F470554

General Info

Members Datasets Scaffolds Average Seq Length
627 376 598 74

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10093926|Ga0105244_100939262
Length 78
Sequence MMVATVTDVYLNPHQARRRPPTQFEDLLGDSIERAYAAGIHELGALVAHLNRTGPSCPYNAGVWTEANYQEEIARLAA

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2818991446 Variovorax sp. 1180 Isolate Unclassified
9 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
10 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
11 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
12 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
13 2885198086 Variovorax sp. 679 Isolate Unclassified
14 2885211737 Variovorax sp. 553 Isolate Unclassified
15 2899924645 Variovorax sp. 369 Isolate Unclassified
16 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
17 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
18 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
19 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
20 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
21 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
22 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
23 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
24 2928037797 Variovorax sp. 1126 Isolate Unclassified
25 2928044640 Variovorax sp. 1128 Isolate Unclassified
26 2928051484 Variovorax sp. 1133 Isolate Unclassified
27 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
28 2928070936 Variovorax gossypii 1167 Isolate Unclassified
29 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
34 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
41 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
42 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
50 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
138 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
202 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
203 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
223 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
226 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
227 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
228 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
235 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
236 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
237 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
238 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
239 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
240 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
243 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
244 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
245 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
246 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
247 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
248 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
249 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
250 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
251 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
252 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
253 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
254 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
255 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
281 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
290 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
315 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
332 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
333 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
336 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
346 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
350 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
353 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
354 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
355 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
356 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
357 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
358 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
359 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
360 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
361 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
362 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
363 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
364 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
365 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
370 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
371 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
374 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 0.64
Isolates 4.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.88
Nodule 0.64
Rhizoplane 5.26
Rhizosphere 59.17
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10045454 3300001989 Bacteria 1441
2 JGI25152J39213_1006739 3300002773 Bacteria 3063
3 JGI25152J39213_1007757 3300002773 Bacteria 2744
4 JGI25150J39212_1004124 3300002774 Bacteria 3278
5 JGI25159J45721_1027654 3300002987 Bacteria 959
6 JGI25151J46595_10021272 3300003187 Bacteria 2718
7 JGI25151J46595_10050715 3300003187 Bacteria 1411
8 JGI25153J46596_10008164 3300003215 Bacteria 5043
9 JGI25153J46596_10038933 3300003215 Bacteria 1491
10 rootH1_10023287 3300003316 Bacteria 1483
11 rootH2_10201511 3300003320 Bacteria 1693
12 rootH1_10010296 3300003323 Bacteria 2569
13 JGI25160J50197_1014803 3300003354 Bacteria 2589
14 JGI25160J50197_1018904 3300003354 Bacteria 2132
15 JGI25161J50226_1001166 3300003374 Bacteria 8720
16 JGI25161J50226_1011488 3300003374 Bacteria 1110
17 JGI25161J50226_1013391 3300003374 Bacteria 951
18 Ga0006562J51391_1081046 3300003578 Bacteria 1500
19 Ga0006562J51391_1081047 3300003578 Bacteria 680
20 Ga0006562J51391_1118556 3300003578 Bacteria 3380
21 Ga0006562J51391_1118558 3300003578 Bacteria 1230
22 Ga0055527_1010495 3300003760 Bacteria 1068
23 Ga0055535_1001794 3300003761 Bacteria 9420
24 Ga0055542_1000004 3300003762 Bacteria 553532
25 Ga0055542_1004738 3300003762 Bacteria 3210
26 Ga0055526_1010824 3300003771 Bacteria 4194
27 Ga0055526_1020299 3300003771 Bacteria 2372
28 Ga0055537_1004186 3300003773 Bacteria 4194
29 Ga0055537_1008545 3300003773 Bacteria 2352
30 Ga0055524_1016108 3300003775 Bacteria 2697
31 Ga0055536_1009558 3300003781 Bacteria 3988
32 Ga0055536_1010487 3300003781 Bacteria 3667
33 Ga0055536_1050417 3300003781 Bacteria 918
34 Ga0055534_1007036 3300003784 Bacteria 2743
35 Ga0055534_1007579 3300003784 Bacteria 2568
36 Ga0055528_1015854 3300003790 Bacteria 2697
37 Ga0055528_1026689 3300003790 Bacteria 1649
38 Ga0055530_10002962 3300003791 Bacteria 10231
39 Ga0055530_10013054 3300003791 Bacteria 2857
40 Ga0055540_1002232 3300003792 Bacteria 10483
41 Ga0055540_1009260 3300003792 Bacteria 3422
42 Ga0055540_1010547 3300003792 Bacteria 3066
43 Ga0055540_1011999 3300003792 Bacteria 2750
44 Ga0055540_1015561 3300003792 Bacteria 2205
45 Ga0055531_10006424 3300003794 Bacteria 6677
46 Ga0055531_10015624 3300003794 Bacteria 3331
47 Ga0055531_10017837 3300003794 Bacteria 2968
48 Ga0055531_10065334 3300003794 Bacteria 865
49 Ga0055543_1001238 3300004625 Bacteria 10652
50 Ga0055543_1006692 3300004625 Bacteria 2750
51 Ga0065165_1003020 3300005262 Bacteria 12691
52 Ga0065165_1032362 3300005262 Bacteria 1640
53 Ga0065714_10099269 3300005288 Bacteria 1649
54 Ga0065714_10218370 3300005288 Bacteria 845
55 Ga0065704_10155066 3300005289 Bacteria 1397
56 Ga0070658_10293938 3300005327 Bacteria 1385
57 Ga0070670_100816493 3300005331 Bacteria 843
58 Ga0070677_10545674 3300005333 Bacteria 635
59 Ga0068869_100864523 3300005334 Bacteria 781
60 Ga0070660_100722101 3300005339 Bacteria 836
61 Ga0070660_101246555 3300005339 Bacteria 631
62 Ga0070668_100756240 3300005347 Bacteria 861
63 Ga0070669_100071932 3300005353 Bacteria 2559
64 Ga0070669_101521397 3300005353 Bacteria 582
65 Ga0070675_101623028 3300005354 Bacteria 597
66 Ga0070671_100659816 3300005355 Bacteria 906
67 Ga0070674_100062602 3300005356 Bacteria 2600
68 Ga0070674_102206699 3300005356 Bacteria 503
69 Ga0070673_100391687 3300005364 Bacteria 1241
70 Ga0070673_101996013 3300005364 Bacteria 551
71 Ga0070688_101510865 3300005365 Bacteria 547
72 Ga0070659_100052983 3300005366 Bacteria 3193
73 Ga0070667_100015926 3300005367 Bacteria 6220
74 Ga0070667_101401403 3300005367 Bacteria 656
75 Ga0070711_100961617 3300005439 Bacteria 731
76 Ga0070708_100535277 3300005445 Bacteria 1105
77 Ga0070678_100664812 3300005456 Bacteria 936
78 Ga0070678_101112639 3300005456 Bacteria 730
79 Ga0070662_100018544 3300005457 Bacteria 4709
80 Ga0068867_100673506 3300005459 Bacteria 910
81 Ga0070685_10269930 3300005466 Bacteria 1135
82 Ga0068853_100030557 3300005539 Bacteria 4551
83 Ga0068853_100078751 3300005539 Bacteria 2881
84 Ga0070672_100117095 3300005543 Bacteria 2178
85 Ga0070672_100491209 3300005543 Bacteria 1061
86 Ga0070665_100074476 3300005548 Bacteria 3401
87 Ga0070665_100083840 3300005548 Bacteria 3192
88 Ga0070665_100320732 3300005548 Bacteria 1554
89 Ga0070665_101816039 3300005548 Bacteria 616
90 Ga0068855_100033501 3300005563 Bacteria 6130
91 Ga0070664_100267954 3300005564 Bacteria 1538
92 Ga0068857_100141486 3300005577 Bacteria 2175
93 Ga0068854_100000568 3300005578 Bacteria 22144
94 Ga0068854_100415950 3300005578 Bacteria 1116
95 Ga0068854_102220245 3300005578 Bacteria 508
96 Ga0068856_100579232 3300005614 Bacteria 1143
97 Ga0068852_101011222 3300005616 Bacteria 850
98 Ga0068852_102143051 3300005616 Bacteria 581
99 Ga0068851_10011467 3300005834 Bacteria 4159
100 Ga0068851_10442209 3300005834 Bacteria 771
101 Ga0068851_10482818 3300005834 Bacteria 741
102 Ga0068870_10455324 3300005840 Bacteria 844
103 Ga0068863_100700414 3300005841 Bacteria 1007
104 Ga0068860_100333651 3300005843 Bacteria 1490
105 Ga0075368_10119415 3300006042 Bacteria 1091
106 Ga0075363_100291663 3300006048 Bacteria 945
107 Ga0075363_100464406 3300006048 Bacteria 749
108 Ga0075364_10841759 3300006051 Bacteria 625
109 Ga0075432_10013889 3300006058 Bacteria 2740
110 Ga0070715_10891459 3300006163 Bacteria 547
111 Ga0075362_10045591 3300006177 Bacteria 1948
112 Ga0075367_10217421 3300006178 Bacteria 1195
113 Ga0075369_10027031 3300006186 Bacteria 2396
114 Ga0075366_10092471 3300006195 Bacteria 1812
115 Ga0075366_10335309 3300006195 Bacteria 927
116 Ga0075366_10596656 3300006195 Bacteria 685
117 Ga0097621_101038054 3300006237 Bacteria 768
118 Ga0097621_101467662 3300006237 Bacteria 647
119 Ga0097621_101662662 3300006237 Bacteria 608
120 Ga0075370_10002278 3300006353 Bacteria 8848
121 Ga0075370_10011877 3300006353 Bacteria 4586
122 Ga0075370_10125617 3300006353 Bacteria 1495
123 Ga0075370_10449209 3300006353 Bacteria 776
124 Ga0075370_10725932 3300006353 Bacteria 604
125 Ga0068871_101641375 3300006358 Bacteria 609
126 Ga0068871_101769182 3300006358 Bacteria 587
127 Ga0068865_100327046 3300006881 Bacteria 1235
128 Ga0068865_101528475 3300006881 Bacteria 599
129 Ga0079104_1000226 3300006946 Bacteria 77894
130 Ga0105244_10001011 3300009036 Bacteria 23532
131 Ga0105244_10093926 3300009036 Bacteria 1473
132 Ga0105250_10000526 3300009092 Bacteria 26634
133 Ga0105240_10660297 3300009093 Bacteria 1145
134 Ga0105240_10665814 3300009093 Bacteria 1139
135 Ga0105245_10541256 3300009098 Bacteria 1185
136 Ga0105247_11541446 3300009101 Bacteria 543
137 Ga0105243_10002414 3300009148 Bacteria 15651
138 Ga0105243_10007533 3300009148 Bacteria 8370
139 Ga0105243_10011391 3300009148 Bacteria 6729
140 Ga0105243_12532994 3300009148 Bacteria 552
141 Ga0105241_10212738 3300009174 Bacteria 1621
142 Ga0105242_10375552 3300009176 Bacteria 1320
143 Ga0105242_10888457 3300009176 Bacteria 890
144 Ga0105242_13037632 3300009176 Bacteria 520
145 Ga0105248_10754013 3300009177 Bacteria 1098
146 Ga0105248_12106155 3300009177 Bacteria 641
147 Ga0105237_10023997 3300009545 Bacteria 6240
148 Ga0105237_11023700 3300009545 Bacteria 833
149 Ga0105238_10000065 3300009551 Bacteria 121196
150 Ga0105238_10413950 3300009551 Bacteria 1342
151 Ga0105238_10613020 3300009551 Bacteria 1097
152 Ga0105249_10492504 3300009553 Bacteria 1270
153 Ga0105249_12897325 3300009553 Bacteria 551
154 Ga0105239_10086610 3300010375 Bacteria 3453
155 Ga0105239_10669925 3300010375 Bacteria 1185
156 Ga0105246_10224283 3300011119 Bacteria 1475
157 Ga0105246_10243772 3300011119 Bacteria 1422
158 Ga0157328_1007993 3300012478 Bacteria 682
159 Ga0157373_10039688 3300013100 Bacteria 3370
160 Ga0157373_10135247 3300013100 Bacteria 1733
161 Ga0157371_10161421 3300013102 Bacteria 1601
162 Ga0157371_10591359 3300013102 Bacteria 825
163 Ga0157370_10111341 3300013104 Bacteria 2559
164 Ga0157370_10678162 3300013104 Bacteria 941
165 Ga0157370_11047683 3300013104 Bacteria 738
166 Ga0157369_10451678 3300013105 Bacteria 1331
167 Ga0157378_11621535 3300013297 Bacteria 693
168 Ga0157378_12372341 3300013297 Bacteria 582
169 Ga0163162_10004924 3300013306 Bacteria 12876
170 Ga0163162_10578215 3300013306 Bacteria 1250
171 Ga0163162_10655089 3300013306 Bacteria 1174
172 Ga0157372_10718220 3300013307 Bacteria 1162
173 Ga0157375_10947170 3300013308 Bacteria 1003
174 Ga0157380_10424451 3300014326 Bacteria 1269
175 Ga0182008_10005597 3300014497 Bacteria 7121
176 Ga0182008_10013054 3300014497 Bacteria 4370
177 Ga0182008_10098018 3300014497 Bacteria 1447
178 Ga0182008_10100052 3300014497 Bacteria 1432
179 Ga0157379_11500668 3300014968 Bacteria 656
180 Ga0157376_10108399 3300014969 Bacteria 2440
181 Ga0157376_10613890 3300014969 Bacteria 1084
182 Ga0157376_11484102 3300014969 Bacteria 711
183 Ga0182006_1000955 3300015261 Bacteria 19201
184 Ga0182006_1016469 3300015261 Bacteria 3153
185 Ga0182006_1099154 3300015261 Bacteria 1036
186 Ga0182006_1104965 3300015261 Bacteria 998
187 Ga0182007_10000617 3300015262 Bacteria 20740
188 Ga0182007_10003714 3300015262 Bacteria 7132
189 Ga0182005_1027596 3300015265 Bacteria 1548
190 Ga0182005_1049536 3300015265 Bacteria 1142
191 Ga0183362_10001 3300015683 Bacteria 2046624
192 Ga0163161_10058522 3300017792 Bacteria 2801
193 Ga0163161_10085194 3300017792 Bacteria 2331
194 Ga0163161_10128840 3300017792 Bacteria 1907
195 Ga0163161_10142788 3300017792 Bacteria 1814
196 Ga0163161_11478487 3300017792 Unclassified 596
197 Ga0213872_10000365 3300021361 Bacteria 38169
198 Ga0213872_10006128 3300021361 Bacteria 6079
199 Ga0209436_105799 3300025208 Bacteria 2786
200 Ga0209436_123283 3300025208 Bacteria 780
201 Ga0209672_103958 3300025228 Bacteria 2887
202 Ga0209147_102289 3300025229 Bacteria 4993
203 Ga0209258_100022 3300025242 Bacteria 553584
204 Ga0207425_1000138 3300025245 Bacteria 65477
205 Ga0207425_1003117 3300025245 Bacteria 5463
206 Ga0209148_1000034 3300025254 Bacteria 553584
207 Ga0209148_1002495 3300025254 Bacteria 6234
208 Ga0209129_1000023 3300025258 Bacteria 420646
209 Ga0209129_1002257 3300025258 Bacteria 9620
210 Ga0209565_1000649 3300025263 Bacteria 22398
211 Ga0209565_1002144 3300025263 Bacteria 7444
212 Ga0209673_1001445 3300025273 Bacteria 22547
213 Ga0209673_1001448 3300025273 Bacteria 22538
214 Ga0209673_1089706 3300025273 Bacteria 683
215 Ga0209130_1000222 3300025284 Bacteria 74607
216 Ga0209130_1001231 3300025284 Bacteria 17981
217 Ga0209130_1002576 3300025284 Bacteria 8828
218 Ga0209675_1002241 3300025291 Bacteria 10106
219 Ga0209675_1002494 3300025291 Bacteria 9420
220 Ga0209675_1028618 3300025291 Bacteria 1352
221 Ga0209675_1029948 3300025291 Bacteria 1304
222 Ga0209676_1000005 3300025292 Bacteria 1076001
223 Ga0209676_1001320 3300025292 Bacteria 25099
224 Ga0209676_1001396 3300025292 Bacteria 23358
225 Ga0209676_1008874 3300025292 Bacteria 4419
226 Ga0209676_1043989 3300025292 Bacteria 1228
227 Ga0209676_1056145 3300025292 Bacteria 1004
228 Ga0209025_1000096 3300025294 Bacteria 239153
229 Ga0209025_1000476 3300025294 Bacteria 77754
230 Ga0209025_1016183 3300025294 Bacteria 4426
231 Ga0209025_1039904 3300025294 Bacteria 2040
232 Ga0209564_1000400 3300025295 Bacteria 77039
233 Ga0209564_1001357 3300025295 Bacteria 25809
234 Ga0209758_1000064 3300025297 Bacteria 311812
235 Ga0209758_1013125 3300025297 Bacteria 4551
236 Ga0209050_1000007 3300025298 Bacteria 1187891
237 Ga0209050_1002090 3300025298 Bacteria 18300
238 Ga0209050_1019537 3300025298 Bacteria 2567
239 Ga0209256_1000038 3300025299 Bacteria 375225
240 Ga0209256_1000115 3300025299 Bacteria 173607
241 Ga0207426_1000001 3300025302 Bacteria 1341301
242 Ga0207426_1000090 3300025302 Bacteria 280662
243 Ga0209051_1000009 3300025303 Bacteria 706778
244 Ga0209051_1000092 3300025303 Bacteria 170056
245 Ga0209051_1000490 3300025303 Bacteria 51070
246 Ga0209051_1000944 3300025303 Bacteria 28691
247 Ga0209051_1008125 3300025303 Bacteria 5608
248 Ga0209051_1089675 3300025303 Bacteria 859
249 Ga0209257_1000011 3300025304 Bacteria 1112630
250 Ga0209257_1000508 3300025304 Bacteria 68156
251 Ga0209257_1014189 3300025304 Bacteria 3449
252 Ga0209257_1018534 3300025304 Bacteria 2673
253 Ga0209257_1041264 3300025304 Bacteria 1370
254 Ga0207656_10019771 3300025321 Bacteria 2667
255 Ga0207656_10330909 3300025321 Bacteria 758
256 Ga0207696_1001349 3300025711 Bacteria 13489
257 Ga0207655_1018003 3300025728 Bacteria 3777
258 Ga0207655_1152847 3300025728 Bacteria 728
259 Ga0207682_10418857 3300025893 Bacteria 633
260 Ga0207688_10789298 3300025901 Bacteria 602
261 Ga0207680_10317254 3300025903 Bacteria 1089
262 Ga0207645_10549202 3300025907 Bacteria 784
263 Ga0207705_10273087 3300025909 Bacteria 1293
264 Ga0207654_11432739 3300025911 Bacteria 504
265 Ga0207695_10022412 3300025913 Bacteria 7169
266 Ga0207695_10405134 3300025913 Bacteria 1248
267 Ga0207671_10016759 3300025914 Bacteria 5682
268 Ga0207663_11224479 3300025916 Bacteria 604
269 Ga0207657_10145664 3300025919 Bacteria 1932
270 Ga0207681_10275401 3300025923 Bacteria 1323
271 Ga0207681_10499487 3300025923 Bacteria 996
272 Ga0207694_10000286 3300025924 Bacteria 47592
273 Ga0207694_10214173 3300025924 Bacteria 1570
274 Ga0207694_10769101 3300025924 Bacteria 813
275 Ga0207694_11891379 3300025924 Unclassified 501
276 Ga0207650_10448127 3300025925 Bacteria 1074
277 Ga0207659_10083753 3300025926 Bacteria 2365
278 Ga0207687_10530706 3300025927 Bacteria 985
279 Ga0207690_10031808 3300025932 Bacteria 3380
280 Ga0207706_10088954 3300025933 Bacteria 2715
281 Ga0207686_10271816 3300025934 Bacteria 1247
282 Ga0207709_10000165 3300025935 Bacteria 90586
283 Ga0207709_10000785 3300025935 Bacteria 24867
284 Ga0207709_10001556 3300025935 Bacteria 15728
285 Ga0207709_10036159 3300025935 Bacteria 2926
286 Ga0207709_10987384 3300025935 Bacteria 688
287 Ga0207669_10104817 3300025937 Bacteria 1879
288 Ga0207669_11283052 3300025937 Bacteria 622
289 Ga0207704_10464657 3300025938 Bacteria 1013
290 Ga0207704_10612965 3300025938 Bacteria 892
291 Ga0207691_10116568 3300025940 Bacteria 2370
292 Ga0207691_10511664 3300025940 Bacteria 1019
293 Ga0207711_11823222 3300025941 Bacteria 551
294 Ga0207689_10289125 3300025942 Bacteria 1358
295 Ga0207679_10048660 3300025945 Bacteria 3088
296 Ga0207651_10093314 3300025960 Bacteria 2210
297 Ga0207712_10592789 3300025961 Bacteria 958
298 Ga0207712_11118598 3300025961 Bacteria 701
299 Ga0207668_10297978 3300025972 Bacteria 1330
300 Ga0207668_10404364 3300025972 Bacteria 1155
301 Ga0207640_10028597 3300025981 Bacteria 3410
302 Ga0207640_10531019 3300025981 Bacteria 985
303 Ga0207658_10224090 3300025986 Bacteria 1583
304 Ga0207639_10004693 3300026041 Bacteria 9197
305 Ga0207639_10084577 3300026041 Bacteria 2521
306 Ga0207639_10916502 3300026041 Bacteria 819
307 Ga0207639_12229242 3300026041 Bacteria 509
308 Ga0207678_11632663 3300026067 Bacteria 567
309 Ga0207641_10853664 3300026088 Bacteria 903
310 Ga0207648_10387349 3300026089 Bacteria 1265
311 Ga0207648_10443011 3300026089 Bacteria 1182
312 Ga0207674_10215482 3300026116 Bacteria 1869
313 Ga0207674_10385264 3300026116 Bacteria 1355
314 Ga0207683_10144960 3300026121 Bacteria 2141
315 Ga0207683_10188260 3300026121 Bacteria 1873
316 Ga0207683_10271434 3300026121 Bacteria 1549
317 Ga0207683_10546233 3300026121 Bacteria 1071
318 Ga0209281_1000002 3300027111 Bacteria 1924012
319 Ga0268266_10114756 3300028379 Bacteria 2390
320 Ga0268266_10127516 3300028379 Bacteria 2272
321 Ga0268266_11526741 3300028379 Bacteria 643
322 Ga0268264_12530875 3300028381 Bacteria 518
323 Ga0307515_10001264 3300028794 Bacteria 57666
324 Ga0314311_1001570 3300030733 Bacteria 609
325 Ga0316183_1120504 3300030742 Bacteria 655
326 Ga0316182_1306980 3300030745 Bacteria 957
327 Ga0265327_10000465 3300031251 Bacteria 72062
328 Ga0265327_10022499 3300031251 Bacteria 3766
329 Ga0265327_10135056 3300031251 Bacteria 1157
330 Ga0307513_10277026 3300031456 Bacteria 1457
331 Ga0307408_100013471 3300031548 Bacteria 5428
332 Ga0307408_100044752 3300031548 Bacteria 3156
333 Ga0307408_100143042 3300031548 Bacteria 1879
334 Ga0307408_100573053 3300031548 Bacteria 999
335 Ga0307514_10001952 3300031649 Bacteria 22533
336 Ga0307405_10023219 3300031731 Bacteria 3521
337 Ga0307405_10087425 3300031731 Bacteria 2054
338 Ga0307405_10259331 3300031731 Bacteria 1297
339 Ga0307405_11082653 3300031731 Bacteria 688
340 Ga0307405_11362662 3300031731 Bacteria 619
341 Ga0307406_10000194 3300031901 Bacteria 36252
342 Ga0307406_10282340 3300031901 Bacteria 1267
343 Ga0307406_11893398 3300031901 Bacteria 532
344 Ga0307412_10005778 3300031911 Bacteria 6957
345 Ga0307412_10015702 3300031911 Bacteria 4495
346 Ga0307412_10298548 3300031911 Bacteria 1272
347 Ga0307412_10737881 3300031911 Bacteria 849
348 Ga0307416_100123854 3300032002 Bacteria 2311
349 Ga0307416_100135504 3300032002 Bacteria 2226
350 Ga0307416_102371027 3300032002 Bacteria 630
351 Ga0307414_10651544 3300032004 Bacteria 949
352 Ga0307414_11150471 3300032004 Bacteria 718
353 Ga0307414_12229461 3300032004 Bacteria 511
354 Ga0307411_10150192 3300032005 Bacteria 1730
355 Ga0307411_10597496 3300032005 Bacteria 948
356 Ga0307411_11784866 3300032005 Bacteria 571
357 Ga0373961_0443146 3300035241 Bacteria 505
358 Ga0373935_1095415 3300035692 Bacteria 593
359 Ga0395899_0001705 3300037312 Bacteria 18309
360 Ga0395900_0001713 3300037418 Bacteria 25348
361 Ga0395898_0011212 3300037466 Bacteria 9329
362 Ga0395905_0000144 3300037471 Bacteria 117622
363 Ga0395905_0320914 3300037471 Bacteria 1438
364 Ga0395905_0637097 3300037471 Bacteria 968
365 Ga0395905_0953744 3300037471 Bacteria 761
366 Ga0395901_0004147 3300038443 Bacteria 14621
367 Ga0436361_0139980 3300039447 Bacteria 21951
368 Ga0436361_0408019 3300039447 Bacteria 3912
369 Ga0436361_0602324 3300039447 Bacteria 38715
370 Ga0436361_1187046 3300039447 Bacteria 1772
371 Ga0439436_0003275 3300041404 Bacteria 4911
372 Ga0439436_0013836 3300041404 Bacteria 2438
373 Ga0439438_001381 3300041405 Bacteria 10707
374 Ga0439438_011801 3300041405 Bacteria 2704
375 Ga0439439_0029943 3300041406 Bacteria 1382
376 Ga0439447_001131 3300041407 Bacteria 9710
377 Ga0439447_032405 3300041407 Bacteria 1306
378 Ga0439447_051043 3300041407 Bacteria 988
379 Ga0439461_0052777 3300041410 Bacteria 905
380 Ga0439466_0008829 3300041411 Bacteria 3791
381 Ga0439466_0036039 3300041411 Bacteria 1671
382 Ga0451791_1414600 3300041451 Bacteria 557
383 Ga0451793_0940603 3300041452 Bacteria 796
384 Ga0451795_0585879 3300041456 Bacteria 1043
385 Ga0451795_1554129 3300041456 Bacteria 636
386 Ga0451807_0295848 3300041486 Bacteria 567
387 Ga0451807_0385540 3300041486 Bacteria 546
388 Ga0451807_2171065 3300041486 Bacteria 583
389 Ga0451841_0777977 3300041498 Bacteria 521
390 Ga0451853_1953379 3300041512 Bacteria 544
391 Ga0439431_0241727 3300041997 Bacteria 534
392 Ga0439433_0034065 3300041999 Bacteria 1171
393 Ga0439442_031559 3300042002 Bacteria 1107
394 Ga0439432_004127 3300042006 Bacteria 5308
395 Ga0439432_004182 3300042006 Bacteria 5278
396 Ga0439449_0007495 3300042007 Bacteria 4146
397 Ga0439452_002519 3300042010 Bacteria 6738
398 Ga0439452_008408 3300042010 Bacteria 3107
399 Ga0439455_0175266 3300042012 Bacteria 617
400 Ga0439462_0007505 3300042015 Bacteria 2731
401 Ga0450911_012040 3300042115 Bacteria 1172
402 Ga0450923_004077 3300042125 Bacteria 2268
403 Ga0450897_002620 3300042128 Bacteria 1370
404 Ga0450894_003677 3300042131 Bacteria 2003
405 Ga0450896_014769 3300042133 Bacteria 1115
406 Ga0450898_016955 3300042134 Bacteria 1248
407 Ga0450898_018735 3300042134 Bacteria 1202
408 Ga0450899_004960 3300042135 Bacteria 1427
409 Ga0450906_013193 3300042145 Bacteria 1527
410 Ga0450910_017831 3300042147 Bacteria 1058
411 Ga0439446_0002193 3300042156 Bacteria 4652
412 Ga0439446_0188892 3300042156 Bacteria 691
413 Ga0450908_003708 3300042184 Bacteria 2963
414 Ga0450909_001072 3300042185 Bacteria 3767
415 Ga0439434_0001685 3300042435 Bacteria 6404
416 Ga0439434_0001880 3300042435 Bacteria 6104
417 Ga0450893_0019801 3300042532 Bacteria 1153
418 Ga0466970_0001601 3300044765 Bacteria 10920
419 Ga0466957_0012882 3300044842 Bacteria 4847
420 Ga0466957_0301481 3300044842 Bacteria 1077
421 Ga0466960_0077707 3300044901 Bacteria 1665
422 Ga0466959_0026452 3300045049 Bacteria 4300
423 Ga0495627_057006 3300046453 Bacteria 1163
424 Ga0495592_0879393 3300046454 Bacteria 528
425 Ga0495603_0586667 3300046455 Bacteria 638
426 Ga0495629_0071622 3300046459 Bacteria 2419
427 Ga0495629_0319809 3300046459 Bacteria 1061
428 Ga0495638_0130536 3300046460 Bacteria 1476
429 Ga0495651_0244418 3300046462 Bacteria 1229
430 Ga0495650_0019956 3300046471 Bacteria 3281
431 Ga0495582_0349743 3300046473 Bacteria 851
432 Ga0495639_0002606 3300046475 Bacteria 7848
433 Ga0495607_0031268 3300046501 Bacteria 3259
434 Ga0495606_0117860 3300046507 Bacteria 1593
435 Ga0495608_0344204 3300046511 Bacteria 918
436 Ga0495610_0034593 3300046512 Bacteria 2601
437 Ga0495616_0022482 3300046513 Bacteria 3406
438 Ga0495618_0362552 3300046514 Bacteria 892
439 Ga0495618_0404188 3300046514 Bacteria 835
440 Ga0495620_0188437 3300046515 Bacteria 796
441 Ga0495628_0276025 3300046516 Bacteria 1249
442 Ga0495631_0004180 3300046518 Bacteria 7726
443 Ga0495632_0001429 3300046519 Bacteria 19891
444 Ga0495643_0002080 3300046522 Bacteria 16559
445 Ga0495644_0354482 3300046523 Bacteria 578
446 Ga0495663_0083933 3300046525 Bacteria 1029
447 Ga0495666_0162654 3300046526 Bacteria 1035
448 Ga0495642_0259121 3300046528 Bacteria 760
449 Ga0495652_0504102 3300046529 Bacteria 839
450 Ga0495654_0000307 3300046530 Bacteria 43179
451 Ga0495654_0108283 3300046530 Bacteria 1270
452 Ga0495640_0139290 3300046533 Bacteria 1565
453 Ga0495586_0163708 3300046535 Bacteria 1255
454 Ga0495587_0437486 3300046536 Bacteria 725
455 Ga0495621_0008890 3300046539 Bacteria 3028
456 Ga0495621_0064111 3300046539 Bacteria 1340
457 Ga0495621_0502267 3300046539 Bacteria 523
458 Ga0495622_0247180 3300046557 Bacteria 785
459 Ga0495622_0427722 3300046557 Bacteria 569
460 Ga0495656_0006966 3300046615 Bacteria 3979
461 Ga0495656_0650503 3300046615 Bacteria 566
462 Ga0495625_0239607 3300046660 Bacteria 1181
463 Ga0495635_0165803 3300046663 Bacteria 1503
464 Ga0495635_0271597 3300046663 Bacteria 1140
465 Ga0495659_0223485 3300046664 Bacteria 778
466 Ga0495661_0001352 3300046665 Bacteria 20780
467 Ga0495588_0123969 3300046674 Bacteria 1362
468 Ga0495588_0189141 3300046674 Bacteria 1087
469 Ga0495588_0382270 3300046674 Bacteria 739
470 Ga0495657_0419608 3300046675 Bacteria 786
471 Ga0495599_0312125 3300046678 Bacteria 948
472 Ga0495623_0609066 3300046679 Bacteria 567
473 Ga0495658_0265295 3300046683 Bacteria 1081
474 Ga0495624_0278647 3300046690 Bacteria 1010
475 Ga0495624_0335929 3300046690 Bacteria 909
476 Ga0495670_0022371 3300046691 Bacteria 3122
477 Ga0495670_0025111 3300046691 Bacteria 2947
478 Ga0495670_0205712 3300046691 Bacteria 1043
479 Ga0495671_0093915 3300046692 Bacteria 1468
480 Ga0495600_0051794 3300046809 Bacteria 2680
481 Ga0495600_0579526 3300046809 Bacteria 683
482 Ga0495600_0680218 3300046809 Bacteria 620
483 Ga0495604_0709894 3300047317 Bacteria 638
484 Ga0495672_0107161 3300047320 Bacteria 1505
485 Ga0495676_0231657 3300047321 Bacteria 1268
486 Ga0495676_0317534 3300047321 Bacteria 1047
487 Ga0495680_0690500 3300047322 Bacteria 675
488 Ga0495677_0004045 3300047445 Bacteria 5659
489 Ga0495686_0478029 3300047472 Bacteria 659
490 Ga0495593_0079212 3300047673 Bacteria 1700
491 Ga0495602_0795634 3300048088 Bacteria 635
492 Ga0495614_0143376 3300048089 Bacteria 1062
493 Ga0495615_0002030 3300048090 Bacteria 3155
494 Ga0495626_0002678 3300048091 Bacteria 12044
495 Ga0496100_0014235 3300048903 Bacteria 4613
496 Ga0496101_0004822 3300048904 Bacteria 8557
497 Ga0496102_0027383 3300048905 Bacteria 5090
498 Ga0496102_0195534 3300048905 Bacteria 1906
499 Ga0496103_0026228 3300048906 Bacteria 3528
500 Ga0496104_0027034 3300048907 Bacteria 5305
501 Ga0496105_0001248 3300048908 Bacteria 17765
502 Ga0496105_1116673 3300048908 Bacteria 584
503 Ga0496106_0218221 3300048909 Bacteria 1520
504 Ga0496106_0563630 3300048909 Bacteria 914
505 Ga0496107_0023692 3300048910 Bacteria 4339
506 Ga0496107_0846812 3300048910 Bacteria 668
507 Ga0496108_0184649 3300048911 Bacteria 1806
508 Ga0496109_0060743 3300048912 Bacteria 3454
509 Ga0496110_0343761 3300048913 Bacteria 1359
510 Ga0496110_0492361 3300048913 Bacteria 1116
511 Ga0496110_0561720 3300048913 Bacteria 1037
512 Ga0496110_1412608 3300048913 Bacteria 605
513 Ga0496111_0087566 3300048914 Bacteria 2279
514 Ga0496111_0714059 3300048914 Bacteria 728
515 Ga0496114_0192344 3300048917 Bacteria 1785
516 Ga0496114_1119673 3300048917 Bacteria 672
517 Ga0496115_1030729 3300048918 Bacteria 627
518 Ga0496116_0014246 3300048919 Bacteria 6360
519 Ga0496116_0030472 3300048919 Bacteria 3874
520 Ga0496117_0035438 3300048920 Bacteria 3745
521 Ga0496117_0037362 3300048920 Bacteria 3619
522 Ga0496117_0256910 3300048920 Bacteria 949
523 Ga0496118_0041873 3300048921 Bacteria 3620
524 Ga0496118_0141949 3300048921 Bacteria 1520
525 Ga0496120_0187145 3300048923 Bacteria 1012
526 Ga0496121_0042532 3300048924 Bacteria 3949
527 Ga0496121_0046495 3300048924 Bacteria 3714
528 Ga0496121_0081078 3300048924 Bacteria 2570
529 Ga0496121_0128980 3300048924 Bacteria 1896
530 Ga0496122_0081081 3300048925 Bacteria 2260
531 Ga0496122_0182470 3300048925 Bacteria 1250
532 Ga0496122_0251477 3300048925 Bacteria 988
533 Ga0496122_0281222 3300048925 Bacteria 909
534 Ga0496122_0387402 3300048925 Bacteria 715
535 Ga0496123_0061048 3300048926 Bacteria 2426
536 Ga0496123_0134951 3300048926 Bacteria 1360
537 Ga0496123_0158164 3300048926 Bacteria 1212
538 Ga0496123_0197740 3300048926 Bacteria 1033
539 Ga0496123_0422433 3300048926 Bacteria 601
540 Ga0496124_0126873 3300048927 Bacteria 2031
541 Ga0496124_0136856 3300048927 Bacteria 1938
542 Ga0496124_0205958 3300048927 Bacteria 1492
543 Ga0496125_0023627 3300048928 Bacteria 5669
544 Ga0496125_0087011 3300048928 Bacteria 2361
545 Ga0496125_0245385 3300048928 Bacteria 1134
546 Ga0496125_0271219 3300048928 Bacteria 1057
547 Ga0496125_0280281 3300048928 Bacteria 1033
548 Ga0496125_0351585 3300048928 Bacteria 880
549 Ga0496126_0068212 3300048929 Bacteria 3176
550 Ga0496126_0255434 3300048929 Bacteria 1459
551 Ga0496126_0266135 3300048929 Bacteria 1424
552 Ga0496126_0470131 3300048929 Bacteria 1009
553 Ga0501032_0020271 3300049569 Bacteria 4634
554 Ga0501034_0081791 3300049571 Bacteria 3232
555 Ga0501037_0206066 3300049573 Bacteria 1388
556 Ga0501039_0054624 3300049575 Bacteria 3092
557 nmdc:mga03683_13376_c1 3300050489 Bacteria 3019
558 nmdc:mga03683_18969_c1 3300050489 Bacteria 2621
559 nmdc:mga03n38_54909_c1 3300050490 Bacteria 1792
560 nmdc:mga0k408_212978_c1 3300050493 Bacteria 1154
561 nmdc:mga0k408_814591_c1 3300050493 Bacteria 544
562 nmdc:mga07m45_14964_c1 3300050496 Bacteria 4141
563 nmdc:mga07m45_275492_c1 3300050496 Bacteria 979
564 nmdc:mga07m45_341351_c1 3300050496 Bacteria 870
565 nmdc:mga07m45_590719_c1 3300050496 Bacteria 641
566 nmdc:mga07m45_87206_c1 3300050496 Bacteria 1786
567 nmdc:mga07m45_875220_c1 3300050496 Bacteria 514
568 Ga0495612_0231383 3300053078 Bacteria 820
569 Ga0500635_0357873 3300053080 Bacteria 578
570 Ga0500578_0719592 3300053086 Bacteria 535
571 Ga0500643_004493 3300053087 Bacteria 6286
572 Ga0500644_0034887 3300053088 Bacteria 1626
573 Ga0500646_0332937 3300053090 Bacteria 550
574 Ga0500651_0000038 3300053093 Bacteria 101707
575 Ga0500562_015907 3300053108 Bacteria 1932
576 Ga0500571_000054 3300053110 Bacteria 35459
577 Ga0500594_0022279 3300053118 Bacteria 1596
578 Ga0500597_014935 3300053120 Bacteria 2924
579 Ga0500607_060588 3300053121 Bacteria 1984
580 Ga0500608_082273 3300053122 Bacteria 1517
581 Ga0500614_217130 3300053123 Bacteria 592
582 Ga0500618_039485 3300053125 Bacteria 1087
583 Ga0500626_019208 3300053128 Bacteria 3030
584 Ga0500655_000123 3300053133 Bacteria 19862
585 Ga0500658_0000237 3300053134 Bacteria 25766
586 Ga0500658_0000266 3300053134 Bacteria 23921
587 Ga0500559_0008198 3300053136 Bacteria 4594
588 Ga0500564_024230 3300053138 Bacteria 2785
589 Ga0500568_0049520 3300053139 Bacteria 1657
590 Ga0500574_027974 3300053141 Bacteria 1491
591 Ga0500577_0395232 3300053142 Bacteria 605
592 Ga0500604_0177287 3300053151 Bacteria 730
593 Ga0500616_0030516 3300053153 Bacteria 2960
594 Ga0500616_0037987 3300053153 Bacteria 2603
595 Ga0500619_134753 3300053154 Bacteria 842
596 Ga0500638_015691 3300053162 Bacteria 3481
597 Ga0500636_0254058 3300053177 Bacteria 894
598 Ga0500609_052525 3300053731 Bacteria 567

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2599185214 2599624721 70
2 iso_pu_bacteria 2599185226 2599672417 70
3 iso_pu_bacteria 2599185227 2599685001 70
4 iso_pu_bacteria 2599185229 2599694026 70
5 iso_pu_bacteria 2818991446 2819596099 70
6 iso_pu_bacteria 2831265667 2831270589 70
7 iso_pu_bacteria 2838054893 2838056813 70
8 iso_pu_bacteria 2857537821 2857541983 70
9 iso_pu_bacteria 2885198086 2885201160 70
10 iso_pu_bacteria 2885211737 2885214800 70
11 iso_pu_bacteria 2899924645 2899925450 70
12 iso_pu_bacteria 2928037797 2928038435 70
13 iso_pu_bacteria 2928044640 2928045959 70
14 iso_pu_bacteria 2928051484 2928053640 70
15 iso_pu_bacteria 2928064002 2928067187 70
16 iso_pu_bacteria 2928070936 2928076149 70
17 iso_pu_bacteria 2928084124 2928085132 70
18 3300046501 Ga0495607_0031268 Ga0495607_0031268_1627_1848 71
19 3300046519 Ga0495632_0001429 Ga0495632_0001429_9588_9812 71
20 3300046522 Ga0495643_0002080 Ga0495643_0002080_2295_2519 71
21 3300046665 Ga0495661_0001352 Ga0495661_0001352_3840_4061 71
22 3300047320 Ga0495672_0107161 Ga0495672_0107161_924_1181 71
23 3300047445 Ga0495677_0004045 Ga0495677_0004045_2422_2646 71
24 3300048091 Ga0495626_0002678 Ga0495626_0002678_4074_4298 71
25 3300048929 Ga0496126_0068212 Ga0496126_0068212_2818_3036 71
26 3300048929 Ga0496126_0266135 Ga0496126_0266135_98_316 71
27 3300003316 rootH1_10023287 rootH1_100232872 72
28 3300003762 Ga0055542_1004738 Ga0055542_10047383 72
29 3300003781 Ga0055536_1050417 Ga0055536_10504172 72
30 3300005327 Ga0070658_10293938 Ga0070658_102939382 72
31 3300005331 Ga0070670_100816493 Ga0070670_1008164932 72
32 3300005333 Ga0070677_10545674 Ga0070677_105456741 72
33 3300005339 Ga0070660_100722101 Ga0070660_1007221012 72
34 3300005347 Ga0070668_100756240 Ga0070668_1007562402 72
35 3300005353 Ga0070669_101521397 Ga0070669_1015213971 72
36 3300005354 Ga0070675_101623028 Ga0070675_1016230281 72
37 3300005355 Ga0070671_100659816 Ga0070671_1006598162 72
38 3300005356 Ga0070674_102206699 Ga0070674_1022066991 72
39 3300005364 Ga0070673_100391687 Ga0070673_1003916872 72
40 3300005364 Ga0070673_101996013 Ga0070673_1019960132 72
41 3300005365 Ga0070688_101510865 Ga0070688_1015108651 72
42 3300005367 Ga0070667_100015926 Ga0070667_1000159263 72
43 3300005367 Ga0070667_101401403 Ga0070667_1014014031 72
44 3300005456 Ga0070678_100664812 Ga0070678_1006648122 72
45 3300005466 Ga0070685_10269930 Ga0070685_102699302 72
46 3300005543 Ga0070672_100117095 Ga0070672_1001170953 72
47 3300005548 Ga0070665_100074476 Ga0070665_1000744762 72
48 3300005548 Ga0070665_100083840 Ga0070665_1000838403 72
49 3300005548 Ga0070665_101816039 Ga0070665_1018160392 72
50 3300005563 Ga0068855_100033501 Ga0068855_1000335016 72
51 3300005578 Ga0068854_100000568 Ga0068854_1000005689 72
52 3300005616 Ga0068852_101011222 Ga0068852_1010112222 72
53 3300005834 Ga0068851_10442209 Ga0068851_104422092 72
54 3300005841 Ga0068863_100700414 Ga0068863_1007004142 72
55 3300005843 Ga0068860_100333651 Ga0068860_1003336512 72
56 3300006163 Ga0070715_10891459 Ga0070715_108914592 72
57 3300006237 Ga0097621_101038054 Ga0097621_1010380542 72
58 3300006237 Ga0097621_101467662 Ga0097621_1014676622 72
59 3300006237 Ga0097621_101662662 Ga0097621_1016626622 72
60 3300006881 Ga0068865_101528475 Ga0068865_1015284752 72
61 3300009036 Ga0105244_10093926 Ga0105244_100939262 72
62 3300009093 Ga0105240_10665814 Ga0105240_106658143 72
63 3300009101 Ga0105247_11541446 Ga0105247_115414462 72
64 3300009545 Ga0105237_10023997 Ga0105237_100239975 72
65 3300009551 Ga0105238_10000065 Ga0105238_1000006595 72
66 3300009551 Ga0105238_10613020 Ga0105238_106130202 72
67 3300009553 Ga0105249_10492504 Ga0105249_104925042 72
68 3300010375 Ga0105239_10086610 Ga0105239_100866104 72
69 3300013104 Ga0157370_11047683 Ga0157370_110476832 72
70 3300014497 Ga0182008_10005597 Ga0182008_100055975 72
71 3300015261 Ga0182006_1000955 Ga0182006_10009559 72
72 3300015261 Ga0182006_1104965 Ga0182006_11049652 72
73 3300015262 Ga0182007_10000617 Ga0182007_100006179 72
74 3300015265 Ga0182005_1027596 Ga0182005_10275962 72
75 3300015683 Ga0183362_10001 Ga0183362_100011675 72
76 3300017792 Ga0163161_10085194 Ga0163161_100851943 72
77 3300017792 Ga0163161_10128840 Ga0163161_101288402 72
78 3300017792 Ga0163161_10142788 Ga0163161_101427882 72
79 3300017792 Ga0163161_11478487 Ga0163161_114784871 72
80 3300021361 Ga0213872_10000365 Ga0213872_1000036516 72
81 3300021361 Ga0213872_10006128 Ga0213872_100061283 72
82 3300025254 Ga0209148_1002495 Ga0209148_10024955 72
83 3300025273 Ga0209673_1089706 Ga0209673_10897062 72
84 3300025284 Ga0209130_1002576 Ga0209130_10025765 72
85 3300025291 Ga0209675_1028618 Ga0209675_10286183 72
86 3300025292 Ga0209676_1043989 Ga0209676_10439892 72
87 3300025304 Ga0209257_1041264 Ga0209257_10412641 72
88 3300025321 Ga0207656_10330909 Ga0207656_103309092 72
89 3300025728 Ga0207655_1152847 Ga0207655_11528472 72
90 3300025903 Ga0207680_10317254 Ga0207680_103172542 72
91 3300025907 Ga0207645_10549202 Ga0207645_105492022 72
92 3300025909 Ga0207705_10273087 Ga0207705_102730872 72
93 3300025913 Ga0207695_10022412 Ga0207695_100224122 72
94 3300025914 Ga0207671_10016759 Ga0207671_100167596 72
95 3300025919 Ga0207657_10145664 Ga0207657_101456642 72
96 3300025923 Ga0207681_10499487 Ga0207681_104994872 72
97 3300025924 Ga0207694_10000286 Ga0207694_1000028640 72
98 3300025924 Ga0207694_10214173 Ga0207694_102141733 72
99 3300025924 Ga0207694_11891379 Ga0207694_118913792 72
100 3300025926 Ga0207659_10083753 Ga0207659_100837532 72
101 3300025934 Ga0207686_10271816 Ga0207686_102718162 72
102 3300025937 Ga0207669_11283052 Ga0207669_112830522 72
103 3300025938 Ga0207704_10612965 Ga0207704_106129652 72
104 3300025940 Ga0207691_10116568 Ga0207691_101165683 72
105 3300025941 Ga0207711_11823222 Ga0207711_118232222 72
106 3300025960 Ga0207651_10093314 Ga0207651_100933143 72
107 3300025961 Ga0207712_10592789 Ga0207712_105927892 72
108 3300025961 Ga0207712_11118598 Ga0207712_111185982 72
109 3300025972 Ga0207668_10404364 Ga0207668_104043642 72
110 3300025981 Ga0207640_10028597 Ga0207640_100285975 72
111 3300025986 Ga0207658_10224090 Ga0207658_102240902 72
112 3300026041 Ga0207639_12229242 Ga0207639_122292422 72
113 3300026088 Ga0207641_10853664 Ga0207641_108536642 72
114 3300026089 Ga0207648_10443011 Ga0207648_104430112 72
115 3300026121 Ga0207683_10188260 Ga0207683_101882602 72
116 3300026121 Ga0207683_10546233 Ga0207683_105462331 72
117 3300028379 Ga0268266_10127516 Ga0268266_101275162 72
118 3300028379 Ga0268266_11526741 Ga0268266_115267412 72
119 3300028381 Ga0268264_12530875 Ga0268264_125308752 72
120 3300031251 Ga0265327_10000465 Ga0265327_1000046555 72
121 3300031251 Ga0265327_10022499 Ga0265327_100224994 72
122 3300031251 Ga0265327_10135056 Ga0265327_101350562 72
123 3300031731 Ga0307405_11362662 Ga0307405_113626622 72
124 3300031901 Ga0307406_11893398 Ga0307406_118933982 72
125 3300035692 Ga0373935_1095415 Ga0373935_1095415_38_259 72
126 3300037471 Ga0395905_0000144 Ga0395905_0000144_103523_103750 72
127 3300037471 Ga0395905_0953744 Ga0395905_0953744_164_403 72
128 3300039447 Ga0436361_0139980 Ga0436361_0139980_2428_2664 72
129 3300041404 Ga0439436_0013836 Ga0439436_0013836_328_561 72
130 3300041405 Ga0439438_001381 Ga0439438_001381_4358_4591 72
131 3300041407 Ga0439447_001131 Ga0439447_001131_2446_2679 72
132 3300041411 Ga0439466_0036039 Ga0439466_0036039_404_637 72
133 3300041486 Ga0451807_2171065 Ga0451807_2171065_212_433 72
134 3300041512 Ga0451853_1953379 Ga0451853_1953379_29_250 72
135 3300042006 Ga0439432_004182 Ga0439432_004182_4358_4591 72
136 3300042010 Ga0439452_002519 Ga0439452_002519_1521_1754 72
137 3300042115 Ga0450911_012040 Ga0450911_012040_691_924 72
138 3300042156 Ga0439446_0002193 Ga0439446_0002193_1826_2059 72
139 3300042435 Ga0439434_0001685 Ga0439434_0001685_2130_2363 72
140 3300044765 Ga0466970_0001601 Ga0466970_0001601_7213_7443 72
141 3300044842 Ga0466957_0012882 Ga0466957_0012882_1410_1628 72
142 3300045049 Ga0466959_0026452 Ga0466959_0026452_561_791 72
143 3300046471 Ga0495650_0019956 Ga0495650_0019956_2394_2621 72
144 3300046514 Ga0495618_0362552 Ga0495618_0362552_639_857 72
145 3300046529 Ga0495652_0504102 Ga0495652_0504102_347_580 72
146 3300046664 Ga0495659_0223485 Ga0495659_0223485_392_616 72
147 3300046675 Ga0495657_0419608 Ga0495657_0419608_46_264 72
148 3300046678 Ga0495599_0312125 Ga0495599_0312125_523_741 72
149 3300046809 Ga0495600_0579526 Ga0495600_0579526_275_493 72
150 3300046809 Ga0495600_0680218 Ga0495600_0680218_330_548 72
151 3300048924 Ga0496121_0081078 Ga0496121_0081078_1367_1603 72
152 3300048926 Ga0496123_0422433 Ga0496123_0422433_123_359 72
153 3300048929 Ga0496126_0255434 Ga0496126_0255434_207_428 72
154 3300049569 Ga0501032_0020271 Ga0501032_0020271_2015_2248 72
155 3300049571 Ga0501034_0081791 Ga0501034_0081791_67_300 72
156 3300049573 Ga0501037_0206066 Ga0501037_0206066_525_758 72
157 3300049575 Ga0501039_0054624 Ga0501039_0054624_107_340 72
158 3300053080 Ga0500635_0357873 Ga0500635_0357873_195_416 72
159 3300053142 Ga0500577_0395232 Ga0500577_0395232_271_489 72
160 3300053151 Ga0500604_0177287 Ga0500604_0177287_255_476 72
161 3300053731 Ga0500609_052525 Ga0500609_052525_300_521 72
162 iso_pu_bacteria 2511231026 2511383270 72
163 iso_pu_bacteria 2521172590 2521557417 72
164 iso_pu_bacteria 2551306416 2553005235 72
165 iso_pu_bacteria 2839094727 2839098841 72
166 iso_pu_bacteria 2904439833 2904439844 72
167 iso_pu_bacteria 2904530477 2904531204 72
168 iso_pu_bacteria 2904584206 2904587141 72
169 iso_pu_bacteria 2904589729 2904592825 72
170 iso_pu_bacteria 2904601388 2904604402 72
171 iso_pu_bacteria 2919046199 2919050161 72
172 iso_pu_bacteria 2919079590 2919082214 72
173 iso_pu_bacteria 2923510766 2923516080 72
174 3300003578 Ga0006562J51391_1118556 Ga0006562J51391_11185562 73
175 3300003578 Ga0006562J51391_1118558 Ga0006562J51391_11185582 73
176 3300003781 Ga0055536_1009558 Ga0055536_10095582 73
177 3300003791 Ga0055530_10013054 Ga0055530_100130542 73
178 3300003792 Ga0055540_1002232 Ga0055540_100223211 73
179 3300003792 Ga0055540_1009260 Ga0055540_10092602 73
180 3300003792 Ga0055540_1010547 Ga0055540_10105474 73
181 3300003794 Ga0055531_10006424 Ga0055531_100064242 73
182 3300003794 Ga0055531_10065334 Ga0055531_100653341 73
183 3300005288 Ga0065714_10099269 Ga0065714_100992691 73
184 3300005288 Ga0065714_10218370 Ga0065714_102183702 73
185 3300005289 Ga0065704_10155066 Ga0065704_101550662 73
186 3300005339 Ga0070660_101246555 Ga0070660_1012465551 73
187 3300005366 Ga0070659_100052983 Ga0070659_1000529831 73
188 3300005445 Ga0070708_100535277 Ga0070708_1005352772 73
189 3300005457 Ga0070662_100018544 Ga0070662_1000185444 73
190 3300005539 Ga0068853_100078751 Ga0068853_1000787512 73
191 3300005564 Ga0070664_100267954 Ga0070664_1002679542 73
192 3300005577 Ga0068857_100141486 Ga0068857_1001414862 73
193 3300005578 Ga0068854_102220245 Ga0068854_1022202452 73
194 3300005834 Ga0068851_10482818 Ga0068851_104828181 73
195 3300005840 Ga0068870_10455324 Ga0068870_104553242 73
196 3300006042 Ga0075368_10119415 Ga0075368_101194151 73
197 3300006048 Ga0075363_100291663 Ga0075363_1002916632 73
198 3300006048 Ga0075363_100464406 Ga0075363_1004644062 73
199 3300006058 Ga0075432_10013889 Ga0075432_100138892 73
200 3300006177 Ga0075362_10045591 Ga0075362_100455912 73
201 3300006178 Ga0075367_10217421 Ga0075367_102174212 73
202 3300006186 Ga0075369_10027031 Ga0075369_100270312 73
203 3300006195 Ga0075366_10092471 Ga0075366_100924713 73
204 3300006195 Ga0075366_10596656 Ga0075366_105966561 73
205 3300006353 Ga0075370_10002278 Ga0075370_100022785 73
206 3300006353 Ga0075370_10011877 Ga0075370_100118772 73
207 3300006353 Ga0075370_10725932 Ga0075370_107259322 73
208 3300006358 Ga0068871_101769182 Ga0068871_1017691821 73
209 3300006881 Ga0068865_100327046 Ga0068865_1003270462 73
210 3300006946 Ga0079104_1000226 Ga0079104_10002268 73
211 3300009036 Ga0105244_10001011 Ga0105244_1000101116 73
212 3300009092 Ga0105250_10000526 Ga0105250_1000052618 73
213 3300009098 Ga0105245_10541256 Ga0105245_105412562 73
214 3300009148 Ga0105243_10002414 Ga0105243_1000241415 73
215 3300009148 Ga0105243_10007533 Ga0105243_100075335 73
216 3300009148 Ga0105243_10011391 Ga0105243_100113913 73
217 3300009174 Ga0105241_10212738 Ga0105241_102127382 73
218 3300009176 Ga0105242_10375552 Ga0105242_103755522 73
219 3300009545 Ga0105237_11023700 Ga0105237_110237002 73
220 3300009551 Ga0105238_10413950 Ga0105238_104139502 73
221 3300011119 Ga0105246_10243772 Ga0105246_102437722 73
222 3300012478 Ga0157328_1007993 Ga0157328_10079932 73
223 3300013100 Ga0157373_10039688 Ga0157373_100396884 73
224 3300013100 Ga0157373_10135247 Ga0157373_101352473 73
225 3300013102 Ga0157371_10591359 Ga0157371_105913591 73
226 3300013104 Ga0157370_10111341 Ga0157370_101113413 73
227 3300013105 Ga0157369_10451678 Ga0157369_104516782 73
228 3300013306 Ga0163162_10655089 Ga0163162_106550892 73
229 3300014497 Ga0182008_10013054 Ga0182008_100130542 73
230 3300014497 Ga0182008_10098018 Ga0182008_100980182 73
231 3300014497 Ga0182008_10100052 Ga0182008_101000522 73
232 3300014969 Ga0157376_10108399 Ga0157376_101083993 73
233 3300015261 Ga0182006_1016469 Ga0182006_10164694 73
234 3300015261 Ga0182006_1099154 Ga0182006_10991542 73
235 3300015262 Ga0182007_10003714 Ga0182007_100037145 73
236 3300015265 Ga0182005_1049536 Ga0182005_10495362 73
237 3300025292 Ga0209676_1001320 Ga0209676_10013206 73
238 3300025292 Ga0209676_1001396 Ga0209676_10013967 73
239 3300025294 Ga0209025_1000096 Ga0209025_100009634 73
240 3300025298 Ga0209050_1002090 Ga0209050_10020904 73
241 3300025303 Ga0209051_1000092 Ga0209051_1000092142 73
242 3300025303 Ga0209051_1000490 Ga0209051_100049043 73
243 3300025303 Ga0209051_1000944 Ga0209051_10009447 73
244 3300025304 Ga0209257_1000508 Ga0209257_100050853 73
245 3300025304 Ga0209257_1018534 Ga0209257_10185343 73
246 3300025711 Ga0207696_1001349 Ga0207696_100134910 73
247 3300025728 Ga0207655_1018003 Ga0207655_10180032 73
248 3300025901 Ga0207688_10789298 Ga0207688_107892982 73
249 3300025911 Ga0207654_11432739 Ga0207654_114327391 73
250 3300025924 Ga0207694_10769101 Ga0207694_107691011 73
251 3300025925 Ga0207650_10448127 Ga0207650_104481272 73
252 3300025927 Ga0207687_10530706 Ga0207687_105307062 73
253 3300025932 Ga0207690_10031808 Ga0207690_100318084 73
254 3300025933 Ga0207706_10088954 Ga0207706_100889542 73
255 3300025935 Ga0207709_10000165 Ga0207709_1000016531 73
256 3300025935 Ga0207709_10000785 Ga0207709_100007855 73
257 3300025935 Ga0207709_10001556 Ga0207709_1000155614 73
258 3300025935 Ga0207709_10036159 Ga0207709_100361592 73
259 3300025935 Ga0207709_10987384 Ga0207709_109873842 73
260 3300025938 Ga0207704_10464657 Ga0207704_104646572 73
261 3300025942 Ga0207689_10289125 Ga0207689_102891252 73
262 3300025945 Ga0207679_10048660 Ga0207679_100486604 73
263 3300025972 Ga0207668_10297978 Ga0207668_102979781 73
264 3300026041 Ga0207639_10084577 Ga0207639_100845772 73
265 3300026041 Ga0207639_10916502 Ga0207639_109165022 73
266 3300026067 Ga0207678_11632663 Ga0207678_116326632 73
267 3300026116 Ga0207674_10215482 Ga0207674_102154822 73
268 3300026116 Ga0207674_10385264 Ga0207674_103852642 73
269 3300026121 Ga0207683_10144960 Ga0207683_101449602 73
270 3300027111 Ga0209281_1000002 Ga0209281_1000002220 73
271 3300028794 Ga0307515_10001264 Ga0307515_1000126443 73
272 3300030733 Ga0314311_1001570 Ga0314311_10015702 73
273 3300031456 Ga0307513_10277026 Ga0307513_102770262 73
274 3300031548 Ga0307408_100013471 Ga0307408_1000134712 73
275 3300031548 Ga0307408_100044752 Ga0307408_1000447523 73
276 3300031548 Ga0307408_100143042 Ga0307408_1001430421 73
277 3300031548 Ga0307408_100573053 Ga0307408_1005730532 73
278 3300031649 Ga0307514_10001952 Ga0307514_100019526 73
279 3300031731 Ga0307405_10023219 Ga0307405_100232194 73
280 3300031731 Ga0307405_10087425 Ga0307405_100874252 73
281 3300031731 Ga0307405_10259331 Ga0307405_102593311 73
282 3300031731 Ga0307405_11082653 Ga0307405_110826532 73
283 3300031901 Ga0307406_10000194 Ga0307406_1000019416 73
284 3300031901 Ga0307406_10282340 Ga0307406_102823402 73
285 3300031911 Ga0307412_10005778 Ga0307412_100057783 73
286 3300031911 Ga0307412_10015702 Ga0307412_100157025 73
287 3300031911 Ga0307412_10298548 Ga0307412_102985482 73
288 3300031911 Ga0307412_10737881 Ga0307412_107378812 73
289 3300032002 Ga0307416_100123854 Ga0307416_1001238543 73
290 3300032002 Ga0307416_100135504 Ga0307416_1001355043 73
291 3300032002 Ga0307416_102371027 Ga0307416_1023710272 73
292 3300032004 Ga0307414_10651544 Ga0307414_106515442 73
293 3300032004 Ga0307414_11150471 Ga0307414_111504712 73
294 3300032004 Ga0307414_12229461 Ga0307414_122294611 73
295 3300032005 Ga0307411_10150192 Ga0307411_101501922 73
296 3300032005 Ga0307411_10597496 Ga0307411_105974962 73
297 3300037471 Ga0395905_0320914 Ga0395905_0320914_1045_1281 73
298 3300037471 Ga0395905_0637097 Ga0395905_0637097_673_909 73
299 3300039447 Ga0436361_0408019 Ga0436361_0408019_2125_2346 73
300 3300041404 Ga0439436_0003275 Ga0439436_0003275_1305_1526 73
301 3300041405 Ga0439438_011801 Ga0439438_011801_444_665 73
302 3300041406 Ga0439439_0029943 Ga0439439_0029943_119_340 73
303 3300041407 Ga0439447_032405 Ga0439447_032405_579_800 73
304 3300041407 Ga0439447_051043 Ga0439447_051043_496_717 73
305 3300041410 Ga0439461_0052777 Ga0439461_0052777_60_281 73
306 3300041411 Ga0439466_0008829 Ga0439466_0008829_865_1086 73
307 3300041451 Ga0451791_1414600 Ga0451791_1414600_75_296 73
308 3300041456 Ga0451795_1554129 Ga0451795_1554129_337_558 73
309 3300041486 Ga0451807_0385540 Ga0451807_0385540_215_439 73
310 3300041997 Ga0439431_0241727 Ga0439431_0241727_260_481 73
311 3300041999 Ga0439433_0034065 Ga0439433_0034065_461_682 73
312 3300042002 Ga0439442_031559 Ga0439442_031559_855_1076 73
313 3300042006 Ga0439432_004127 Ga0439432_004127_2919_3140 73
314 3300042007 Ga0439449_0007495 Ga0439449_0007495_1040_1261 73
315 3300042010 Ga0439452_008408 Ga0439452_008408_53_274 73
316 3300042012 Ga0439455_0175266 Ga0439455_0175266_53_274 73
317 3300042015 Ga0439462_0007505 Ga0439462_0007505_1890_2111 73
318 3300042125 Ga0450923_004077 Ga0450923_004077_726_947 73
319 3300042128 Ga0450897_002620 Ga0450897_002620_689_910 73
320 3300042131 Ga0450894_003677 Ga0450894_003677_1358_1579 73
321 3300042133 Ga0450896_014769 Ga0450896_014769_370_591 73
322 3300042134 Ga0450898_016955 Ga0450898_016955_599_820 73
323 3300042135 Ga0450899_004960 Ga0450899_004960_290_511 73
324 3300042145 Ga0450906_013193 Ga0450906_013193_644_865 73
325 3300042147 Ga0450910_017831 Ga0450910_017831_278_499 73
326 3300042156 Ga0439446_0188892 Ga0439446_0188892_248_469 73
327 3300042184 Ga0450908_003708 Ga0450908_003708_2061_2282 73
328 3300042185 Ga0450909_001072 Ga0450909_001072_1990_2211 73
329 3300042435 Ga0439434_0001880 Ga0439434_0001880_2916_3137 73
330 3300042532 Ga0450893_0019801 Ga0450893_0019801_517_738 73
331 3300044842 Ga0466957_0301481 Ga0466957_0301481_624_845 73
332 3300044901 Ga0466960_0077707 Ga0466960_0077707_317_541 73
333 3300046453 Ga0495627_057006 Ga0495627_057006_699_920 73
334 3300046507 Ga0495606_0117860 Ga0495606_0117860_879_1100 73
335 3300046514 Ga0495618_0404188 Ga0495618_0404188_500_721 73
336 3300046530 Ga0495654_0000307 Ga0495654_0000307_37800_38021 73
337 3300046674 Ga0495588_0123969 Ga0495588_0123969_532_753 73
338 3300046692 Ga0495671_0093915 Ga0495671_0093915_74_307 73
339 3300048905 Ga0496102_0195534 Ga0496102_0195534_579_800 73
340 3300048919 Ga0496116_0014246 Ga0496116_0014246_365_586 73
341 3300048920 Ga0496117_0256910 Ga0496117_0256910_76_297 73
342 3300048921 Ga0496118_0141949 Ga0496118_0141949_1038_1259 73
343 3300048924 Ga0496121_0046495 Ga0496121_0046495_3217_3438 73
344 3300048925 Ga0496122_0081081 Ga0496122_0081081_58_279 73
345 3300048925 Ga0496122_0251477 Ga0496122_0251477_321_542 73
346 3300048926 Ga0496123_0197740 Ga0496123_0197740_586_807 73
347 3300048927 Ga0496124_0136856 Ga0496124_0136856_291_512 73
348 3300048927 Ga0496124_0205958 Ga0496124_0205958_265_486 73
349 3300048928 Ga0496125_0023627 Ga0496125_0023627_4070_4291 73
350 3300048928 Ga0496125_0245385 Ga0496125_0245385_278_499 73
351 3300048928 Ga0496125_0271219 Ga0496125_0271219_485_706 73
352 3300050489 nmdc:mga03683_13376_c1 nmdc:mga03683_13376_c1_1348_1569 73
353 3300050489 nmdc:mga03683_18969_c1 nmdc:mga03683_18969_c1_377_598 73
354 3300050490 nmdc:mga03n38_54909_c1 nmdc:mga03n38_54909_c1_1412_1633 73
355 3300050493 nmdc:mga0k408_212978_c1 nmdc:mga0k408_212978_c1_330_551 73
356 3300050493 nmdc:mga0k408_814591_c1 nmdc:mga0k408_814591_c1_160_381 73
357 3300050496 nmdc:mga07m45_14964_c1 nmdc:mga07m45_14964_c1_1059_1280 73
358 3300050496 nmdc:mga07m45_275492_c1 nmdc:mga07m45_275492_c1_67_288 73
359 3300050496 nmdc:mga07m45_341351_c1 nmdc:mga07m45_341351_c1_305_529 73
360 3300050496 nmdc:mga07m45_87206_c1 nmdc:mga07m45_87206_c1_1031_1252 73
361 3300053088 Ga0500644_0034887 Ga0500644_0034887_922_1146 73
362 3300053090 Ga0500646_0332937 Ga0500646_0332937_259_489 73
363 3300053108 Ga0500562_015907 Ga0500562_015907_212_436 73
364 3300053121 Ga0500607_060588 Ga0500607_060588_1268_1489 73
365 3300053153 Ga0500616_0030516 Ga0500616_0030516_1346_1570 73
366 3300001989 JGI24739J22299_10045454 JGI24739J22299_100454542 74
367 3300002773 JGI25152J39213_1006739 JGI25152J39213_10067393 74
368 3300002773 JGI25152J39213_1007757 JGI25152J39213_10077572 74
369 3300002774 JGI25150J39212_1004124 JGI25150J39212_10041244 74
370 3300002987 JGI25159J45721_1027654 JGI25159J45721_10276542 74
371 3300003187 JGI25151J46595_10021272 JGI25151J46595_100212722 74
372 3300003187 JGI25151J46595_10050715 JGI25151J46595_100507152 74
373 3300003215 JGI25153J46596_10008164 JGI25153J46596_100081643 74
374 3300003215 JGI25153J46596_10038933 JGI25153J46596_100389332 74
375 3300003320 rootH2_10201511 rootH2_102015112 74
376 3300003323 rootH1_10010296 rootH1_100102962 74
377 3300003354 JGI25160J50197_1014803 JGI25160J50197_10148032 74
378 3300003354 JGI25160J50197_1018904 JGI25160J50197_10189042 74
379 3300003374 JGI25161J50226_1001166 JGI25161J50226_10011662 74
380 3300003374 JGI25161J50226_1011488 JGI25161J50226_10114882 74
381 3300003374 JGI25161J50226_1013391 JGI25161J50226_10133912 74
382 3300003578 Ga0006562J51391_1081046 Ga0006562J51391_10810462 74
383 3300003578 Ga0006562J51391_1081047 Ga0006562J51391_10810472 74
384 3300003760 Ga0055527_1010495 Ga0055527_10104952 74
385 3300003761 Ga0055535_1001794 Ga0055535_10017945 74
386 3300003762 Ga0055542_1000004 Ga0055542_1000004301 74
387 3300003771 Ga0055526_1010824 Ga0055526_10108242 74
388 3300003771 Ga0055526_1020299 Ga0055526_10202992 74
389 3300003773 Ga0055537_1004186 Ga0055537_10041862 74
390 3300003773 Ga0055537_1008545 Ga0055537_10085453 74
391 3300003775 Ga0055524_1016108 Ga0055524_10161082 74
392 3300003781 Ga0055536_1010487 Ga0055536_10104872 74
393 3300003784 Ga0055534_1007036 Ga0055534_10070362 74
394 3300003784 Ga0055534_1007579 Ga0055534_10075793 74
395 3300003790 Ga0055528_1015854 Ga0055528_10158542 74
396 3300003790 Ga0055528_1026689 Ga0055528_10266892 74
397 3300003791 Ga0055530_10002962 Ga0055530_100029625 74
398 3300003792 Ga0055540_1011999 Ga0055540_10119992 74
399 3300003792 Ga0055540_1015561 Ga0055540_10155611 74
400 3300003794 Ga0055531_10015624 Ga0055531_100156242 74
401 3300003794 Ga0055531_10017837 Ga0055531_100178372 74
402 3300004625 Ga0055543_1001238 Ga0055543_10012387 74
403 3300004625 Ga0055543_1006692 Ga0055543_10066922 74
404 3300005262 Ga0065165_1003020 Ga0065165_10030206 74
405 3300005262 Ga0065165_1032362 Ga0065165_10323622 74
406 3300005334 Ga0068869_100864523 Ga0068869_1008645231 74
407 3300005353 Ga0070669_100071932 Ga0070669_1000719322 74
408 3300005356 Ga0070674_100062602 Ga0070674_1000626021 74
409 3300005439 Ga0070711_100961617 Ga0070711_1009616172 74
410 3300005456 Ga0070678_101112639 Ga0070678_1011126392 74
411 3300005459 Ga0068867_100673506 Ga0068867_1006735062 74
412 3300005539 Ga0068853_100030557 Ga0068853_1000305574 74
413 3300005543 Ga0070672_100491209 Ga0070672_1004912092 74
414 3300005548 Ga0070665_100320732 Ga0070665_1003207322 74
415 3300005578 Ga0068854_100415950 Ga0068854_1004159502 74
416 3300005614 Ga0068856_100579232 Ga0068856_1005792322 74
417 3300005616 Ga0068852_102143051 Ga0068852_1021430512 74
418 3300005834 Ga0068851_10011467 Ga0068851_100114673 74
419 3300006051 Ga0075364_10841759 Ga0075364_108417591 74
420 3300006195 Ga0075366_10335309 Ga0075366_103353092 74
421 3300006353 Ga0075370_10125617 Ga0075370_101256173 74
422 3300006353 Ga0075370_10449209 Ga0075370_104492092 74
423 3300006358 Ga0068871_101641375 Ga0068871_1016413752 74
424 3300009093 Ga0105240_10660297 Ga0105240_106602972 74
425 3300009148 Ga0105243_12532994 Ga0105243_125329942 74
426 3300009176 Ga0105242_10888457 Ga0105242_108884572 74
427 3300009176 Ga0105242_13037632 Ga0105242_130376322 74
428 3300009177 Ga0105248_10754013 Ga0105248_107540133 74
429 3300009177 Ga0105248_12106155 Ga0105248_121061552 74
430 3300009553 Ga0105249_12897325 Ga0105249_128973252 74
431 3300010375 Ga0105239_10669925 Ga0105239_106699252 74
432 3300011119 Ga0105246_10224283 Ga0105246_102242832 74
433 3300013102 Ga0157371_10161421 Ga0157371_101614212 74
434 3300013104 Ga0157370_10678162 Ga0157370_106781622 74
435 3300013297 Ga0157378_11621535 Ga0157378_116215351 74
436 3300013297 Ga0157378_12372341 Ga0157378_123723412 74
437 3300013306 Ga0163162_10004924 Ga0163162_1000492410 74
438 3300013306 Ga0163162_10578215 Ga0163162_105782152 74
439 3300013307 Ga0157372_10718220 Ga0157372_107182202 74
440 3300013308 Ga0157375_10947170 Ga0157375_109471701 74
441 3300014326 Ga0157380_10424451 Ga0157380_104244511 74
442 3300014968 Ga0157379_11500668 Ga0157379_115006682 74
443 3300014969 Ga0157376_10613890 Ga0157376_106138902 74
444 3300014969 Ga0157376_11484102 Ga0157376_114841022 74
445 3300017792 Ga0163161_10058522 Ga0163161_100585223 74
446 3300025208 Ga0209436_105799 Ga0209436_1057993 74
447 3300025208 Ga0209436_123283 Ga0209436_1232832 74
448 3300025228 Ga0209672_103958 Ga0209672_1039582 74
449 3300025229 Ga0209147_102289 Ga0209147_1022893 74
450 3300025242 Ga0209258_100022 Ga0209258_100022302 74
451 3300025245 Ga0207425_1000138 Ga0207425_10001387 74
452 3300025245 Ga0207425_1003117 Ga0207425_10031174 74
453 3300025254 Ga0209148_1000034 Ga0209148_1000034302 74
454 3300025258 Ga0209129_1000023 Ga0209129_1000023375 74
455 3300025258 Ga0209129_1002257 Ga0209129_10022577 74
456 3300025263 Ga0209565_1000649 Ga0209565_10006497 74
457 3300025263 Ga0209565_1002144 Ga0209565_10021442 74
458 3300025273 Ga0209673_1001445 Ga0209673_100144516 74
459 3300025273 Ga0209673_1001448 Ga0209673_10014487 74
460 3300025284 Ga0209130_1000222 Ga0209130_100022256 74
461 3300025284 Ga0209130_1001231 Ga0209130_10012312 74
462 3300025291 Ga0209675_1002241 Ga0209675_10022415 74
463 3300025291 Ga0209675_1002494 Ga0209675_10024945 74
464 3300025291 Ga0209675_1029948 Ga0209675_10299482 74
465 3300025292 Ga0209676_1000005 Ga0209676_1000005422 74
466 3300025292 Ga0209676_1008874 Ga0209676_10088743 74
467 3300025292 Ga0209676_1056145 Ga0209676_10561452 74
468 3300025294 Ga0209025_1000476 Ga0209025_100047620 74
469 3300025294 Ga0209025_1016183 Ga0209025_10161832 74
470 3300025294 Ga0209025_1039904 Ga0209025_10399042 74
471 3300025295 Ga0209564_1000400 Ga0209564_100040016 74
472 3300025295 Ga0209564_1001357 Ga0209564_10013577 74
473 3300025297 Ga0209758_1000064 Ga0209758_1000064276 74
474 3300025297 Ga0209758_1013125 Ga0209758_10131252 74
475 3300025298 Ga0209050_1000007 Ga0209050_1000007675 74
476 3300025298 Ga0209050_1019537 Ga0209050_10195373 74
477 3300025299 Ga0209256_1000038 Ga0209256_1000038288 74
478 3300025299 Ga0209256_1000115 Ga0209256_100011521 74
479 3300025302 Ga0207426_1000001 Ga0207426_10000011283 74
480 3300025302 Ga0207426_1000090 Ga0207426_1000090239 74
481 3300025303 Ga0209051_1000009 Ga0209051_1000009422 74
482 3300025303 Ga0209051_1008125 Ga0209051_10081252 74
483 3300025303 Ga0209051_1089675 Ga0209051_10896752 74
484 3300025304 Ga0209257_1000011 Ga0209257_1000011396 74
485 3300025304 Ga0209257_1014189 Ga0209257_10141892 74
486 3300025321 Ga0207656_10019771 Ga0207656_100197713 74
487 3300025893 Ga0207682_10418857 Ga0207682_104188572 74
488 3300025913 Ga0207695_10405134 Ga0207695_104051342 74
489 3300025916 Ga0207663_11224479 Ga0207663_112244791 74
490 3300025923 Ga0207681_10275401 Ga0207681_102754012 74
491 3300025937 Ga0207669_10104817 Ga0207669_101048173 74
492 3300025940 Ga0207691_10511664 Ga0207691_105116642 74
493 3300025981 Ga0207640_10531019 Ga0207640_105310192 74
494 3300026041 Ga0207639_10004693 Ga0207639_100046934 74
495 3300026089 Ga0207648_10387349 Ga0207648_103873492 74
496 3300026121 Ga0207683_10271434 Ga0207683_102714342 74
497 3300028379 Ga0268266_10114756 Ga0268266_101147562 74
498 3300030742 Ga0316183_1120504 Ga0316183_11205042 74
499 3300030745 Ga0316182_1306980 Ga0316182_13069802 74
500 3300032005 Ga0307411_11784866 Ga0307411_117848661 74
501 3300035241 Ga0373961_0443146 Ga0373961_0443146_138_395 74
502 3300037312 Ga0395899_0001705 Ga0395899_0001705_10697_10921 74
503 3300037418 Ga0395900_0001713 Ga0395900_0001713_7264_7488 74
504 3300037466 Ga0395898_0011212 Ga0395898_0011212_1717_1941 74
505 3300038443 Ga0395901_0004147 Ga0395901_0004147_7389_7613 74
506 3300039447 Ga0436361_0602324 Ga0436361_0602324_20179_20409 74
507 3300039447 Ga0436361_1187046 Ga0436361_1187046_41_265 74
508 3300041452 Ga0451793_0940603 Ga0451793_0940603_227_451 74
509 3300041456 Ga0451795_0585879 Ga0451795_0585879_102_332 74
510 3300041486 Ga0451807_0295848 Ga0451807_0295848_170_400 74
511 3300041498 Ga0451841_0777977 Ga0451841_0777977_203_433 74
512 3300042134 Ga0450898_018735 Ga0450898_018735_828_1052 74
513 3300046454 Ga0495592_0879393 Ga0495592_0879393_59_283 74
514 3300046455 Ga0495603_0586667 Ga0495603_0586667_185_415 74
515 3300046459 Ga0495629_0071622 Ga0495629_0071622_1244_1474 74
516 3300046459 Ga0495629_0319809 Ga0495629_0319809_390_614 74
517 3300046460 Ga0495638_0130536 Ga0495638_0130536_834_1058 74
518 3300046462 Ga0495651_0244418 Ga0495651_0244418_854_1084 74
519 3300046473 Ga0495582_0349743 Ga0495582_0349743_608_838 74
520 3300046475 Ga0495639_0002606 Ga0495639_0002606_6883_7113 74
521 3300046511 Ga0495608_0344204 Ga0495608_0344204_483_713 74
522 3300046512 Ga0495610_0034593 Ga0495610_0034593_287_511 74
523 3300046513 Ga0495616_0022482 Ga0495616_0022482_59_283 74
524 3300046515 Ga0495620_0188437 Ga0495620_0188437_424_648 74
525 3300046516 Ga0495628_0276025 Ga0495628_0276025_928_1158 74
526 3300046518 Ga0495631_0004180 Ga0495631_0004180_6997_7221 74
527 3300046523 Ga0495644_0354482 Ga0495644_0354482_279_509 74
528 3300046525 Ga0495663_0083933 Ga0495663_0083933_455_685 74
529 3300046526 Ga0495666_0162654 Ga0495666_0162654_559_789 74
530 3300046528 Ga0495642_0259121 Ga0495642_0259121_453_683 74
531 3300046530 Ga0495654_0108283 Ga0495654_0108283_575_799 74
532 3300046533 Ga0495640_0139290 Ga0495640_0139290_768_998 74
533 3300046535 Ga0495586_0163708 Ga0495586_0163708_199_429 74
534 3300046536 Ga0495587_0437486 Ga0495587_0437486_340_570 74
535 3300046539 Ga0495621_0008890 Ga0495621_0008890_2514_2744 74
536 3300046539 Ga0495621_0064111 Ga0495621_0064111_624_848 74
537 3300046539 Ga0495621_0502267 Ga0495621_0502267_173_427 74
538 3300046557 Ga0495622_0247180 Ga0495622_0247180_414_638 74
539 3300046557 Ga0495622_0427722 Ga0495622_0427722_39_269 74
540 3300046615 Ga0495656_0006966 Ga0495656_0006966_612_842 74
541 3300046615 Ga0495656_0650503 Ga0495656_0650503_290_520 74
542 3300046660 Ga0495625_0239607 Ga0495625_0239607_469_693 74
543 3300046663 Ga0495635_0165803 Ga0495635_0165803_759_989 74
544 3300046663 Ga0495635_0271597 Ga0495635_0271597_776_1000 74
545 3300046674 Ga0495588_0189141 Ga0495588_0189141_637_861 74
546 3300046674 Ga0495588_0382270 Ga0495588_0382270_202_432 74
547 3300046679 Ga0495623_0609066 Ga0495623_0609066_177_407 74
548 3300046683 Ga0495658_0265295 Ga0495658_0265295_808_1032 74
549 3300046690 Ga0495624_0278647 Ga0495624_0278647_578_808 74
550 3300046690 Ga0495624_0335929 Ga0495624_0335929_546_770 74
551 3300046691 Ga0495670_0022371 Ga0495670_0022371_2348_2578 74
552 3300046691 Ga0495670_0025111 Ga0495670_0025111_1747_1977 74
553 3300046691 Ga0495670_0205712 Ga0495670_0205712_76_300 74
554 3300046809 Ga0495600_0051794 Ga0495600_0051794_2302_2532 74
555 3300047317 Ga0495604_0709894 Ga0495604_0709894_382_612 74
556 3300047321 Ga0495676_0231657 Ga0495676_0231657_30_254 74
557 3300047321 Ga0495676_0317534 Ga0495676_0317534_243_473 74
558 3300047322 Ga0495680_0690500 Ga0495680_0690500_298_528 74
559 3300047472 Ga0495686_0478029 Ga0495686_0478029_219_443 74
560 3300047673 Ga0495593_0079212 Ga0495593_0079212_431_655 74
561 3300048088 Ga0495602_0795634 Ga0495602_0795634_203_427 74
562 3300048089 Ga0495614_0143376 Ga0495614_0143376_350_574 74
563 3300048090 Ga0495615_0002030 Ga0495615_0002030_747_977 74
564 3300048903 Ga0496100_0014235 Ga0496100_0014235_331_561 74
565 3300048904 Ga0496101_0004822 Ga0496101_0004822_3922_4152 74
566 3300048905 Ga0496102_0027383 Ga0496102_0027383_3084_3314 74
567 3300048906 Ga0496103_0026228 Ga0496103_0026228_1449_1679 74
568 3300048907 Ga0496104_0027034 Ga0496104_0027034_3254_3484 74
569 3300048908 Ga0496105_0001248 Ga0496105_0001248_7232_7462 74
570 3300048908 Ga0496105_1116673 Ga0496105_1116673_337_567 74
571 3300048909 Ga0496106_0218221 Ga0496106_0218221_220_450 74
572 3300048909 Ga0496106_0563630 Ga0496106_0563630_308_532 74
573 3300048910 Ga0496107_0023692 Ga0496107_0023692_1270_1500 74
574 3300048910 Ga0496107_0846812 Ga0496107_0846812_283_507 74
575 3300048911 Ga0496108_0184649 Ga0496108_0184649_585_815 74
576 3300048912 Ga0496109_0060743 Ga0496109_0060743_2855_3085 74
577 3300048913 Ga0496110_0343761 Ga0496110_0343761_886_1116 74
578 3300048913 Ga0496110_0492361 Ga0496110_0492361_630_860 74
579 3300048913 Ga0496110_0561720 Ga0496110_0561720_234_464 74
580 3300048913 Ga0496110_1412608 Ga0496110_1412608_52_282 74
581 3300048914 Ga0496111_0087566 Ga0496111_0087566_1748_1978 74
582 3300048914 Ga0496111_0714059 Ga0496111_0714059_150_380 74
583 3300048917 Ga0496114_0192344 Ga0496114_0192344_1253_1483 74
584 3300048917 Ga0496114_1119673 Ga0496114_1119673_366_596 74
585 3300048918 Ga0496115_1030729 Ga0496115_1030729_309_539 74
586 3300048919 Ga0496116_0030472 Ga0496116_0030472_3327_3551 74
587 3300048920 Ga0496117_0035438 Ga0496117_0035438_3281_3505 74
588 3300048920 Ga0496117_0037362 Ga0496117_0037362_2455_2679 74
589 3300048921 Ga0496118_0041873 Ga0496118_0041873_2793_3017 74
590 3300048923 Ga0496120_0187145 Ga0496120_0187145_511_735 74
591 3300048924 Ga0496121_0042532 Ga0496121_0042532_2132_2356 74
592 3300048924 Ga0496121_0128980 Ga0496121_0128980_1194_1418 74
593 3300048925 Ga0496122_0182470 Ga0496122_0182470_301_525 74
594 3300048925 Ga0496122_0281222 Ga0496122_0281222_96_320 74
595 3300048925 Ga0496122_0387402 Ga0496122_0387402_239_463 74
596 3300048926 Ga0496123_0061048 Ga0496123_0061048_1635_1859 74
597 3300048926 Ga0496123_0134951 Ga0496123_0134951_704_928 74
598 3300048926 Ga0496123_0158164 Ga0496123_0158164_655_879 74
599 3300048927 Ga0496124_0126873 Ga0496124_0126873_170_394 74
600 3300048928 Ga0496125_0087011 Ga0496125_0087011_35_259 74
601 3300048928 Ga0496125_0280281 Ga0496125_0280281_219_443 74
602 3300048928 Ga0496125_0351585 Ga0496125_0351585_170_394 74
603 3300048929 Ga0496126_0470131 Ga0496126_0470131_551_775 74
604 3300050496 nmdc:mga07m45_590719_c1 nmdc:mga07m45_590719_c1_226_456 74
605 3300050496 nmdc:mga07m45_875220_c1 nmdc:mga07m45_875220_c1_77_301 74
606 3300053078 Ga0495612_0231383 Ga0495612_0231383_411_641 74
607 3300053086 Ga0500578_0719592 Ga0500578_0719592_189_413 74
608 3300053087 Ga0500643_004493 Ga0500643_004493_5976_6200 74
609 3300053093 Ga0500651_0000038 Ga0500651_0000038_30142_30366 74
610 3300053110 Ga0500571_000054 Ga0500571_000054_18158_18382 74
611 3300053118 Ga0500594_0022279 Ga0500594_0022279_697_921 74
612 3300053120 Ga0500597_014935 Ga0500597_014935_785_1009 74
613 3300053122 Ga0500608_082273 Ga0500608_082273_60_284 74
614 3300053123 Ga0500614_217130 Ga0500614_217130_250_474 74
615 3300053125 Ga0500618_039485 Ga0500618_039485_567_791 74
616 3300053128 Ga0500626_019208 Ga0500626_019208_445_669 74
617 3300053133 Ga0500655_000123 Ga0500655_000123_15602_15826 74
618 3300053134 Ga0500658_0000237 Ga0500658_0000237_23416_23640 74
619 3300053134 Ga0500658_0000266 Ga0500658_0000266_17428_17652 74
620 3300053136 Ga0500559_0008198 Ga0500559_0008198_595_819 74
621 3300053138 Ga0500564_024230 Ga0500564_024230_2360_2584 74
622 3300053139 Ga0500568_0049520 Ga0500568_0049520_872_1096 74
623 3300053141 Ga0500574_027974 Ga0500574_027974_1146_1370 74
624 3300053153 Ga0500616_0037987 Ga0500616_0037987_752_976 74
625 3300053154 Ga0500619_134753 Ga0500619_134753_376_600 74
626 3300053162 Ga0500638_015691 Ga0500638_015691_892_1116 74
627 3300053177 Ga0500636_0254058 Ga0500636_0254058_394_618 74

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20552

HTH_62

Recombinase-like helix-turn-helix domain

6

78

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4esv-assembly2.cif.gz_J a new twist on the translocation mechanism of helicases from the structure of dnab with its substrates 0.7461 18 51
4esv-assembly2.cif.gz_G a new twist on the translocation mechanism of helicases from the structure of dnab with its substrates 0.7442 18 51
2vye-assembly1.cif.gz_A crystal structure of the dnac-ssdna complex 0.7038 18 70
4esv-assembly1.cif.gz_B a new twist on the translocation mechanism of helicases from the structure of dnab with its substrates 0.6868 18 52
4esv-assembly1.cif.gz_D a new twist on the translocation mechanism of helicases from the structure of dnab with its substrates 0.6857 18 52
ID Description Score Start End Superfamily
af_O06604_144_296_3.90.1750.20 Alpha Beta;Alpha-Beta Complex;Hect, E3 ligase catalytic domain fold;Putative Large Serine Recombinase; Chain B, Domain 2 0.7197 27 62 3.90.1750.20
4esvC01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.6847 18 52 1.10.860.10
4esvA01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.6841 18 52 1.10.860.10
af_P75993_25_88_1.20.5.5260 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6694 21 55 1.20.5.5260
4esvI01 Mainly Alpha;Orthogonal Bundle;DNAb Helicase; Chain A;DNAb Helicase; Chain A 0.6679 18 51 1.10.860.10
ID Description Score Start End GO Terms
AF-A0A502GCP4-F1-model_v4 Recombinase-like domain-containing protein 0.9829 16 74
AF-A0A3N2GQF7-F1-model_v4 Recombinase-like domain-containing protein 0.9755 17 73
AF-A0A5C5T9R3-F1-model_v4 Recombinase-like domain-containing protein 0.972 16 73
AF-A0A2N5L7J8-F1-model_v4 deleted 0.9717 17 74
AF-A0A1Q4BED1-F1-model_v4 Recombinase-like domain-containing protein 0.9603 14 73

Feature Viewer

pLDDT pTM Quality
84.22 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map