F470520

General Info

Members Datasets Scaffolds Average Seq Length
626 431 1252 176

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991467|2819722224
Length 194
Sequence QGRGICFGTAVAQSAGMTLPSIRPAAPADIPAIAAIYAHAVCNGTASWELDPPGEAEMLRRLEATLAGGYPYLAAERDGSLLGYAYAGAYRPRPAYRATVENSIYLAPAAQGLGIGSLLLDALIAECTKRGFRQMIAVIGDGTGASIGSRRLHEKAGFRLIGVAEKVGFKHGRWLDQMLMQKELGEADRSPPGF

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
274 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
297 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
301 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
302 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
305 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
306 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
307 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
308 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
309 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
310 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
311 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
312 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
313 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
314 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
315 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
316 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
317 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
318 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
321 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
322 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
323 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
324 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
325 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
328 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
329 2818991467 Bosea vestrisii 3192 Isolate Unclassified
330 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
331 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
332 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
333 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
334 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
335 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
336 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
337 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
338 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
339 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
340 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
341 2643221733 Bosea sp. Root381 Isolate Unclassified
342 2643221734 Bosea sp. Root670 Isolate Unclassified
343 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
344 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
345 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
346 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
347 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
348 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
349 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
350 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
351 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
352 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
353 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
354 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
355 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
356 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
357 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
358 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
359 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
360 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
361 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
362 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
363 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
364 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
365 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
366 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
367 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
368 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
369 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
370 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
371 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
372 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
373 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
374 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
375 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
376 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
377 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
378 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
379 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
380 2922368715
381 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
382 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
383 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
384 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
385 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
386 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
387 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
388 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
389 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
390 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
391 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
392 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
393 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
394 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
395 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
396 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
397 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
398 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
399 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
400 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
401 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
402 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
403 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
404 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
405 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
406 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
407 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
408 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
409 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
410 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
411 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
412 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
413 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
414 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
415 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
416 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
417 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
418 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
419 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
420 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
421 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
422 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
423 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
424 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
425 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
426 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
427 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
428 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
429 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
430 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
431 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.52
Metatranscriptomes 0.16
Isolates 16.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.38
Nodule 11.34
Rhizoplane 5.43
Rhizosphere 56.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10064236 3300001989 Bacteria 1154
2 JGI25151J46595_10000264 3300003187 Bacteria 60338
3 JGI25153J46596_10012370 3300003215 Bacteria 3687
4 JGI25160J50197_1033292 3300003354 Bacteria 1298
5 JGI25404J52841_10028843 3300003659 Bacteria 1191
6 JGI25404J52841_10029762 3300003659 Bacteria 1170
7 JGI25404J52841_10071298 3300003659 Bacteria 726
8 JGI25404J52841_10092918 3300003659 Bacteria 631
9 Ga0055542_1013482 3300003762 Bacteria 1373
10 Ga0055529_1031663 3300003763 Bacteria 647
11 Ga0055526_1030393 3300003771 Bacteria 1577
12 Ga0055524_1000328 3300003775 Bacteria 44226
13 Ga0055543_1005489 3300004625 Bacteria 3224
14 Ga0065165_1005125 3300005262 Bacteria 7588
15 Ga0065165_1010510 3300005262 Bacteria 3985
16 Ga0070658_10278292 3300005327 Bacteria 1424
17 Ga0070658_10801013 3300005327 Bacteria 819
18 Ga0068869_100692349 3300005334 Bacteria 868
19 Ga0070666_10377097 3300005335 Bacteria 1018
20 Ga0070666_10521301 3300005335 Bacteria 863
21 Ga0070668_100043766 3300005347 Bacteria 3434
22 Ga0070668_100373805 3300005347 Bacteria 1211
23 Ga0070675_100820146 3300005354 Bacteria 851
24 Ga0070688_100742889 3300005365 Bacteria 763
25 Ga0070667_100069292 3300005367 Bacteria 3002
26 Ga0070709_10044929 3300005434 Bacteria 2738
27 Ga0070714_100073568 3300005435 Bacteria 2961
28 Ga0070713_100025592 3300005436 Bacteria 4617
29 Ga0070713_100045297 3300005436 Bacteria 3604
30 Ga0070711_100004422 3300005439 Bacteria 8294
31 Ga0070663_100144104 3300005455 Bacteria 1821
32 Ga0070678_100796989 3300005456 Bacteria 858
33 Ga0070681_10177508 3300005458 Bacteria 2052
34 Ga0068867_101417594 3300005459 Bacteria 645
35 Ga0070699_100168805 3300005518 Bacteria 1938
36 Ga0068853_100574982 3300005539 Bacteria 1069
37 Ga0070695_100045867 3300005545 Bacteria 2788
38 Ga0070696_100448595 3300005546 Bacteria 1017
39 Ga0070704_100163064 3300005549 Bacteria 1765
40 Ga0068857_100985828 3300005577 Bacteria 811
41 Ga0068856_100750988 3300005614 Bacteria 995
42 Ga0068856_101189719 3300005614 Bacteria 779
43 Ga0068856_101233061 3300005614 Bacteria 764
44 Ga0068852_100182679 3300005616 Bacteria 1973
45 Ga0068852_100356368 3300005616 Bacteria 1430
46 Ga0068852_100458967 3300005616 Bacteria 1262
47 Ga0068859_100093827 3300005617 Bacteria 3052
48 Ga0068864_100886181 3300005618 Bacteria 881
49 Ga0068863_100047958 3300005841 Bacteria 4051
50 Ga0068863_100101416 3300005841 Bacteria 2736
51 Ga0068858_100350676 3300005842 Bacteria 1414
52 Ga0068858_100752291 3300005842 Bacteria 950
53 Ga0068860_100000477 3300005843 Bacteria 49839
54 Ga0068860_100366893 3300005843 Bacteria 1419
55 Ga0068860_100388020 3300005843 Bacteria 1379
56 Ga0068862_101182758 3300005844 Bacteria 762
57 Ga0081455_10011519 3300005937 Bacteria 8881
58 Ga0081455_10029499 3300005937 Bacteria 5002
59 Ga0081540_1005811 3300005983 Bacteria 9130
60 Ga0081540_1007723 3300005983 Bacteria 7624
61 Ga0081540_1102336 3300005983 Bacteria 1231
62 Ga0081539_10069763 3300005985 Bacteria 1889
63 Ga0070717_10003277 3300006028 Bacteria 11581
64 Ga0070717_10018898 3300006028 Bacteria 5392
65 Ga0070717_11309052 3300006028 Bacteria 659
66 Ga0075365_10120513 3300006038 Bacteria 1809
67 Ga0075365_10332839 3300006038 Bacteria 1070
68 Ga0075368_10013967 3300006042 Bacteria 2957
69 Ga0075363_100279507 3300006048 Bacteria 965
70 Ga0075364_10281770 3300006051 Bacteria 1131
71 Ga0070715_10004000 3300006163 Bacteria 4778
72 Ga0070716_100266121 3300006173 Bacteria 1175
73 Ga0070716_100590712 3300006173 Bacteria 834
74 Ga0070712_100168623 3300006175 Bacteria 1697
75 Ga0070712_100268054 3300006175 Bacteria 1371
76 Ga0070712_100346476 3300006175 Bacteria 1215
77 Ga0075367_10082920 3300006178 Bacteria 1941
78 Ga0075367_10118883 3300006178 Bacteria 1627
79 Ga0075367_10153320 3300006178 Bacteria 1430
80 Ga0075367_10328220 3300006178 Bacteria 964
81 Ga0075366_10014376 3300006195 Bacteria 4520
82 Ga0075366_10438306 3300006195 Bacteria 806
83 Ga0075370_10055957 3300006353 Bacteria 2241
84 Ga0068871_100422264 3300006358 Bacteria 1191
85 Ga0075433_10359254 3300006852 Bacteria 1287
86 Ga0075434_100156127 3300006871 Bacteria 2301
87 Ga0068865_101025106 3300006881 Bacteria 724
88 Ga0075436_100045387 3300006914 Bacteria 3031
89 Ga0075436_100316820 3300006914 Bacteria 1120
90 Ga0097620_100093827 3300006931 Bacteria 3052
91 Ga0099824_1016102 3300006942 Bacteria 6873
92 Ga0099794_10186757 3300007265 Bacteria 1059
93 Ga0105240_10007949 3300009093 Bacteria 15306
94 Ga0105240_10755973 3300009093 Bacteria 1056
95 Ga0111539_10089486 3300009094 Bacteria 3617
96 Ga0105245_10093315 3300009098 Bacteria 2773
97 Ga0105247_10266368 3300009101 Bacteria 1177
98 Ga0114129_11005944 3300009147 Bacteria 1049
99 Ga0105243_10801645 3300009148 Bacteria 928
100 Ga0105242_10514296 3300009176 Bacteria 1141
101 Ga0105248_10569711 3300009177 Bacteria 1278
102 Ga0105248_10895827 3300009177 Bacteria 1002
103 Ga0105237_10014927 3300009545 Bacteria 8100
104 Ga0105237_12027228 3300009545 Bacteria 584
105 Ga0105238_10063705 3300009551 Bacteria 3687
106 Ga0105239_10080594 3300010375 Bacteria 3582
107 Ga0105239_10561772 3300010375 Bacteria 1300
108 Ga0105239_11026624 3300010375 Bacteria 948
109 Ga0105239_11241041 3300010375 Bacteria 859
110 Ga0105246_10321536 3300011119 Bacteria 1257
111 Ga0105246_10656614 3300011119 Bacteria 914
112 Ga0105246_10755530 3300011119 Bacteria 858
113 Ga0157370_10216070 3300013104 Bacteria 1776
114 Ga0171462_1039 3300013250 Bacteria 76960
115 Ga0157378_11030991 3300013297 Bacteria 858
116 Ga0163162_11231543 3300013306 Bacteria 850
117 Ga0157372_10297785 3300013307 Bacteria 1876
118 Ga0157375_10363026 3300013308 Bacteria 1614
119 Ga0163163_11299098 3300014325 Bacteria 790
120 Ga0157380_11075071 3300014326 Bacteria 842
121 Ga0157380_11960472 3300014326 Bacteria 647
122 Ga0157379_10812576 3300014968 Bacteria 883
123 Ga0157376_11246208 3300014969 Bacteria 773
124 Ga0182007_10117689 3300015262 Bacteria 887
125 Ga0163161_10110233 3300017792 Bacteria 2057
126 Ga0163161_10876331 3300017792 Bacteria 759
127 Ga0213876_10139886 3300021384 Bacteria 1287
128 Ga0213871_10029098 3300021441 Bacteria 1430
129 Ga0209148_1000295 3300025254 Bacteria 73660
130 Ga0209233_1010286 3300025261 Bacteria 2812
131 Ga0209233_1026020 3300025261 Bacteria 1437
132 Ga0209455_1003593 3300025272 Bacteria 5408
133 Ga0209673_1007289 3300025273 Bacteria 5134
134 Ga0209675_1000542 3300025291 Bacteria 27681
135 Ga0209025_1000357 3300025294 Bacteria 98040
136 Ga0209564_1000580 3300025295 Bacteria 58002
137 Ga0209564_1002538 3300025295 Bacteria 14083
138 Ga0209564_1023455 3300025295 Bacteria 2143
139 Ga0209758_1001918 3300025297 Bacteria 22622
140 Ga0209758_1021185 3300025297 Bacteria 3041
141 Ga0209256_1000504 3300025299 Bacteria 57416
142 Ga0209256_1004970 3300025299 Bacteria 7964
143 Ga0209256_1029810 3300025299 Bacteria 1514
144 Ga0207426_1002838 3300025302 Bacteria 10314
145 Ga0207426_1006032 3300025302 Bacteria 5354
146 Ga0209257_1027911 3300025304 Bacteria 1868
147 Ga0209257_1032678 3300025304 Bacteria 1646
148 Ga0209257_1064761 3300025304 Bacteria 982
149 Ga0207653_10024198 3300025885 Bacteria 1938
150 Ga0207692_10054679 3300025898 Bacteria 2040
151 Ga0207688_10073730 3300025901 Bacteria 1941
152 Ga0207680_10423851 3300025903 Bacteria 943
153 Ga0207647_10022531 3300025904 Bacteria 4181
154 Ga0207685_10086232 3300025905 Bacteria 1311
155 Ga0207705_10329601 3300025909 Bacteria 1174
156 Ga0207707_10137668 3300025912 Bacteria 2135
157 Ga0207695_10000148 3300025913 Bacteria 208344
158 Ga0207671_10006238 3300025914 Bacteria 10683
159 Ga0207671_10075332 3300025914 Bacteria 2524
160 Ga0207693_10111680 3300025915 Bacteria 2144
161 Ga0207693_10172462 3300025915 Bacteria 1703
162 Ga0207663_11087163 3300025916 Bacteria 643
163 Ga0207649_11009368 3300025920 Bacteria 655
164 Ga0207649_11091007 3300025920 Bacteria 630
165 Ga0207652_10059154 3300025921 Bacteria 3303
166 Ga0207694_10449313 3300025924 Bacteria 1076
167 Ga0207694_10847695 3300025924 Bacteria 772
168 Ga0207687_10029992 3300025927 Bacteria 3663
169 Ga0207687_11309350 3300025927 Bacteria 623
170 Ga0207700_11552083 3300025928 Bacteria 587
171 Ga0207664_10271574 3300025929 Bacteria 1485
172 Ga0207644_10514893 3300025931 Bacteria 988
173 Ga0207644_10566533 3300025931 Bacteria 941
174 Ga0207686_10340099 3300025934 Bacteria 1127
175 Ga0207686_10981469 3300025934 Bacteria 685
176 Ga0207709_10537303 3300025935 Bacteria 917
177 Ga0207670_10119370 3300025936 Bacteria 1914
178 Ga0207669_11297403 3300025937 Bacteria 618
179 Ga0207665_10175287 3300025939 Bacteria 1550
180 Ga0207665_10569224 3300025939 Bacteria 882
181 Ga0207691_10505169 3300025940 Bacteria 1026
182 Ga0207691_10514364 3300025940 Bacteria 1016
183 Ga0207711_10599457 3300025941 Bacteria 1028
184 Ga0207689_10469636 3300025942 Bacteria 1053
185 Ga0207661_10333038 3300025944 Bacteria 1367
186 Ga0207668_10069744 3300025972 Bacteria 2504
187 Ga0207678_10096139 3300026067 Bacteria 2531
188 Ga0207708_10306574 3300026075 Bacteria 1293
189 Ga0207708_11418991 3300026075 Bacteria 609
190 Ga0207702_10206689 3300026078 Bacteria 1823
191 Ga0207702_10632824 3300026078 Bacteria 1051
192 Ga0207702_10730214 3300026078 Bacteria 977
193 Ga0207641_10697816 3300026088 Bacteria 999
194 Ga0207676_10419426 3300026095 Bacteria 1255
195 Ga0207674_10175013 3300026116 Bacteria 2099
196 Ga0207675_100559400 3300026118 Bacteria 1144
197 Ga0207698_10096241 3300026142 Bacteria 2439
198 Ga0207698_10373848 3300026142 Bacteria 1354
199 Ga0207698_11217063 3300026142 Bacteria 767
200 Ga0209813_10017917 3300027866 Bacteria 1950
201 Ga0268266_10283609 3300028379 Bacteria 1541
202 Ga0268264_10000062 3300028381 Bacteria 302110
203 Ga0307515_10231624 3300028794 Bacteria 1638
204 Ga0307515_10311398 3300028794 Bacteria 1249
205 Ga0307515_10629061 3300028794 Bacteria 685
206 Ga0265332_10080032 3300031238 Bacteria 1386
207 Ga0307513_10083845 3300031456 Bacteria 3276
208 Ga0307513_10646628 3300031456 Bacteria 764
209 Ga0307509_10207829 3300031507 Bacteria 1786
210 Ga0307509_10500430 3300031507 Bacteria 900
211 Ga0307509_10534883 3300031507 Bacteria 852
212 Ga0307408_100563801 3300031548 Bacteria 1007
213 Ga0265314_10012010 3300031711 Bacteria 7101
214 Ga0307516_10392774 3300031730 Bacteria 1047
215 Ga0307409_100077156 3300031995 Bacteria 2675
216 Ga0307411_10274087 3300032005 Bacteria 1339
217 Ga0307415_101143066 3300032126 Bacteria 731
218 Ga0307507_10009183 3300033179 Bacteria 13279
219 Ga0307510_10088635 3300033180 Bacteria 2952
220 Ga0307510_10309652 3300033180 Bacteria 1039
221 Ga0373938_0099198 3300034957 Bacteria 730
222 Ga0373934_0020526 3300035086 Bacteria 2539
223 Ga0373941_0235921 3300035115 Bacteria 709
224 Ga0373957_0010970 3300035120 Bacteria 3011
225 Ga0373946_0193569 3300035171 Bacteria 971
226 Ga0373931_0409276 3300035691 Bacteria 860
227 Ga0373935_0122548 3300035692 Bacteria 1738
228 Ga0373935_0193731 3300035692 Bacteria 1401
229 Ga0373935_0797995 3300035692 Bacteria 697
230 Ga0373927_0005757 3300035695 Bacteria 8509
231 Ga0373927_0014665 3300035695 Bacteria 5182
232 Ga0373933_0022552 3300035724 Bacteria 3586
233 Ga0373933_0538336 3300035724 Bacteria 766
234 Ga0373937_0039400 3300036401 Bacteria 4306
235 Ga0372808_016876 3300036459 Bacteria 1048
236 Ga0373925_0015746 3300037068 Bacteria 5473
237 Ga0373925_0038217 3300037068 Bacteria 3548
238 Ga0373925_0130723 3300037068 Bacteria 1957
239 Ga0395899_0097795 3300037312 Bacteria 2121
240 Ga0395899_0176474 3300037312 Bacteria 1502
241 Ga0395900_0005138 3300037418 Bacteria 13747
242 Ga0395900_0163056 3300037418 Bacteria 2273
243 Ga0395900_0230895 3300037418 Bacteria 1861
244 Ga0395900_1049701 3300037418 Bacteria 733
245 Ga0395898_0035036 3300037466 Bacteria 4996
246 Ga0395898_0070416 3300037466 Bacteria 3381
247 Ga0395898_0158728 3300037466 Bacteria 2163
248 Ga0395898_1052716 3300037466 Bacteria 748
249 Ga0395905_0349147 3300037471 Bacteria 1371
250 Ga0436364_0963381 3300037853 Bacteria 1225
251 Ga0395901_0154816 3300038443 Bacteria 2408
252 Ga0395901_0225175 3300038443 Bacteria 1959
253 Ga0395901_0582025 3300038443 Bacteria 1131
254 Ga0395901_1134943 3300038443 Bacteria 750
255 Ga0436365_0956766 3300039437 Bacteria 1884
256 Ga0436365_1525132 3300039437 Bacteria 1805
257 Ga0436360_0362329 3300039438 Bacteria 713
258 Ga0436360_0911099 3300039438 Bacteria 2043
259 Ga0436360_1199217 3300039438 Bacteria 922
260 Ga0436361_0477321 3300039447 Bacteria 2038
261 Ga0436361_0717236 3300039447 Bacteria 779
262 Ga0436363_0195303 3300039450 Bacteria 778
263 Ga0451791_1444558 3300041451 Bacteria 624
264 Ga0451855_0628729 3300041511 Bacteria 794
265 Ga0466972_0000299 3300044658 Bacteria 30012
266 Ga0466972_0126828 3300044658 Bacteria 1202
267 Ga0466972_0198998 3300044658 Bacteria 938
268 Ga0466965_0046117 3300044683 Bacteria 2157
269 Ga0466965_0161697 3300044683 Bacteria 1174
270 Ga0466961_0001682 3300044693 Bacteria 13766
271 Ga0466961_0175672 3300044693 Bacteria 1331
272 Ga0466963_0623471 3300044694 Bacteria 761
273 Ga0466968_0002351 3300044735 Bacteria 6916
274 Ga0466968_0048683 3300044735 Bacteria 1804
275 Ga0466968_0146143 3300044735 Bacteria 1084
276 Ga0466968_0189445 3300044735 Bacteria 959
277 Ga0466960_0480626 3300044901 Bacteria 725
278 Ga0466959_0024742 3300045049 Bacteria 4448
279 Ga0466958_0466855 3300045836 Bacteria 818
280 Ga0466967_0339145 3300045976 Bacteria 1453
281 Ga0495617_084294 3300046452 Bacteria 1040
282 Ga0495617_155324 3300046452 Bacteria 727
283 Ga0495592_0026073 3300046454 Bacteria 4434
284 Ga0495592_0135867 3300046454 Bacteria 1715
285 Ga0495603_0007385 3300046455 Bacteria 6608
286 Ga0495603_0108946 3300046455 Bacteria 1616
287 Ga0495603_0114274 3300046455 Bacteria 1574
288 Ga0495591_150020 3300046458 Bacteria 560
289 Ga0495629_0004806 3300046459 Bacteria 10133
290 Ga0495638_0036645 3300046460 Bacteria 3123
291 Ga0495638_0281408 3300046460 Bacteria 903
292 Ga0495641_0061630 3300046461 Bacteria 1693
293 Ga0495641_0355745 3300046461 Bacteria 662
294 Ga0495651_0031023 3300046462 Bacteria 4169
295 Ga0495651_0236702 3300046462 Bacteria 1254
296 Ga0495653_0146770 3300046463 Bacteria 1652
297 Ga0495653_0697648 3300046463 Bacteria 617
298 Ga0495639_0096043 3300046475 Bacteria 1395
299 Ga0495662_0332045 3300046476 Bacteria 748
300 Ga0495664_0002994 3300046477 Bacteria 9132
301 Ga0495664_0012801 3300046477 Bacteria 4751
302 Ga0495584_0316707 3300046491 Bacteria 792
303 Ga0495585_0241062 3300046492 Bacteria 905
304 Ga0495594_0129496 3300046499 Bacteria 1429
305 Ga0495594_0194894 3300046499 Bacteria 1154
306 Ga0495594_0606955 3300046499 Bacteria 620
307 Ga0495596_0176053 3300046500 Bacteria 832
308 Ga0495583_0134845 3300046506 Bacteria 1031
309 Ga0495583_0187435 3300046506 Bacteria 845
310 Ga0495606_0034430 3300046507 Bacteria 3477
311 Ga0495608_0200991 3300046511 Bacteria 1256
312 Ga0495610_0031953 3300046512 Bacteria 2741
313 Ga0495610_0079374 3300046512 Bacteria 1511
314 Ga0495616_0267617 3300046513 Bacteria 729
315 Ga0495618_0359143 3300046514 Bacteria 897
316 Ga0495628_0011810 3300046516 Bacteria 7371
317 Ga0495628_0377370 3300046516 Bacteria 1039
318 Ga0495630_0379284 3300046517 Bacteria 1083
319 Ga0495643_0007651 3300046522 Bacteria 6931
320 Ga0495643_0023010 3300046522 Bacteria 3547
321 Ga0495648_0038208 3300046524 Bacteria 3074
322 Ga0495648_0046272 3300046524 Bacteria 2698
323 Ga0495648_0142054 3300046524 Bacteria 1262
324 Ga0495663_0213189 3300046525 Bacteria 677
325 Ga0495652_0031563 3300046529 Bacteria 4638
326 Ga0495652_0083647 3300046529 Bacteria 2626
327 Ga0495652_0246788 3300046529 Bacteria 1325
328 Ga0495652_0568662 3300046529 Bacteria 777
329 Ga0495654_0131764 3300046530 Bacteria 1122
330 Ga0495640_0048791 3300046533 Bacteria 2923
331 Ga0495609_0073249 3300046538 Bacteria 1503
332 Ga0495645_0015358 3300046543 Bacteria 5445
333 Ga0495645_0044984 3300046543 Bacteria 3220
334 Ga0495645_0363195 3300046543 Bacteria 930
335 Ga0495622_0007496 3300046557 Bacteria 5062
336 Ga0495622_0030343 3300046557 Bacteria 2526
337 Ga0495667_0025221 3300046559 Bacteria 4008
338 Ga0495667_0046355 3300046559 Bacteria 2875
339 Ga0495667_0257883 3300046559 Bacteria 1109
340 Ga0495668_0082621 3300046616 Bacteria 1762
341 Ga0495668_0259959 3300046616 Bacteria 950
342 Ga0495634_0111102 3300046642 Bacteria 1762
343 Ga0495634_0178699 3300046642 Bacteria 1330
344 Ga0495611_0023920 3300046648 Bacteria 2654
345 Ga0495625_0156509 3300046660 Bacteria 1529
346 Ga0495625_0203054 3300046660 Bacteria 1307
347 Ga0495625_0351539 3300046660 Bacteria 931
348 Ga0495625_0463047 3300046660 Bacteria 781
349 Ga0495635_0003646 3300046663 Bacteria 10680
350 Ga0495635_0166983 3300046663 Bacteria 1497
351 Ga0495635_0270211 3300046663 Bacteria 1143
352 Ga0495588_0138413 3300046674 Bacteria 1285
353 Ga0495657_0002636 3300046675 Bacteria 15017
354 Ga0495657_0050857 3300046675 Bacteria 2785
355 Ga0495657_0101089 3300046675 Bacteria 1837
356 Ga0495657_0362795 3300046675 Bacteria 856
357 Ga0495599_0002199 3300046678 Bacteria 11335
358 Ga0495623_0116673 3300046679 Bacteria 1613
359 Ga0495623_0358692 3300046679 Bacteria 792
360 Ga0495646_0016307 3300046680 Bacteria 4714
361 Ga0495647_0030151 3300046681 Bacteria 2011
362 Ga0495669_0242855 3300046684 Bacteria 864
363 Ga0495613_0059672 3300046689 Bacteria 2796
364 Ga0495613_0360014 3300046689 Bacteria 998
365 Ga0495613_0746248 3300046689 Bacteria 642
366 Ga0495624_0041264 3300046690 Bacteria 2952
367 Ga0495670_0287835 3300046691 Bacteria 879
368 Ga0495671_0420297 3300046692 Bacteria 639
369 Ga0495649_0466945 3300046694 Bacteria 629
370 Ga0495589_0270196 3300046794 Bacteria 792
371 Ga0495600_0347468 3300046809 Bacteria 929
372 Ga0495660_0102334 3300046810 Bacteria 1473
373 Ga0495581_0099753 3300047315 Bacteria 1687
374 Ga0495581_0276664 3300047315 Bacteria 981
375 Ga0495581_0349752 3300047315 Bacteria 863
376 Ga0495604_0020841 3300047317 Bacteria 5233
377 Ga0495604_0059915 3300047317 Bacteria 2916
378 Ga0495604_0144534 3300047317 Bacteria 1696
379 Ga0495674_0040981 3300047319 Bacteria 4139
380 Ga0495676_0114547 3300047321 Bacteria 1972
381 Ga0495676_0281748 3300047321 Bacteria 1125
382 Ga0495680_0000836 3300047322 Bacteria 34084
383 Ga0495683_0292151 3300047323 Bacteria 702
384 Ga0495675_0036875 3300047444 Bacteria 3116
385 Ga0495675_0241177 3300047444 Bacteria 1088
386 Ga0495679_109389 3300047446 Bacteria 762
387 Ga0495684_0007621 3300047471 Bacteria 8376
388 Ga0495684_0018978 3300047471 Bacteria 5294
389 Ga0495686_0071914 3300047472 Bacteria 2128
390 Ga0495686_0131275 3300047472 Bacteria 1485
391 Ga0495602_0039017 3300048088 Bacteria 4380
392 Ga0495602_0187974 3300048088 Bacteria 1586
393 Ga0495614_0038654 3300048089 Bacteria 2048
394 Ga0495626_0292280 3300048091 Bacteria 645
395 Ga0496100_0075644 3300048903 Bacteria 2259
396 Ga0496100_0751985 3300048903 Bacteria 762
397 Ga0496101_0355225 3300048904 Bacteria 1152
398 Ga0496101_0427327 3300048904 Bacteria 1044
399 Ga0496101_0445854 3300048904 Bacteria 1021
400 Ga0496102_0047470 3300048905 Bacteria 3902
401 Ga0496102_0345887 3300048905 Bacteria 1400
402 Ga0496102_0497224 3300048905 Bacteria 1141
403 Ga0496102_0982180 3300048905 Bacteria 765
404 Ga0496103_0016321 3300048906 Bacteria 4431
405 Ga0496104_0006887 3300048907 Bacteria 10025
406 Ga0496104_0008723 3300048907 Bacteria 9013
407 Ga0496105_0018687 3300048908 Bacteria 5579
408 Ga0496105_0078682 3300048908 Bacteria 2722
409 Ga0496106_0102327 3300048909 Bacteria 2222
410 Ga0496106_0302396 3300048909 Bacteria 1283
411 Ga0496106_0339044 3300048909 Bacteria 1207
412 Ga0496107_0402349 3300048910 Bacteria 1018
413 Ga0496108_0256202 3300048911 Bacteria 1522
414 Ga0496108_0517229 3300048911 Bacteria 1042
415 Ga0496108_1044926 3300048911 Bacteria 696
416 Ga0496109_0048681 3300048912 Bacteria 3856
417 Ga0496109_1248631 3300048912 Bacteria 679
418 Ga0496110_0138630 3300048913 Bacteria 2199
419 Ga0496110_0159416 3300048913 Bacteria 2045
420 Ga0496110_1247090 3300048913 Bacteria 652
421 Ga0496111_0648091 3300048914 Bacteria 771
422 Ga0496112_0278445 3300048915 Bacteria 1620
423 Ga0496112_0310340 3300048915 Bacteria 1522
424 Ga0496112_0438671 3300048915 Bacteria 1244
425 Ga0496113_0357045 3300048916 Bacteria 1172
426 Ga0496114_0490966 3300048917 Bacteria 1086
427 Ga0496115_0064081 3300048918 Bacteria 2966
428 Ga0496116_0028756 3300048919 Bacteria 4020
429 Ga0496117_0012405 3300048920 Bacteria 7516
430 Ga0496117_0021409 3300048920 Bacteria 5231
431 Ga0496117_0022151 3300048920 Bacteria 5103
432 Ga0496117_0042532 3300048920 Bacteria 3314
433 Ga0496118_0090327 3300048921 Bacteria 2111
434 Ga0496118_0217702 3300048921 Bacteria 1114
435 Ga0496119_0034743 3300048922 Bacteria 3312
436 Ga0496119_0079078 3300048922 Bacteria 1900
437 Ga0496121_0000870 3300048924 Bacteria 54546
438 Ga0496121_0099568 3300048924 Bacteria 2246
439 Ga0496121_0106280 3300048924 Bacteria 2152
440 Ga0496122_0090130 3300048925 Bacteria 2093
441 Ga0496122_0366553 3300048925 Bacteria 745
442 Ga0496123_0053238 3300048926 Bacteria 2676
443 Ga0496123_0423737 3300048926 Bacteria 599
444 Ga0496124_0002001 3300048927 Bacteria 27769
445 Ga0496124_0031535 3300048927 Bacteria 4691
446 Ga0496124_0243951 3300048927 Bacteria 1334
447 Ga0496125_0015348 3300048928 Bacteria 7416
448 Ga0496125_0026599 3300048928 Bacteria 5267
449 Ga0496125_0064488 3300048928 Bacteria 2910
450 Ga0496125_0118997 3300048928 Bacteria 1890
451 Ga0496126_0074215 3300048929 Bacteria 3021
452 Ga0496126_0076214 3300048929 Bacteria 2975
453 Ga0496126_0087079 3300048929 Bacteria 2752
454 Ga0496126_0096368 3300048929 Bacteria 2593
455 Ga0496126_0906731 3300048929 Bacteria 668
456 Ga0495678_177883 3300049459 Bacteria 669
457 Ga0501032_0298462 3300049569 Bacteria 1042
458 Ga0501033_0189819 3300049570 Bacteria 1471
459 Ga0501034_0081264 3300049571 Bacteria 3243
460 Ga0501036_0185584 3300049572 Bacteria 1750
461 Ga0501037_0091254 3300049573 Bacteria 2203
462 Ga0501037_0198900 3300049573 Bacteria 1417
463 Ga0501047_0372356 3300049581 Bacteria 1263
464 Ga0501076_0134528 3300049592 Bacteria 2006
465 Ga0501035_0671899 3300049822 Bacteria 838
466 nmdc:mga03683_38345_c1 3300050489 Bacteria 1956
467 nmdc:mga03n38_120954_c1 3300050490 Bacteria 1286
468 nmdc:mga03n38_129768_c1 3300050490 Bacteria 1248
469 nmdc:mga00v17_115645_c1 3300050491 Bacteria 1705
470 nmdc:mga0yw44_22302_c1 3300050492 Bacteria 3549
471 nmdc:mga0k408_16010_c1 3300050493 Bacteria 4153
472 nmdc:mga06z11_123447_c1 3300050494 Bacteria 1447
473 nmdc:mga06z11_256099_c1 3300050494 Bacteria 1032
474 nmdc:mga06z11_364043_c1 3300050494 Bacteria 867
475 nmdc:mga06z11_83139_c1 3300050494 Bacteria 1723
476 nmdc:mga04h51_14834_c1 3300050495 Bacteria 2235
477 nmdc:mga0qj67_1020243_c1 3300050509 Bacteria 648
478 nmdc:mga0n895_176411_c1 3300050512 Bacteria 2168
479 nmdc:mga0n895_745066_c1 3300050512 Bacteria 973
480 nmdc:mga08x19_298080_c1 3300050514 Bacteria 1119
481 nmdc:mga0a205_220905_c1 3300050515 Bacteria 1780
482 nmdc:mga0sz30_180604_c1 3300050516 Bacteria 936
483 nmdc:mga0sz30_201921_c1 3300050516 Bacteria 883
484 nmdc:mga0sz30_37906_c1 3300050516 Bacteria 2019
485 Ga0495601_0042626 3300053077 Bacteria 2848
486 Ga0495601_0175746 3300053077 Bacteria 1400
487 Ga0500635_0157757 3300053080 Bacteria 869
488 Ga0495655_0078568 3300053083 Bacteria 938
489 Ga0495595_0116539 3300053084 Bacteria 1299
490 Ga0495619_0239120 3300053085 Bacteria 1258
491 Ga0495619_0254204 3300053085 Bacteria 1218
492 Ga0500578_0142777 3300053086 Bacteria 1496
493 Ga0500578_0281901 3300053086 Bacteria 991
494 Ga0500646_0180049 3300053090 Bacteria 716
495 Ga0500583_0098664 3300053092 Bacteria 1428
496 Ga0500651_0097626 3300053093 Bacteria 1804
497 Ga0500566_0001834 3300053094 Bacteria 12491
498 Ga0500566_0132255 3300053094 Bacteria 1333
499 Ga0500562_007663 3300053108 Bacteria 2722
500 Ga0500595_002547 3300053119 Bacteria 8931
501 Ga0500607_133788 3300053121 Bacteria 1178
502 Ga0500608_023340 3300053122 Bacteria 2879
503 Ga0500642_0139820 3300053130 Bacteria 1136
504 Ga0500652_123758 3300053131 Bacteria 1081
505 Ga0500658_0126781 3300053134 Bacteria 1135
506 Ga0500559_0019096 3300053136 Bacteria 2896
507 Ga0500559_0326428 3300053136 Bacteria 719
508 Ga0500577_0125467 3300053142 Bacteria 1071
509 Ga0500577_0162537 3300053142 Bacteria 951
510 Ga0500588_0066007 3300053146 Bacteria 1173
511 Ga0500616_0000244 3300053153 Bacteria 85079
512 Ga0500616_0031311 3300053153 Bacteria 2914
513 Ga0500622_0026302 3300053156 Bacteria 3073
514 Ga0500638_025570 3300053162 Bacteria 2823
515 Ga0500639_028109 3300053163 Bacteria 2972
516 Ga0500636_0078573 3300053177 Bacteria 1904
517 Ga0500636_0101321 3300053177 Bacteria 1636
518 Ga0500637_0193624 3300053178 Bacteria 1160
519 Ga0500657_131207 3300053728 Bacteria 971
520 Ga0500645_082663 3300053730 Bacteria 916
521 Ga0500645_117837 3300053730 Bacteria 742
522 Ga0500552_051531 3300053733 Bacteria 698
523 Ga0500599_001510 3300053736 Bacteria 2687
524 2819722224 2818991467 Bacteria 5893227
525 2509152170 2508501128 Bacteria 8613869
526 2511400451 2511231028 Bacteria 8046582
527 2513651343 2513237095 Bacteria 8976980
528 2513676306 2513237098 Bacteria 9902361
529 2513700728 2513237102 Bacteria 7703324
530 2513873359 2513237139 Bacteria 8737671
531 2514014689 2513237161 Bacteria 8871253
532 2517106289 2517093001 Bacteria 9002274
533 2524441432 2524023205 Bacteria 8918781
534 2528853328 2528768022 Bacteria 10457665
535 2617352070 2617270735 Bacteria 9163226
536 2644730998 2643221733 Bacteria 5690728
537 2644734658 2643221734 Bacteria 5365412
538 2745077566 2744054633 Bacteria 8678936
539 2793062225 2791355196 Bacteria 7323613
540 2805920707 2802429603 Bacteria 8777136
541 2818237847 2816332527 Bacteria 8933356
542 2824609192 2824600985 Bacteria 8488197
543 2824617783 2824609381 Bacteria 8672835
544 2824660135 2824653114 Bacteria 8493680
545 2824669997 2824661429 Bacteria 9877870
546 2824676584 2824671348 Bacteria 8369588
547 2824693246 2824687955 Bacteria 8360029
548 2824702615 2824696289 Bacteria 8335049
549 2824780853 2824773399 Bacteria 8360218
550 2838124687 2838122688 Bacteria 8803140
551 2841945379 2841941048 Bacteria 8688029
552 2841952165 2841949485 Bacteria 8680857
553 2841970448 2841966195 Bacteria 8673214
554 2841981696 2841974524 Bacteria 8931498
555 2841984977 2841983080 Bacteria 8395090
556 2844315534 2844315083 Bacteria 8138177
557 2847931239 2847930680 Bacteria 9342022
558 2847942330 2847939898 Bacteria 8606328
559 2849083203 2849076700 Bacteria 7039503
560 2857516363 2857509624 Bacteria 7472071
561 2874621212 2874620515 Bacteria 8290088
562 2874628611 2874628541 Bacteria 8630250
563 2876769632 2876761206 Bacteria 10111113
564 2879083761 2879083081 Bacteria 8587928
565 2879100430 2879099564 Bacteria 10442239
566 2885369344 2885366525 Bacteria 8326213
567 2888420131 2888419890 Bacteria 7857137
568 2889035313 2889033259 Bacteria 9099371
569 2903733697 2903727486 Bacteria 8281579
570 2903774496 2903768456 Bacteria 9749579
571 2904667757 2904666416 Bacteria 8226587
572 2906609455 2906602504 Bacteria 8295279
573 2906650282 2906643746 Bacteria 8722424
574 2917703071 2917699015 Bacteria 7043791
575 2922369397
576 2929618774 2929615660 Bacteria 9193770
577 2929628541 2929624759 Bacteria 9339455
578 2932790956 2932784394 Bacteria 9704911
579 2932811990 2932809354 Bacteria 9135765
580 2932825559 2932818245 Bacteria 9955613
581 2932833672 2932828146 Bacteria 9745859
582 2933580516 2933577622 Bacteria 9116884
583 2935623198 2935616580 Bacteria 9032984
584 2935636047 2935630451 Bacteria 8169952
585 2935644273 2935638405 Bacteria 10015038
586 2935672145 2935665750 Bacteria 9571747
587 2935679334 2935675223 Bacteria 9928132
588 2935686576 2935684952 Bacteria 9590419
589 2935700358 2935694250 Bacteria 9291695
590 2935710306 2935703347 Bacteria 10242284
591 2935716264 2935713505 Bacteria 9608509
592 2935723612 2935722832 Bacteria 9608746
593 2935735167 2935732158 Bacteria 9706831
594 2935744042 2935741537 Bacteria 9707219
595 2935752542 2935750917 Bacteria 9590372
596 2935763324 2935760218 Bacteria 9817913
597 2935808297 2935801545 Bacteria 9301974
598 2935816089 2935810662 Bacteria 9401221
599 2935833483 2935827899 Bacteria 10038562
600 2935845959 2935837841 Bacteria 9454360
601 2935861446 2935855204 Bacteria 9035059
602 2935869565 2935864058 Bacteria 9784707
603 2935879894 2935873716 Bacteria 9632195
604 2935997883 2935992306 Bacteria 9802711
605 2936008852 2936002035 Bacteria 9362176
606 2936041094 2936037263 Bacteria 9446081
607 2940558455 2940556831 Bacteria 9590747
608 2941512649 2941507105 Bacteria 8166816
609 2941520513 2941515067 Bacteria 8166720
610 2941528527 2941523033 Bacteria 8169134
611 2941535352 2941531003 Bacteria 7653939
612 2941547128 2941538514 Bacteria 9402094
613 3005508989 3005506211 Bacteria 6943378
614 3005594128 3005587118 Bacteria 7794411
615 3005595226 3005594810 Bacteria 8716512
616 3005718464 3005718088 Bacteria 8283608
617 8006930404 8006926726 Bacteria 6749210
618 8016518001 8016511872 Bacteria 9921665
619 8017058640 8017057580 Bacteria 10023680
620 8019577018 8019576017 Bacteria 10049540
621 8019595085 8019586578 Bacteria 10212056
622 8019606656 8019597564 Bacteria 10041141
623 8019611855 8019608314 Bacteria 10042931
624 8055742623 8055742211 Bacteria 9226248
625 8056682931 8056681323 Bacteria 8472857
626 8056971482 8056967851 Bacteria 9038162
627 JGI24739J22299_10064236
628 JGI25151J46595_10000264
629 JGI25153J46596_10012370
630 JGI25160J50197_1033292
631 JGI25404J52841_10028843
632 JGI25404J52841_10029762
633 JGI25404J52841_10071298
634 JGI25404J52841_10092918
635 Ga0055542_1013482
636 Ga0055529_1031663
637 Ga0055526_1030393
638 Ga0055524_1000328
639 Ga0055543_1005489
640 Ga0065165_1005125
641 Ga0065165_1010510
642 Ga0070658_10278292
643 Ga0070658_10801013
644 Ga0068869_100692349
645 Ga0070666_10377097
646 Ga0070666_10521301
647 Ga0070668_100043766
648 Ga0070668_100373805
649 Ga0070675_100820146
650 Ga0070688_100742889
651 Ga0070667_100069292
652 Ga0070709_10044929
653 Ga0070714_100073568
654 Ga0070713_100025592
655 Ga0070713_100045297
656 Ga0070711_100004422
657 Ga0070663_100144104
658 Ga0070678_100796989
659 Ga0070681_10177508
660 Ga0068867_101417594
661 Ga0070699_100168805
662 Ga0068853_100574982
663 Ga0070695_100045867
664 Ga0070696_100448595
665 Ga0070704_100163064
666 Ga0068857_100985828
667 Ga0068856_100750988
668 Ga0068856_101189719
669 Ga0068856_101233061
670 Ga0068852_100182679
671 Ga0068852_100356368
672 Ga0068852_100458967
673 Ga0068859_100093827
674 Ga0068864_100886181
675 Ga0068863_100047958
676 Ga0068863_100101416
677 Ga0068858_100350676
678 Ga0068858_100752291
679 Ga0068860_100000477
680 Ga0068860_100366893
681 Ga0068860_100388020
682 Ga0068862_101182758
683 Ga0081455_10011519
684 Ga0081455_10029499
685 Ga0081540_1005811
686 Ga0081540_1007723
687 Ga0081540_1102336
688 Ga0081539_10069763
689 Ga0070717_10003277
690 Ga0070717_10018898
691 Ga0070717_11309052
692 Ga0075365_10120513
693 Ga0075365_10332839
694 Ga0075368_10013967
695 Ga0075363_100279507
696 Ga0075364_10281770
697 Ga0070715_10004000
698 Ga0070716_100266121
699 Ga0070716_100590712
700 Ga0070712_100168623
701 Ga0070712_100268054
702 Ga0070712_100346476
703 Ga0075367_10082920
704 Ga0075367_10118883
705 Ga0075367_10153320
706 Ga0075367_10328220
707 Ga0075366_10014376
708 Ga0075366_10438306
709 Ga0075370_10055957
710 Ga0068871_100422264
711 Ga0075433_10359254
712 Ga0075434_100156127
713 Ga0068865_101025106
714 Ga0075436_100045387
715 Ga0075436_100316820
716 Ga0097620_100093827
717 Ga0099824_1016102
718 Ga0099794_10186757
719 Ga0105240_10007949
720 Ga0105240_10755973
721 Ga0111539_10089486
722 Ga0105245_10093315
723 Ga0105247_10266368
724 Ga0114129_11005944
725 Ga0105243_10801645
726 Ga0105242_10514296
727 Ga0105248_10569711
728 Ga0105248_10895827
729 Ga0105237_10014927
730 Ga0105237_12027228
731 Ga0105238_10063705
732 Ga0105239_10080594
733 Ga0105239_10561772
734 Ga0105239_11026624
735 Ga0105239_11241041
736 Ga0105246_10321536
737 Ga0105246_10656614
738 Ga0105246_10755530
739 Ga0157370_10216070
740 Ga0171462_1039
741 Ga0157378_11030991
742 Ga0163162_11231543
743 Ga0157372_10297785
744 Ga0157375_10363026
745 Ga0163163_11299098
746 Ga0157380_11075071
747 Ga0157380_11960472
748 Ga0157379_10812576
749 Ga0157376_11246208
750 Ga0182007_10117689
751 Ga0163161_10110233
752 Ga0163161_10876331
753 Ga0213876_10139886
754 Ga0213871_10029098
755 Ga0209148_1000295
756 Ga0209233_1010286
757 Ga0209233_1026020
758 Ga0209455_1003593
759 Ga0209673_1007289
760 Ga0209675_1000542
761 Ga0209025_1000357
762 Ga0209564_1000580
763 Ga0209564_1002538
764 Ga0209564_1023455
765 Ga0209758_1001918
766 Ga0209758_1021185
767 Ga0209256_1000504
768 Ga0209256_1004970
769 Ga0209256_1029810
770 Ga0207426_1002838
771 Ga0207426_1006032
772 Ga0209257_1027911
773 Ga0209257_1032678
774 Ga0209257_1064761
775 Ga0207653_10024198
776 Ga0207692_10054679
777 Ga0207688_10073730
778 Ga0207680_10423851
779 Ga0207647_10022531
780 Ga0207685_10086232
781 Ga0207705_10329601
782 Ga0207707_10137668
783 Ga0207695_10000148
784 Ga0207671_10006238
785 Ga0207671_10075332
786 Ga0207693_10111680
787 Ga0207693_10172462
788 Ga0207663_11087163
789 Ga0207649_11009368
790 Ga0207649_11091007
791 Ga0207652_10059154
792 Ga0207694_10449313
793 Ga0207694_10847695
794 Ga0207687_10029992
795 Ga0207687_11309350
796 Ga0207700_11552083
797 Ga0207664_10271574
798 Ga0207644_10514893
799 Ga0207644_10566533
800 Ga0207686_10340099
801 Ga0207686_10981469
802 Ga0207709_10537303
803 Ga0207670_10119370
804 Ga0207669_11297403
805 Ga0207665_10175287
806 Ga0207665_10569224
807 Ga0207691_10505169
808 Ga0207691_10514364
809 Ga0207711_10599457
810 Ga0207689_10469636
811 Ga0207661_10333038
812 Ga0207668_10069744
813 Ga0207678_10096139
814 Ga0207708_10306574
815 Ga0207708_11418991
816 Ga0207702_10206689
817 Ga0207702_10632824
818 Ga0207702_10730214
819 Ga0207641_10697816
820 Ga0207676_10419426
821 Ga0207674_10175013
822 Ga0207675_100559400
823 Ga0207698_10096241
824 Ga0207698_10373848
825 Ga0207698_11217063
826 Ga0209813_10017917
827 Ga0268266_10283609
828 Ga0268264_10000062
829 Ga0307515_10231624
830 Ga0307515_10311398
831 Ga0307515_10629061
832 Ga0265332_10080032
833 Ga0307513_10083845
834 Ga0307513_10646628
835 Ga0307509_10207829
836 Ga0307509_10500430
837 Ga0307509_10534883
838 Ga0307408_100563801
839 Ga0265314_10012010
840 Ga0307516_10392774
841 Ga0307409_100077156
842 Ga0307411_10274087
843 Ga0307415_101143066
844 Ga0307507_10009183
845 Ga0307510_10088635
846 Ga0307510_10309652
847 Ga0373938_0099198
848 Ga0373934_0020526
849 Ga0373941_0235921
850 Ga0373957_0010970
851 Ga0373946_0193569
852 Ga0373931_0409276
853 Ga0373935_0122548
854 Ga0373935_0193731
855 Ga0373935_0797995
856 Ga0373927_0005757
857 Ga0373927_0014665
858 Ga0373933_0022552
859 Ga0373933_0538336
860 Ga0373937_0039400
861 Ga0372808_016876
862 Ga0373925_0015746
863 Ga0373925_0038217
864 Ga0373925_0130723
865 Ga0395899_0097795
866 Ga0395899_0176474
867 Ga0395900_0005138
868 Ga0395900_0163056
869 Ga0395900_0230895
870 Ga0395900_1049701
871 Ga0395898_0035036
872 Ga0395898_0070416
873 Ga0395898_0158728
874 Ga0395898_1052716
875 Ga0395905_0349147
876 Ga0436364_0963381
877 Ga0395901_0154816
878 Ga0395901_0225175
879 Ga0395901_0582025
880 Ga0395901_1134943
881 Ga0436365_0956766
882 Ga0436365_1525132
883 Ga0436360_0362329
884 Ga0436360_0911099
885 Ga0436360_1199217
886 Ga0436361_0477321
887 Ga0436361_0717236
888 Ga0436363_0195303
889 Ga0451791_1444558
890 Ga0451855_0628729
891 Ga0466972_0000299
892 Ga0466972_0126828
893 Ga0466972_0198998
894 Ga0466965_0046117
895 Ga0466965_0161697
896 Ga0466961_0001682
897 Ga0466961_0175672
898 Ga0466963_0623471
899 Ga0466968_0002351
900 Ga0466968_0048683
901 Ga0466968_0146143
902 Ga0466968_0189445
903 Ga0466960_0480626
904 Ga0466959_0024742
905 Ga0466958_0466855
906 Ga0466967_0339145
907 Ga0495617_084294
908 Ga0495617_155324
909 Ga0495592_0026073
910 Ga0495592_0135867
911 Ga0495603_0007385
912 Ga0495603_0108946
913 Ga0495603_0114274
914 Ga0495591_150020
915 Ga0495629_0004806
916 Ga0495638_0036645
917 Ga0495638_0281408
918 Ga0495641_0061630
919 Ga0495641_0355745
920 Ga0495651_0031023
921 Ga0495651_0236702
922 Ga0495653_0146770
923 Ga0495653_0697648
924 Ga0495639_0096043
925 Ga0495662_0332045
926 Ga0495664_0002994
927 Ga0495664_0012801
928 Ga0495584_0316707
929 Ga0495585_0241062
930 Ga0495594_0129496
931 Ga0495594_0194894
932 Ga0495594_0606955
933 Ga0495596_0176053
934 Ga0495583_0134845
935 Ga0495583_0187435
936 Ga0495606_0034430
937 Ga0495608_0200991
938 Ga0495610_0031953
939 Ga0495610_0079374
940 Ga0495616_0267617
941 Ga0495618_0359143
942 Ga0495628_0011810
943 Ga0495628_0377370
944 Ga0495630_0379284
945 Ga0495643_0007651
946 Ga0495643_0023010
947 Ga0495648_0038208
948 Ga0495648_0046272
949 Ga0495648_0142054
950 Ga0495663_0213189
951 Ga0495652_0031563
952 Ga0495652_0083647
953 Ga0495652_0246788
954 Ga0495652_0568662
955 Ga0495654_0131764
956 Ga0495640_0048791
957 Ga0495609_0073249
958 Ga0495645_0015358
959 Ga0495645_0044984
960 Ga0495645_0363195
961 Ga0495622_0007496
962 Ga0495622_0030343
963 Ga0495667_0025221
964 Ga0495667_0046355
965 Ga0495667_0257883
966 Ga0495668_0082621
967 Ga0495668_0259959
968 Ga0495634_0111102
969 Ga0495634_0178699
970 Ga0495611_0023920
971 Ga0495625_0156509
972 Ga0495625_0203054
973 Ga0495625_0351539
974 Ga0495625_0463047
975 Ga0495635_0003646
976 Ga0495635_0166983
977 Ga0495635_0270211
978 Ga0495588_0138413
979 Ga0495657_0002636
980 Ga0495657_0050857
981 Ga0495657_0101089
982 Ga0495657_0362795
983 Ga0495599_0002199
984 Ga0495623_0116673
985 Ga0495623_0358692
986 Ga0495646_0016307
987 Ga0495647_0030151
988 Ga0495669_0242855
989 Ga0495613_0059672
990 Ga0495613_0360014
991 Ga0495613_0746248
992 Ga0495624_0041264
993 Ga0495670_0287835
994 Ga0495671_0420297
995 Ga0495649_0466945
996 Ga0495589_0270196
997 Ga0495600_0347468
998 Ga0495660_0102334
999 Ga0495581_0099753
1000 Ga0495581_0276664
1001 Ga0495581_0349752
1002 Ga0495604_0020841
1003 Ga0495604_0059915
1004 Ga0495604_0144534
1005 Ga0495674_0040981
1006 Ga0495676_0114547
1007 Ga0495676_0281748
1008 Ga0495680_0000836
1009 Ga0495683_0292151
1010 Ga0495675_0036875
1011 Ga0495675_0241177
1012 Ga0495679_109389
1013 Ga0495684_0007621
1014 Ga0495684_0018978
1015 Ga0495686_0071914
1016 Ga0495686_0131275
1017 Ga0495602_0039017
1018 Ga0495602_0187974
1019 Ga0495614_0038654
1020 Ga0495626_0292280
1021 Ga0496100_0075644
1022 Ga0496100_0751985
1023 Ga0496101_0355225
1024 Ga0496101_0427327
1025 Ga0496101_0445854
1026 Ga0496102_0047470
1027 Ga0496102_0345887
1028 Ga0496102_0497224
1029 Ga0496102_0982180
1030 Ga0496103_0016321
1031 Ga0496104_0006887
1032 Ga0496104_0008723
1033 Ga0496105_0018687
1034 Ga0496105_0078682
1035 Ga0496106_0102327
1036 Ga0496106_0302396
1037 Ga0496106_0339044
1038 Ga0496107_0402349
1039 Ga0496108_0256202
1040 Ga0496108_0517229
1041 Ga0496108_1044926
1042 Ga0496109_0048681
1043 Ga0496109_1248631
1044 Ga0496110_0138630
1045 Ga0496110_0159416
1046 Ga0496110_1247090
1047 Ga0496111_0648091
1048 Ga0496112_0278445
1049 Ga0496112_0310340
1050 Ga0496112_0438671
1051 Ga0496113_0357045
1052 Ga0496114_0490966
1053 Ga0496115_0064081
1054 Ga0496116_0028756
1055 Ga0496117_0012405
1056 Ga0496117_0021409
1057 Ga0496117_0022151
1058 Ga0496117_0042532
1059 Ga0496118_0090327
1060 Ga0496118_0217702
1061 Ga0496119_0034743
1062 Ga0496119_0079078
1063 Ga0496121_0000870
1064 Ga0496121_0099568
1065 Ga0496121_0106280
1066 Ga0496122_0090130
1067 Ga0496122_0366553
1068 Ga0496123_0053238
1069 Ga0496123_0423737
1070 Ga0496124_0002001
1071 Ga0496124_0031535
1072 Ga0496124_0243951
1073 Ga0496125_0015348
1074 Ga0496125_0026599
1075 Ga0496125_0064488
1076 Ga0496125_0118997
1077 Ga0496126_0074215
1078 Ga0496126_0076214
1079 Ga0496126_0087079
1080 Ga0496126_0096368
1081 Ga0496126_0906731
1082 Ga0495678_177883
1083 Ga0501032_0298462
1084 Ga0501033_0189819
1085 Ga0501034_0081264
1086 Ga0501036_0185584
1087 Ga0501037_0091254
1088 Ga0501037_0198900
1089 Ga0501047_0372356
1090 Ga0501076_0134528
1091 Ga0501035_0671899
1092 nmdc:mga03683_38345_c1
1093 nmdc:mga03n38_120954_c1
1094 nmdc:mga03n38_129768_c1
1095 nmdc:mga00v17_115645_c1
1096 nmdc:mga0yw44_22302_c1
1097 nmdc:mga0k408_16010_c1
1098 nmdc:mga06z11_123447_c1
1099 nmdc:mga06z11_256099_c1
1100 nmdc:mga06z11_364043_c1
1101 nmdc:mga06z11_83139_c1
1102 nmdc:mga04h51_14834_c1
1103 nmdc:mga0qj67_1020243_c1
1104 nmdc:mga0n895_176411_c1
1105 nmdc:mga0n895_745066_c1
1106 nmdc:mga08x19_298080_c1
1107 nmdc:mga0a205_220905_c1
1108 nmdc:mga0sz30_180604_c1
1109 nmdc:mga0sz30_201921_c1
1110 nmdc:mga0sz30_37906_c1
1111 Ga0495601_0042626
1112 Ga0495601_0175746
1113 Ga0500635_0157757
1114 Ga0495655_0078568
1115 Ga0495595_0116539
1116 Ga0495619_0239120
1117 Ga0495619_0254204
1118 Ga0500578_0142777
1119 Ga0500578_0281901
1120 Ga0500646_0180049
1121 Ga0500583_0098664
1122 Ga0500651_0097626
1123 Ga0500566_0001834
1124 Ga0500566_0132255
1125 Ga0500562_007663
1126 Ga0500595_002547
1127 Ga0500607_133788
1128 Ga0500608_023340
1129 Ga0500642_0139820
1130 Ga0500652_123758
1131 Ga0500658_0126781
1132 Ga0500559_0019096
1133 Ga0500559_0326428
1134 Ga0500577_0125467
1135 Ga0500577_0162537
1136 Ga0500588_0066007
1137 Ga0500616_0000244
1138 Ga0500616_0031311
1139 Ga0500622_0026302
1140 Ga0500638_025570
1141 Ga0500639_028109
1142 Ga0500636_0078573
1143 Ga0500636_0101321
1144 Ga0500637_0193624
1145 Ga0500657_131207
1146 Ga0500645_082663
1147 Ga0500645_117837
1148 Ga0500552_051531
1149 Ga0500599_001510
1150 2819722224
1151 2509152170
1152 2511400451
1153 2513651343
1154 2513676306
1155 2513700728
1156 2513873359
1157 2514014689
1158 2517106289
1159 2524441432
1160 2528853328
1161 2617352070
1162 2644730998
1163 2644734658
1164 2745077566
1165 2793062225
1166 2805920707
1167 2818237847
1168 2824609192
1169 2824617783
1170 2824660135
1171 2824669997
1172 2824676584
1173 2824693246
1174 2824702615
1175 2824780853
1176 2838124687
1177 2841945379
1178 2841952165
1179 2841970448
1180 2841981696
1181 2841984977
1182 2844315534
1183 2847931239
1184 2847942330
1185 2849083203
1186 2857516363
1187 2874621212
1188 2874628611
1189 2876769632
1190 2879083761
1191 2879100430
1192 2885369344
1193 2888420131
1194 2889035313
1195 2903733697
1196 2903774496
1197 2904667757
1198 2906609455
1199 2906650282
1200 2917703071
1201 2922369397
1202 2929618774
1203 2929628541
1204 2932790956
1205 2932811990
1206 2932825559
1207 2932833672
1208 2933580516
1209 2935623198
1210 2935636047
1211 2935644273
1212 2935672145
1213 2935679334
1214 2935686576
1215 2935700358
1216 2935710306
1217 2935716264
1218 2935723612
1219 2935735167
1220 2935744042
1221 2935752542
1222 2935763324
1223 2935808297
1224 2935816089
1225 2935833483
1226 2935845959
1227 2935861446
1228 2935869565
1229 2935879894
1230 2935997883
1231 2936008852
1232 2936041094
1233 2940558455
1234 2941512649
1235 2941520513
1236 2941528527
1237 2941535352
1238 2941547128
1239 3005508989
1240 3005594128
1241 3005595226
1242 3005718464
1243 8006930404
1244 8016518001
1245 8017058640
1246 8019577018
1247 8019595085
1248 8019606656
1249 8019611855
1250 8055742623
1251 8056682931
1252 8056971482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

22

179

0.91

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

21

159

0.78

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

33

158

0.75

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

68

160

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.9839 3 175
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9831 3 166
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.9772 5 166
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9771 3 166
4mbu-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.9759 2 167
ID Description Score Start End Superfamily
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9829 2 175 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.981 5 167 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.975 5 167 3.40.630.30
6m7gE00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9671 3 168 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9664 2 175 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2I7N9P4-F1-model_v4 GNAT family N-acetyltransferase 0.9955 5 165 GO:0016747
AF-A0A4Q7U8J8-F1-model_v4 deleted 0.9938 1 176
AF-A0A1C3UHM1-F1-model_v4 Phosphinothricin acetyltransferase 0.9936 1 176 GO:0016747
AF-A0A382V1F4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9935 2 133 GO:0016747
AF-A0A1G8AUB9-F1-model_v4 Phosphinothricin acetyltransferase 0.993 6 166 GO:0016747

Map