344204 | Ga0495608_0344204_483_713 | 74 |
| 522 | 3300046512 | Ga0495610_0034593 | Ga0495610_0034593_287_511 | 74 |
| 523 | 3300046513 | Ga0495616_0022482 | Ga0495616_0022482_59_283 | 74 |
| 524 | 3300046515 | Ga0495620_0188437 | Ga0495620_0188437_424_648 | 74 |
| 525 | 3300046516 | Ga0495628_0276025 | Ga0495628_0276025_928_1158 | 74 |
| 526 | 3300046518 | Ga0495631_0004180 | Ga0495631_0004180_6997_7221 | 74 |
| 527 | 3300046523 | Ga0495644_0354482 | Ga0495644_0354482_279_509 | 74 |
| 528 | 3300046525 | Ga0495663_0083933 | Ga0495663_0083933_455_685 | 74 |
| 529 | 3300046526 | Ga0495666_0162654 | Ga0495666_0162654_559_789 | 74 |
| 530 | 3300046528 | Ga0495642_0259121 | Ga0495642_0259121_453_683 | 74 |
| 531 | 3300046530 | Ga0495654_0108283 | Ga0495654_0108283_575_799 | 74 |
| 532 | 3300046533 | Ga0495640_0139290 | Ga0495640_0139290_768_998 | 74 |
| 533 | 3300046535 | Ga0495586_0163708 | Ga0495586_0163708_199_429 | 74 |
| 534 | 3300046536 | Ga0495587_0437486 | Ga0495587_0437486_340_570 | 74 |
| 535 | 3300046539 | Ga0495621_0008890 | Ga0495621_0008890_2514_2744 | 74 |
| 536 | 3300046539 | Ga0495621_0064111 | Ga0495621_0064111_624_848 | 74 |
| 537 | 3300046539 | Ga0495621_0502267 | Ga0495621_0502267_173_427 | 74 |
| 538 | 3300046557 | Ga0495622_0247180 | Ga0495622_0247180_414_638 | 74 |
| 539 | 3300046557 | Ga0495622_0427722 | Ga0495622_0427722_39_269 | 74 |
| 540 | 3300046615 | Ga0495656_0006966 | Ga0495656_0006966_612_842 | 74 |
| 541 | 3300046615 | Ga0495656_0650503 | Ga0495656_0650503_290_520 | 74 |
| 542 | 3300046660 | Ga0495625_0239607 | Ga0495625_0239607_469_693 | 74 |
| 543 | 3300046663 | Ga0495635_0165803 | Ga0495635_0165803_759_989 | 74 |
| 544 | 3300046663 | Ga0495635_0271597 | Ga0495635_0271597_776_1000 | 74 |
| 545 | 3300046674 | Ga0495588_0189141 | Ga0495588_0189141_637_861 | 74 |
| 546 | 3300046674 | Ga0495588_0382270 | Ga0495588_0382270_202_432 | 74 |
| 547 | 3300046679 | Ga0495623_0609066 | Ga0495623_0609066_177_407 | 74 |
| 548 | 3300046683 | Ga0495658_0265295 | Ga0495658_0265295_808_1032 | 74 |
| 549 | 3300046690 | Ga0495624_0278647 | Ga0495624_0278647_578_808 | 74 |
| 550 | 3300046690 | Ga0495624_0335929 | Ga0495624_0335929_546_770 | 74 |
| 551 | 3300046691 | Ga0495670_0022371 | Ga0495670_0022371_2348_2578 | 74 |
| 552 | 3300046691 | Ga0495670_0025111 | Ga0495670_0025111_1747_1977 | 74 |
| 553 | 3300046691 | Ga0495670_0205712 | Ga0495670_0205712_76_300 | 74 |
| 554 | 3300046809 | Ga0495600_0051794 | Ga0495600_0051794_2302_2532 | 74 |
| 555 | 3300047317 | Ga0495604_0709894 | Ga0495604_0709894_382_612 | 74 |
| 556 | 3300047321 | Ga0495676_0231657 | Ga0495676_0231657_30_254 | 74 |
| 557 | 3300047321 | Ga0495676_0317534 | Ga0495676_0317534_243_473 | 74 |
| 558 | 3300047322 | Ga0495680_0690500 | Ga0495680_0690500_298_528 | 74 |
| 559 | 3300047472 | Ga0495686_0478029 | Ga0495686_0478029_219_443 | 74 |
| 560 | 3300047673 | Ga0495593_0079212 | Ga0495593_0079212_431_655 | 74 |
| 561 | 3300048088 | Ga0495602_0795634 | Ga0495602_0795634_203_427 | 74 |
| 562 | 3300048089 | Ga0495614_0143376 | Ga0495614_0143376_350_574 | 74 |
| 563 | 3300048090 | Ga0495615_0002030 | Ga0495615_0002030_747_977 | 74 |
| 564 | 3300048903 | Ga0496100_0014235 | Ga0496100_0014235_331_561 | 74 |
| 565 | 3300048904 | Ga0496101_0004822 | Ga0496101_0004822_3922_4152 | 74 |
| 566 | 3300048905 | Ga0496102_0027383 | Ga0496102_0027383_3084_3314 | 74 |
| 567 | 3300048906 | Ga0496103_0026228 | Ga0496103_0026228_1449_1679 | 74 |
| 568 | 3300048907 | Ga0496104_0027034 | Ga0496104_0027034_3254_3484 | 74 |
| 569 | 3300048908 | Ga0496105_0001248 | Ga0496105_0001248_7232_7462 | 74 |
| 570 | 3300048908 | Ga0496105_1116673 | Ga0496105_1116673_337_567 | 74 |
| 571 | 3300048909 | Ga0496106_0218221 | Ga0496106_0218221_220_450 | 74 |
| 572 | 3300048909 | Ga0496106_0563630 | Ga0496106_0563630_308_532 | 74 |
| 573 | 3300048910 | Ga0496107_0023692 | Ga0496107_0023692_1270_1500 | 74 |
| 574 | 3300048910 | Ga0496107_0846812 | Ga0496107_0846812_283_507 | 74 |
| 575 | 3300048911 | Ga0496108_0184649 | Ga0496108_0184649_585_815 | 74 |
| 576 | 3300048912 | Ga0496109_0060743 | Ga0496109_0060743_2855_3085 | 74 |
| 577 | 3300048913 | Ga0496110_0343761 | Ga0496110_0343761_886_1116 | 74 |
| 578 | 3300048913 | Ga0496110_0492361 | Ga0496110_0492361_630_860 | 74 |
| 579 | 3300048913 | Ga0496110_0561720 | Ga0496110_0561720_234_464 | 74 |
| 580 | 3300048913 | Ga0496110_1412608 | Ga0496110_1412608_52_282 | 74 |
| 581 | 3300048914 | Ga0496111_0087566 | Ga0496111_0087566_1748_1978 | 74 |
| 582 | 3300048914 | Ga0496111_0714059 | Ga0496111_0714059_150_380 | 74 |
| 583 | 3300048917 | Ga0496114_0192344 | Ga0496114_0192344_1253_1483 | 74 |
| 584 | 3300048917 | Ga0496114_1119673 | Ga0496114_1119673_366_596 | 74 |
| 585 | 3300048918 | Ga0496115_1030729 | Ga0496115_1030729_309_539 | 74 |
| 586 | 3300048919 | Ga0496116_0030472 | Ga0496116_0030472_3327_3551 | 74 |
| 587 | 3300048920 | Ga0496117_0035438 | Ga0496117_0035438_3281_3505 | 74 |
| 588 | 3300048920 | Ga0496117_0037362 | Ga0496117_0037362_2455_2679 | 74 |
| 589 | 3300048921 | Ga0496118_0041873 | Ga0496118_0041873_2793_3017 | 74 |
| 590 | 3300048923 | Ga0496120_0187145 | Ga0496120_0187145_511_735 | 74 |
| 591 | 3300048924 | Ga0496121_0042532 | Ga0496121_0042532_2132_2356 | 74 |
| 592 | 3300048924 | Ga0496121_0128980 | Ga0496121_0128980_1194_1418 | 74 |
| 593 | 3300048925 | Ga0496122_0182470 | Ga0496122_0182470_301_525 | 74 |
| 594 | 3300048925 | Ga0496122_0281222 | Ga0496122_0281222_96_320 | 74 |
| 595 | 3300048925 | Ga0496122_0387402 | Ga0496122_0387402_239_463 | 74 |
| 596 | 3300048926 | Ga0496123_0061048 | Ga0496123_0061048_1635_1859 | 74 |
| 597 | 3300048926 | Ga0496123_0134951 | Ga0496123_0134951_704_928 | 74 |
| 598 | 3300048926 | Ga0496123_0158164 | Ga0496123_0158164_655_879 | 74 |
| 599 | 3300048927 | Ga0496124_0126873 | Ga0496124_0126873_170_394 | 74 |
| 600 | 3300048928 | Ga0496125_0087011 | Ga0496125_0087011_35_259 | 74 |
| 601 | 3300048928 | Ga0496125_0280281 | Ga0496125_0280281_219_443 | 74 |
| 602 | 3300048928 | Ga0496125_0351585 | Ga0496125_0351585_170_394 | 74 |
| 603 | 3300048929 | Ga0496126_0470131 | Ga0496126_0470131_551_775 | 74 |
| 604 | 3300050496 | nmdc:mga07m45_590719_c1 | nmdc:mga07m45_590719_c1_226_456 | 74 |
| 605 | 3300050496 | nmdc:mga07m45_875220_c1 | nmdc:mga07m45_875220_c1_77_301 | 74 |
| 606 | 3300053078 | Ga0495612_0231383 | Ga0495612_0231383_411_641 | 74 |
| 607 | 3300053086 | Ga0500578_0719592 | Ga0500578_0719592_189_413 | 74 |
| 608 | 3300053087 | Ga0500643_004493 | Ga0500643_004493_5976_6200 | 74 |
| 609 | 3300053093 | Ga0500651_0000038 | Ga0500651_0000038_30142_30366 | 74 |
| 610 | 3300053110 | Ga0500571_000054 | Ga0500571_000054_18158_18382 | 74 |
| 611 | 3300053118 | Ga0500594_0022279 | Ga0500594_0022279_697_921 | 74 |
| 612 | 3300053120 | Ga0500597_014935 | Ga0500597_014935_785_1009 | 74 |
| 613 | 3300053122 | Ga0500608_082273 | Ga0500608_082273_60_284 | 74 |
| 614 | 3300053123 | Ga0500614_217130 | Ga0500614_217130_250_474 | 74 |
| 615 | 3300053125 | Ga0500618_039485 | Ga0500618_039485_567_791 | 74 |
| 616 | 3300053128 | Ga0500626_019208 | Ga0500626_019208_445_669 | 74 |
| 617 | 3300053133 | Ga0500655_000123 | Ga0500655_000123_15602_15826 | 74 |
| 618 | 3300053134 | Ga0500658_0000237 | Ga0500658_0000237_23416_23640 | 74 |
| 619 | 3300053134 | Ga0500658_0000266 | Ga0500658_0000266_17428_17652 | 74 |
| 620 | 3300053136 | Ga0500559_0008198 | Ga0500559_0008198_595_819 | 74 |
| 621 | 3300053138 | Ga0500564_024230 | Ga0500564_024230_2360_2584 | 74 |
| 622 | 3300053139 | Ga0500568_0049520 | Ga0500568_0049520_872_1096 | 74 |
| 623 | 3300053141 | Ga0500574_027974 | Ga0500574_027974_1146_1370 | 74 |
| 624 | 3300053153 | Ga0500616_0037987 | Ga0500616_0037987_752_976 | 74 |
| 625 | 3300053154 | Ga0500619_134753 | Ga0500619_134753_376_600 | 74 |
| 626 | 3300053162 | Ga0500638_015691 | Ga0500638_015691_892_1116 | 74 |
| 627 | 3300053177 | Ga0500636_0254058 | Ga0500636_0254058_394_618 | 74 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4esv-assembly2.cif.gz_J | a new twist on the translocation mechanism of helicases from the structure of dnab with its substrates | 0.7461 | 18 | 51 |
| 4esv-assembly2.cif.gz_G | a new twist on the translocation mechanism of helicases from the structure of dnab with its substrates | 0.7442 | 18 | 51 |
| 2vye-assembly1.cif.gz_A | crystal structure of the dnac-ssdna complex | 0.7038 | 18 | 70 |
| 4esv-assembly1.cif.gz_B | a new twist on the translocation mechanism of helicases from the structure of dnab with its substrates | 0.6868 | 18 | 52 |
| 4esv-assembly1.cif.gz_D | a new twist on the translocation mechanism of helicases from the structure of dnab with its substrates | 0.6857 | 18 | 52 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06604_144_296_3.90.1750.20 | Alpha Beta;Alpha-Beta Complex;Hect, E3 ligase catalytic domain fold;Putative Large Serine Recombinase; Chain B, Domain 2 | 0.7197 | 27 | 62 | 3.90.1750.20 |
| 4esvC01 | Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A | 0.6847 | 18 | 52 | 1.10.860.10 |
| 4esvA01 | Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A | 0.6841 | 18 | 52 | 1.10.860.10 |
| af_P75993_25_88_1.20.5.5260 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.6694 | 21 | 55 | 1.20.5.5260 |
| 4esvI01 | Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A | 0.6679 | 18 | 51 | 1.10.860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A502GCP4-F1-model_v4 | Recombinase-like domain-containing protein | 0.9829 | 16 | 74 |
|
| AF-A0A3N2GQF7-F1-model_v4 | Recombinase-like domain-containing protein | 0.9755 | 17 | 73 |
|
| AF-A0A5C5T9R3-F1-model_v4 | Recombinase-like domain-containing protein | 0.972 | 16 | 73 |
|
| AF-A0A2N5L7J8-F1-model_v4 | deleted | 0.9717 | 17 | 74 |
|
| AF-A0A1Q4BED1-F1-model_v4 | Recombinase-like domain-containing protein | 0.9603 | 14 | 73 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar