F470477

General Info

Members Datasets Scaffolds Average Seq Length
626 259 1252 100

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0081578|Ga0373945_0081578_823_1185
Length 120
Sequence MQFDYLTGRWDERENGGRMDFSSAASAASDDAHDEDLDGLSRRDREILAFERQWWKYAGAKEQAIRELFDMSATRYYQVLNALIDRPEALVADPLLVRRLRRMRAERQRVRSARRLGFEV

Samples

Sample ID Description Type Environment
1 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
124 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
138 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
139 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
154 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 2643221613 Oerskovia sp. Root22 Isolate Unclassified
252 2643221721 Oerskovia sp. Root918 Isolate Unclassified
253 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
254 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
255 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
256 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
257 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
258 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
259 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 3.51
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 13.26
Rhizosphere 81.47
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373945_0081578 3300035116 Bacteria 1240
2 JGI24737J22298_10095623 3300001990 Bacteria 881
3 JGI24735J21928_10053969 3300002067 Bacteria 1158
4 Ga0070658_10310099 3300005327 Bacteria 1346
5 Ga0070658_10510634 3300005327 Bacteria 1039
6 Ga0070683_100145352 3300005329 Bacteria 2247
7 Ga0070683_100305198 3300005329 Bacteria 1514
8 Ga0070683_100499108 3300005329 Bacteria 1162
9 Ga0070683_100645150 3300005329 Bacteria 1014
10 Ga0070683_100856257 3300005329 Bacteria 872
11 Ga0070680_100014434 3300005336 Bacteria 6176
12 Ga0070680_100187008 3300005336 Bacteria 1745
13 Ga0070680_100277356 3300005336 Bacteria 1420
14 Ga0070682_100143255 3300005337 Bacteria 1632
15 Ga0070682_100390350 3300005337 Bacteria 1050
16 Ga0070682_100618225 3300005337 Bacteria 858
17 Ga0070660_100570516 3300005339 Bacteria 945
18 Ga0070660_100692658 3300005339 Bacteria 854
19 Ga0070660_100994039 3300005339 Bacteria 709
20 Ga0070687_100355592 3300005343 Bacteria 947
21 Ga0070692_11394541 3300005345 Bacteria 506
22 Ga0070668_100326144 3300005347 Bacteria 1294
23 Ga0070671_101055390 3300005355 Bacteria 713
24 Ga0070659_100387602 3300005366 Bacteria 1178
25 Ga0070714_100000010 3300005435 Bacteria 262871
26 Ga0070714_101841911 3300005435 Bacteria 591
27 Ga0070713_101347438 3300005436 Bacteria 692
28 Ga0070710_10453441 3300005437 Bacteria 870
29 Ga0070701_11042171 3300005438 Bacteria 573
30 Ga0070708_100305573 3300005445 Unclassified 1498
31 Ga0070663_100092750 3300005455 Bacteria 2240
32 Ga0070663_100494426 3300005455 Bacteria 1015
33 Ga0070663_100636148 3300005455 Bacteria 901
34 Ga0070663_100753169 3300005455 Bacteria 832
35 Ga0070678_100363398 3300005456 Bacteria 1248
36 Ga0070681_10010044 3300005458 Bacteria 9331
37 Ga0070681_10315449 3300005458 Bacteria 1473
38 Ga0070681_10390741 3300005458 Bacteria 1302
39 Ga0070685_10465226 3300005466 Bacteria 889
40 Ga0070706_101423448 3300005467 Unclassified 634
41 Ga0070679_100005832 3300005530 Bacteria 11425
42 Ga0070679_100064024 3300005530 Bacteria 3664
43 Ga0070679_100130181 3300005530 Bacteria 2497
44 Ga0070679_100219072 3300005530 Bacteria 1865
45 Ga0070679_100310395 3300005530 Bacteria 1527
46 Ga0070679_100455761 3300005530 Bacteria 1223
47 Ga0070684_100314072 3300005535 Bacteria 1439
48 Ga0070684_100708568 3300005535 Bacteria 938
49 Ga0070684_101947369 3300005535 Bacteria 555
50 Ga0068853_102288055 3300005539 Bacteria 524
51 Ga0070672_100663912 3300005543 Bacteria 911
52 Ga0070696_100003113 3300005546 Bacteria 11038
53 Ga0070693_100122110 3300005547 Bacteria 1617
54 Ga0070693_100122846 3300005547 Bacteria 1613
55 Ga0070665_100169321 3300005548 Bacteria 2186
56 Ga0070665_100323322 3300005548 Bacteria 1547
57 Ga0070665_100948714 3300005548 Bacteria 873
58 Ga0070704_101470429 3300005549 Bacteria 626
59 Ga0068855_100266254 3300005563 Bacteria 1907
60 Ga0068855_100510149 3300005563 Bacteria 1306
61 Ga0070664_100498759 3300005564 Bacteria 1122
62 Ga0070664_101176606 3300005564 Bacteria 723
63 Ga0068857_100214008 3300005577 Bacteria 1759
64 Ga0068854_100247533 3300005578 Bacteria 1422
65 Ga0068854_100780719 3300005578 Bacteria 831
66 Ga0068856_100081943 3300005614 Bacteria 3202
67 Ga0068856_100175950 3300005614 Bacteria 2152
68 Ga0068856_101684205 3300005614 Bacteria 647
69 Ga0068856_102303943 3300005614 Bacteria 547
70 Ga0068856_102341065 3300005614 Bacteria 542
71 Ga0068852_100013367 3300005616 Bacteria 6283
72 Ga0068852_100482649 3300005616 Bacteria 1232
73 Ga0068852_101629102 3300005616 Bacteria 668
74 Ga0068864_102508121 3300005618 Bacteria 522
75 Ga0068866_10180415 3300005718 Bacteria 1247
76 Ga0068851_10854338 3300005834 Bacteria 568
77 Ga0068870_10452167 3300005840 Bacteria 847
78 Ga0068870_10916938 3300005840 Bacteria 620
79 Ga0068858_100860558 3300005842 Bacteria 886
80 Ga0075363_100174372 3300006048 Bacteria 1222
81 Ga0070716_100456104 3300006173 Bacteria 933
82 Ga0070712_100887705 3300006175 Bacteria 768
83 Ga0070712_101828220 3300006175 Bacteria 532
84 Ga0097621_101182537 3300006237 Bacteria 720
85 Ga0068865_100882298 3300006881 Bacteria 777
86 Ga0105240_10132520 3300009093 Bacteria 2988
87 Ga0105240_11156589 3300009093 Bacteria 821
88 Ga0105240_11487337 3300009093 Bacteria 710
89 Ga0105240_11799359 3300009093 Bacteria 638
90 Ga0111539_11247115 3300009094 Bacteria 863
91 Ga0105245_10423117 3300009098 Bacteria 1335
92 Ga0105245_10756319 3300009098 Bacteria 1008
93 Ga0105245_11094066 3300009098 Bacteria 843
94 Ga0105245_11242285 3300009098 Bacteria 793
95 Ga0105247_10026514 3300009101 Bacteria 3500
96 Ga0105243_10325620 3300009148 Bacteria 1402
97 Ga0105243_10337867 3300009148 Bacteria 1378
98 Ga0105241_10142610 3300009174 Bacteria 1952
99 Ga0105241_11495697 3300009174 Bacteria 650
100 Ga0105248_10276341 3300009177 Bacteria 1891
101 Ga0105248_11903469 3300009177 Bacteria 675
102 Ga0105248_11949918 3300009177 Bacteria 667
103 Ga0105237_10480559 3300009545 Bacteria 1249
104 Ga0105237_11151535 3300009545 Bacteria 782
105 Ga0105237_11526929 3300009545 Bacteria 675
106 Ga0105237_12219400 3300009545 Bacteria 558
107 Ga0105238_10502562 3300009551 Bacteria 1213
108 Ga0105249_10600177 3300009553 Bacteria 1155
109 Ga0105249_11321984 3300009553 Bacteria 792
110 Ga0105249_11397955 3300009553 Bacteria 772
111 Ga0105239_10197122 3300010375 Bacteria 2255
112 Ga0105239_10640366 3300010375 Bacteria 1214
113 Ga0105246_10791789 3300011119 Bacteria 840
114 Ga0157373_10654083 3300013100 Bacteria 768
115 Ga0157370_10502624 3300013104 Bacteria 1113
116 Ga0157370_11014623 3300013104 Bacteria 751
117 Ga0157370_11056459 3300013104 Bacteria 734
118 Ga0157369_10032493 3300013105 Bacteria 5738
119 Ga0157369_10115868 3300013105 Bacteria 2846
120 Ga0157369_10211325 3300013105 Bacteria 2033
121 Ga0157369_10234110 3300013105 Bacteria 1920
122 Ga0157369_10762451 3300013105 Bacteria 995
123 Ga0157369_10855897 3300013105 Bacteria 933
124 Ga0157369_11568368 3300013105 Bacteria 670
125 Ga0157374_10751349 3300013296 Bacteria 990
126 Ga0157374_11111854 3300013296 Bacteria 811
127 Ga0163162_10899923 3300013306 Bacteria 998
128 Ga0163162_10990218 3300013306 Bacteria 950
129 Ga0157372_10524261 3300013307 Bacteria 1381
130 Ga0157372_10541263 3300013307 Bacteria 1357
131 Ga0157372_10968222 3300013307 Bacteria 986
132 Ga0157372_12453838 3300013307 Bacteria 599
133 Ga0157375_10007894 3300013308 Bacteria 9316
134 Ga0157375_10290779 3300013308 Bacteria 1797
135 Ga0157375_10351461 3300013308 Bacteria 1640
136 Ga0157375_10652433 3300013308 Bacteria 1209
137 Ga0157375_12597656 3300013308 Bacteria 605
138 Ga0157375_13765980 3300013308 Bacteria 504
139 Ga0163163_10058078 3300014325 Bacteria 3825
140 Ga0163163_10509694 3300014325 Bacteria 1265
141 Ga0157380_12121954 3300014326 Bacteria 625
142 Ga0157380_13240049 3300014326 Bacteria 520
143 Ga0182008_10638512 3300014497 Bacteria 602
144 Ga0157377_10542408 3300014745 Bacteria 820
145 Ga0157379_11207618 3300014968 Bacteria 728
146 Ga0157376_10514012 3300014969 Bacteria 1179
147 Ga0163161_10026453 3300017792 Bacteria 4109
148 Ga0197907_10701904 3300020069 Bacteria 1111
149 Ga0197907_10917757 3300020069 Bacteria 830
150 Ga0197907_11302365 3300020069 Bacteria 879
151 Ga0206356_10244213 3300020070 Bacteria 1400
152 Ga0206356_10317816 3300020070 Bacteria 544
153 Ga0206356_10893727 3300020070 Bacteria 781
154 Ga0206349_1876287 3300020075 Bacteria 515
155 Ga0206350_10812855 3300020080 Bacteria 553
156 Ga0206354_10351692 3300020081 Bacteria 1280
157 Ga0206354_10638130 3300020081 Bacteria 552
158 Ga0206354_10901839 3300020081 Bacteria 544
159 Ga0206354_11710813 3300020081 Bacteria 1355
160 Ga0206353_10173779 3300020082 Bacteria 1976
161 Ga0206353_10277316 3300020082 Bacteria 1277
162 Ga0206353_10964427 3300020082 Bacteria 1639
163 Ga0206353_11258726 3300020082 Bacteria 1781
164 Ga0206353_11609099 3300020082 Bacteria 1575
165 Ga0206353_12042904 3300020082 Bacteria 1787
166 Ga0213876_10061655 3300021384 Bacteria 1979
167 Ga0224712_10294360 3300022467 Bacteria 758
168 Ga0224712_10443418 3300022467 Bacteria 623
169 Ga0224712_10590411 3300022467 Bacteria 542
170 Ga0207692_10375263 3300025898 Bacteria 882
171 Ga0207642_10418385 3300025899 Bacteria 805
172 Ga0207710_10012319 3300025900 Bacteria 3598
173 Ga0207680_11112138 3300025903 Bacteria 565
174 Ga0207647_10344229 3300025904 Bacteria 844
175 Ga0207647_10492070 3300025904 Bacteria 684
176 Ga0207643_10426591 3300025908 Bacteria 841
177 Ga0207643_10912612 3300025908 Bacteria 569
178 Ga0207705_10425844 3300025909 Bacteria 1028
179 Ga0207654_11011513 3300025911 Bacteria 605
180 Ga0207707_10078539 3300025912 Bacteria 2882
181 Ga0207707_10481438 3300025912 Bacteria 1060
182 Ga0207707_10557762 3300025912 Bacteria 973
183 Ga0207707_10733637 3300025912 Bacteria 827
184 Ga0207695_10128309 3300025913 Bacteria 2496
185 Ga0207695_10836988 3300025913 Bacteria 800
186 Ga0207671_10708223 3300025914 Bacteria 801
187 Ga0207660_10071612 3300025917 Bacteria 2523
188 Ga0207660_10138311 3300025917 Bacteria 1860
189 Ga0207660_10829596 3300025917 Bacteria 754
190 Ga0207660_11133874 3300025917 Bacteria 637
191 Ga0207660_11146026 3300025917 Bacteria 633
192 Ga0207662_10296509 3300025918 Bacteria 1074
193 Ga0207657_10104989 3300025919 Bacteria 2340
194 Ga0207657_10123760 3300025919 Bacteria 2126
195 Ga0207657_10967975 3300025919 Bacteria 654
196 Ga0207652_10031624 3300025921 Bacteria 4446
197 Ga0207652_10127893 3300025921 Bacteria 2264
198 Ga0207652_10415418 3300025921 Bacteria 1213
199 Ga0207652_11774101 3300025921 Bacteria 522
200 Ga0207652_11880100 3300025921 Bacteria 504
201 Ga0207694_10289113 3300025924 Bacteria 1348
202 Ga0207694_10586231 3300025924 Bacteria 937
203 Ga0207687_10066706 3300025927 Bacteria 2558
204 Ga0207687_10958013 3300025927 Bacteria 733
205 Ga0207700_11116506 3300025928 Bacteria 705
206 Ga0207664_10000009 3300025929 Bacteria 299246
207 Ga0207664_10784182 3300025929 Bacteria 857
208 Ga0207644_10793168 3300025931 Bacteria 792
209 Ga0207644_11379525 3300025931 Bacteria 592
210 Ga0207690_10122138 3300025932 Bacteria 1894
211 Ga0207709_11343961 3300025935 Bacteria 591
212 Ga0207704_10236620 3300025938 Bacteria 1362
213 Ga0207691_10451813 3300025940 Bacteria 1093
214 Ga0207711_11638681 3300025941 Bacteria 587
215 Ga0207711_11966998 3300025941 Bacteria 527
216 Ga0207661_10316689 3300025944 Bacteria 1402
217 Ga0207661_10409150 3300025944 Bacteria 1231
218 Ga0207661_10521156 3300025944 Bacteria 1087
219 Ga0207661_10822931 3300025944 Bacteria 855
220 Ga0207661_11346483 3300025944 Bacteria 655
221 Ga0207679_10282135 3300025945 Bacteria 1425
222 Ga0207679_10611184 3300025945 Bacteria 983
223 Ga0207679_10645570 3300025945 Bacteria 957
224 Ga0207667_10052548 3300025949 Bacteria 4291
225 Ga0207667_10088545 3300025949 Bacteria 3201
226 Ga0207667_10330606 3300025949 Bacteria 1556
227 Ga0207667_10351638 3300025949 Bacteria 1503
228 Ga0207712_10489669 3300025961 Bacteria 1049
229 Ga0207668_10254653 3300025972 Bacteria 1428
230 Ga0207677_10396112 3300026023 Bacteria 1170
231 Ga0207677_10695943 3300026023 Bacteria 901
232 Ga0207639_10345563 3300026041 Bacteria 1327
233 Ga0207639_11186448 3300026041 Bacteria 716
234 Ga0207639_12093070 3300026041 Bacteria 527
235 Ga0207678_10421513 3300026067 Bacteria 1157
236 Ga0207678_10712868 3300026067 Bacteria 883
237 Ga0207702_10038959 3300026078 Bacteria 3981
238 Ga0207702_10748059 3300026078 Bacteria 965
239 Ga0207702_11058328 3300026078 Bacteria 805
240 Ga0207702_11386252 3300026078 Bacteria 697
241 Ga0207702_12268584 3300026078 Bacteria 531
242 Ga0207674_10140446 3300026116 Bacteria 2375
243 Ga0207674_10311236 3300026116 Bacteria 1524
244 Ga0207683_10256659 3300026121 Bacteria 1596
245 Ga0207683_10802541 3300026121 Bacteria 873
246 Ga0207698_10024260 3300026142 Bacteria 4253
247 Ga0207698_10200576 3300026142 Bacteria 1786
248 Ga0207698_10950229 3300026142 Bacteria 868
249 Ga0207698_12197664 3300026142 Bacteria 565
250 Ga0268266_10239575 3300028379 Bacteria 1674
251 Ga0268264_10866789 3300028381 Bacteria 905
252 Ga0307515_10869658 3300028794 Bacteria 530
253 Ga0307513_10140170 3300031456 Bacteria 2346
254 Ga0316575_10029775 3300031665 Bacteria 2132
255 Ga0316579_10004462 3300031691 Bacteria 5555
256 Ga0316579_10021273 3300031691 Bacteria 2888
257 Ga0316576_10002480 3300031727 Bacteria 10500
258 Ga0316576_10063258 3300031727 Bacteria 2715
259 Ga0316578_10011944 3300031728 Bacteria 4565
260 Ga0316578_10022067 3300031728 Bacteria 3543
261 Ga0307405_10021175 3300031731 Bacteria 3651
262 Ga0316577_10079136 3300031733 Bacteria 1836
263 Ga0316577_10126766 3300031733 Bacteria 1435
264 Ga0307413_11465124 3300031824 Bacteria 602
265 Ga0307413_11852353 3300031824 Bacteria 541
266 Ga0307410_10317934 3300031852 Bacteria 1234
267 Ga0307407_11362095 3300031903 Bacteria 558
268 Ga0307412_10830372 3300031911 Bacteria 805
269 Ga0307409_100549955 3300031995 Bacteria 1133
270 Ga0307409_101445090 3300031995 Bacteria 714
271 Ga0307409_102424934 3300031995 Bacteria 553
272 Ga0307416_100166658 3300032002 Bacteria 2044
273 Ga0307416_101554351 3300032002 Bacteria 767
274 Ga0307411_11828333 3300032005 Bacteria 564
275 Ga0307415_100669245 3300032126 Bacteria 933
276 Ga0307415_101397904 3300032126 Bacteria 666
277 Ga0316583_10057532 3300032133 Bacteria 1365
278 Ga0316585_10001789 3300032137 Bacteria 5745
279 Ga0316585_10006913 3300032137 Bacteria 3257
280 Ga0316580_10029033 3300032139 Bacteria 1710
281 Ga0316580_10039029 3300032139 Bacteria 1467
282 Ga0373943_0589675 3300035170 Bacteria 654
283 Ga0316574_0094295 3300035398 Bacteria 1911
284 Ga0316574_0499597 3300035398 Bacteria 758
285 Ga0316574_0769199 3300035398 Bacteria 588
286 Ga0316574_0815398 3300035398 Bacteria 567
287 Ga0316582_0006356 3300036647 Bacteria 6197
288 Ga0316582_0009834 3300036647 Bacteria 5207
289 Ga0316584_0015015 3300036712 Bacteria 5531
290 Ga0316584_0038685 3300036712 Bacteria 3549
291 Ga0316584_0586919 3300036712 Bacteria 774
292 Ga0316581_0001949 3300037588 Bacteria 4828
293 Ga0436365_0779088 3300039437 Bacteria 3689
294 Ga0439436_0189074 3300041404 Bacteria 587
295 Ga0451787_210124 3300041441 Bacteria 1212
296 Ga0451791_1660553 3300041451 Bacteria 1715
297 Ga0451793_0751648 3300041452 Bacteria 542
298 Ga0451797_0658121 3300041453 Bacteria 1868
299 Ga0451797_1209429 3300041453 Bacteria 567
300 Ga0451802_1357028 3300041460 Bacteria 563
301 Ga0451807_1158303 3300041486 Bacteria 612
302 Ga0451841_1236843 3300041498 Bacteria 2382
303 Ga0451847_0741165 3300041503 Bacteria 613
304 Ga0451853_3643746 3300041512 Bacteria 880
305 Ga0439431_0242065 3300041997 Bacteria 534
306 Ga0439449_0041534 3300042007 Bacteria 1710
307 Ga0439462_0024815 3300042015 Bacteria 1577
308 Ga0466969_0038907 3300044656 Bacteria 2391
309 Ga0466969_0146072 3300044656 Bacteria 1091
310 Ga0466969_0510545 3300044656 Bacteria 549
311 Ga0466972_0016237 3300044658 Bacteria 3721
312 Ga0466972_0053943 3300044658 Bacteria 1935
313 Ga0466972_0248132 3300044658 Bacteria 832
314 Ga0466972_0515694 3300044658 Bacteria 563
315 Ga0466965_0053244 3300044683 Bacteria 2011
316 Ga0466965_0159293 3300044683 Bacteria 1183
317 Ga0466966_0008575 3300044684 Bacteria 6766
318 Ga0466966_0009202 3300044684 Bacteria 6539
319 Ga0466966_0030629 3300044684 Bacteria 3491
320 Ga0466966_0040771 3300044684 Bacteria 2987
321 Ga0466966_0053855 3300044684 Bacteria 2552
322 Ga0466966_0173885 3300044684 Bacteria 1308
323 Ga0466966_0245887 3300044684 Bacteria 1078
324 Ga0466966_0277947 3300044684 Bacteria 1007
325 Ga0466966_0443536 3300044684 Bacteria 780
326 Ga0466966_0455862 3300044684 Bacteria 769
327 Ga0466961_0013336 3300044693 Bacteria 5261
328 Ga0466961_0013777 3300044693 Bacteria 5182
329 Ga0466961_0017982 3300044693 Bacteria 4545
330 Ga0466961_0025565 3300044693 Bacteria 3797
331 Ga0466961_0036961 3300044693 Bacteria 3134
332 Ga0466961_0039894 3300044693 Bacteria 3009
333 Ga0466961_0054253 3300044693 Bacteria 2557
334 Ga0466961_0065557 3300044693 Bacteria 2308
335 Ga0466961_0087703 3300044693 Bacteria 1966
336 Ga0466961_0109684 3300044693 Bacteria 1737
337 Ga0466961_0129512 3300044693 Bacteria 1582
338 Ga0466961_0202563 3300044693 Bacteria 1227
339 Ga0466961_0446667 3300044693 Bacteria 783
340 Ga0466963_0023698 3300044694 Bacteria 3901
341 Ga0466963_0035562 3300044694 Bacteria 3246
342 Ga0466963_0052194 3300044694 Bacteria 2712
343 Ga0466963_0079087 3300044694 Bacteria 2224
344 Ga0466963_0102033 3300044694 Bacteria 1964
345 Ga0466963_0233722 3300044694 Bacteria 1288
346 Ga0466963_0250710 3300044694 Bacteria 1242
347 Ga0466963_0318594 3300044694 Bacteria 1094
348 Ga0466963_1328435 3300044694 Bacteria 504
349 Ga0466964_0011435 3300044706 Bacteria 3353
350 Ga0466964_0024894 3300044706 Bacteria 2334
351 Ga0466964_0089994 3300044706 Bacteria 1334
352 Ga0466964_0102355 3300044706 Bacteria 1265
353 Ga0466964_0319268 3300044706 Bacteria 789
354 Ga0466964_0612938 3300044706 Bacteria 598
355 Ga0466971_0011469 3300044719 Bacteria 3881
356 Ga0466971_0024472 3300044719 Bacteria 2694
357 Ga0466971_0036102 3300044719 Bacteria 2216
358 Ga0466971_0041775 3300044719 Bacteria 2060
359 Ga0466971_0243649 3300044719 Bacteria 855
360 Ga0466971_0323461 3300044719 Bacteria 743
361 Ga0466971_0431977 3300044719 Bacteria 644
362 Ga0466968_0190203 3300044735 Bacteria 957
363 Ga0466968_0503874 3300044735 Bacteria 603
364 Ga0466970_0021343 3300044765 Bacteria 3373
365 Ga0466970_0028421 3300044765 Bacteria 2938
366 Ga0466970_0231976 3300044765 Bacteria 1031
367 Ga0466970_0497501 3300044765 Bacteria 702
368 Ga0466957_0007445 3300044842 Bacteria 6184
369 Ga0466957_0024221 3300044842 Bacteria 3591
370 Ga0466957_0037002 3300044842 Bacteria 2937
371 Ga0466957_0135547 3300044842 Bacteria 1582
372 Ga0466957_0218772 3300044842 Bacteria 1257
373 Ga0466957_0478015 3300044842 Bacteria 861
374 Ga0466957_0490285 3300044842 Bacteria 851
375 Ga0466957_0675856 3300044842 Bacteria 727
376 Ga0466957_1115497 3300044842 Bacteria 569
377 Ga0466960_0027851 3300044901 Bacteria 2581
378 Ga0466960_0073871 3300044901 Bacteria 1703
379 Ga0466960_0105365 3300044901 Bacteria 1457
380 Ga0466960_0147587 3300044901 Bacteria 1254
381 Ga0466960_0194193 3300044901 Bacteria 1106
382 Ga0466960_0270048 3300044901 Bacteria 950
383 Ga0466960_0342771 3300044901 Bacteria 851
384 Ga0466959_0146847 3300045049 Bacteria 1663
385 Ga0466959_0154139 3300045049 Bacteria 1618
386 Ga0466959_0169849 3300045049 Bacteria 1530
387 Ga0466959_0224305 3300045049 Bacteria 1302
388 Ga0466959_0267271 3300045049 Bacteria 1176
389 Ga0466959_0448734 3300045049 Bacteria 874
390 Ga0466959_0515924 3300045049 Bacteria 807
391 Ga0466959_0519225 3300045049 Bacteria 804
392 Ga0466959_0571521 3300045049 Bacteria 762
393 Ga0466959_0589434 3300045049 Bacteria 748
394 Ga0466959_0746953 3300045049 Bacteria 655
395 Ga0466958_0008070 3300045836 Bacteria 5825
396 Ga0466958_0026241 3300045836 Bacteria 3442
397 Ga0466958_0040967 3300045836 Bacteria 2784
398 Ga0466958_0085002 3300045836 Bacteria 1951
399 Ga0466958_0129093 3300045836 Bacteria 1586
400 Ga0466958_0161582 3300045836 Bacteria 1415
401 Ga0466958_0175888 3300045836 Bacteria 1357
402 Ga0466958_0909473 3300045836 Bacteria 574
403 Ga0466967_0005628 3300045976 Bacteria 8717
404 Ga0466967_0021302 3300045976 Bacteria 5261
405 Ga0466967_0076707 3300045976 Bacteria 3007
406 Ga0466967_0103319 3300045976 Bacteria 2607
407 Ga0466967_0107114 3300045976 Bacteria 2563
408 Ga0466967_0116246 3300045976 Bacteria 2464
409 Ga0466967_0141535 3300045976 Bacteria 2241
410 Ga0466967_0163670 3300045976 Bacteria 2090
411 Ga0466967_0188014 3300045976 Bacteria 1951
412 Ga0466967_0191352 3300045976 Bacteria 1934
413 Ga0466967_0210847 3300045976 Bacteria 1842
414 Ga0466967_0221778 3300045976 Bacteria 1797
415 Ga0466967_0405726 3300045976 Bacteria 1327
416 Ga0466967_0539017 3300045976 Bacteria 1148
417 Ga0466967_0627678 3300045976 Bacteria 1062
418 Ga0466967_0735522 3300045976 Bacteria 978
419 Ga0466967_0873288 3300045976 Bacteria 894
420 Ga0466967_0978747 3300045976 Bacteria 842
421 Ga0466967_1095674 3300045976 Bacteria 793
422 Ga0495629_0256022 3300046459 Bacteria 1204
423 Ga0495582_0504684 3300046473 Bacteria 699
424 Ga0495582_0603705 3300046473 Bacteria 635
425 Ga0495608_0538427 3300046511 Bacteria 704
426 Ga0495657_0491479 3300046675 Bacteria 716
427 Ga0495647_0160771 3300046681 Bacteria 968
428 Ga0495669_0002278 3300046684 Bacteria 7871
429 Ga0495613_0544607 3300046689 Bacteria 777
430 Ga0495600_0508192 3300046809 Bacteria 740
431 Ga0495581_0040087 3300047315 Bacteria 2711
432 Ga0495614_0404070 3300048089 Bacteria 642
433 Ga0496100_0098780 3300048903 Bacteria 2007
434 Ga0496100_0266465 3300048903 Bacteria 1272
435 Ga0496100_1268514 3300048903 Bacteria 581
436 Ga0496100_1304107 3300048903 Bacteria 573
437 Ga0496100_1568059 3300048903 Bacteria 520
438 Ga0496101_0030867 3300048904 Bacteria 3762
439 Ga0496101_0268987 3300048904 Bacteria 1330
440 Ga0496101_0620492 3300048904 Bacteria 855
441 Ga0496101_1521608 3300048904 Bacteria 521
442 Ga0496102_0000023 3300048905 Bacteria 237015
443 Ga0496102_0000814 3300048905 Bacteria 30342
444 Ga0496102_0013010 3300048905 Bacteria 7205
445 Ga0496102_0142753 3300048905 Bacteria 2246
446 Ga0496102_0239286 3300048905 Bacteria 1712
447 Ga0496102_0253623 3300048905 Bacteria 1659
448 Ga0496103_0000189 3300048906 Bacteria 61964
449 Ga0496103_0181379 3300048906 Bacteria 1353
450 Ga0496103_0621819 3300048906 Bacteria 687
451 Ga0496104_0117362 3300048907 Bacteria 2554
452 Ga0496104_0263661 3300048907 Bacteria 1635
453 Ga0496104_0405723 3300048907 Bacteria 1275
454 Ga0496104_0425735 3300048907 Bacteria 1239
455 Ga0496105_0021433 3300048908 Bacteria 5229
456 Ga0496105_0533153 3300048908 Bacteria 918
457 Ga0496106_1459769 3300048909 Bacteria 527
458 Ga0496107_0086088 3300048910 Bacteria 2293
459 Ga0496107_0547834 3300048910 Bacteria 857
460 Ga0496107_0578337 3300048910 Bacteria 831
461 Ga0496107_0983036 3300048910 Bacteria 613
462 Ga0496108_0112016 3300048911 Bacteria 2334
463 Ga0496108_0119036 3300048911 Bacteria 2264
464 Ga0496108_0275677 3300048911 Bacteria 1464
465 Ga0496108_0362979 3300048911 Bacteria 1264
466 Ga0496108_0469631 3300048911 Bacteria 1099
467 Ga0496108_0590114 3300048911 Bacteria 968
468 Ga0496108_1026604 3300048911 Bacteria 703
469 Ga0496109_0038134 3300048912 Bacteria 4343
470 Ga0496109_0076964 3300048912 Bacteria 3069
471 Ga0496109_0086184 3300048912 Bacteria 2900
472 Ga0496109_0147673 3300048912 Bacteria 2200
473 Ga0496109_0175998 3300048912 Bacteria 2008
474 Ga0496109_0513123 3300048912 Bacteria 1131
475 Ga0496109_0526006 3300048912 Bacteria 1116
476 Ga0496109_0553156 3300048912 Bacteria 1086
477 Ga0496109_1322613 3300048912 Bacteria 657
478 Ga0496110_0007657 3300048913 Bacteria 8643
479 Ga0496110_0052536 3300048913 Bacteria 3581
480 Ga0496110_0125547 3300048913 Bacteria 2315
481 Ga0496110_0135564 3300048913 Bacteria 2225
482 Ga0496110_0493619 3300048913 Bacteria 1115
483 Ga0496110_0651623 3300048913 Bacteria 953
484 Ga0496110_1256971 3300048913 Bacteria 649
485 Ga0496111_0011756 3300048914 Bacteria 5910
486 Ga0496111_0064575 3300048914 Bacteria 2655
487 Ga0496111_0197014 3300048914 Bacteria 1497
488 Ga0496111_0273813 3300048914 Bacteria 1252
489 Ga0496111_0613380 3300048914 Bacteria 796
490 Ga0496111_0669099 3300048914 Bacteria 757
491 Ga0496111_1243184 3300048914 Bacteria 526
492 Ga0496112_0021172 3300048915 Bacteria 6179
493 Ga0496112_0295381 3300048915 Bacteria 1566
494 Ga0496112_0576378 3300048915 Bacteria 1058
495 Ga0496113_0045377 3300048916 Bacteria 3260
496 Ga0496113_0528082 3300048916 Bacteria 947
497 Ga0496113_0629218 3300048916 Bacteria 859
498 Ga0496114_0008482 3300048917 Bacteria 8143
499 Ga0496114_0011690 3300048917 Bacteria 7019
500 Ga0496114_0017862 3300048917 Bacteria 5733
501 Ga0496114_0140368 3300048917 Bacteria 2091
502 Ga0496114_0189785 3300048917 Bacteria 1798
503 Ga0496114_0201422 3300048917 Bacteria 1743
504 Ga0496114_0436249 3300048917 Bacteria 1160
505 Ga0496115_0042981 3300048918 Bacteria 3602
506 Ga0496115_0071990 3300048918 Bacteria 2804
507 Ga0496115_0134194 3300048918 Bacteria 2041
508 Ga0496115_0540274 3300048918 Bacteria 933
509 Ga0496117_0149570 3300048920 Bacteria 1384
510 Ga0496117_0262162 3300048920 Bacteria 936
511 Ga0496118_0060605 3300048921 Bacteria 2808
512 Ga0496118_0067262 3300048921 Bacteria 2610
513 Ga0496118_0395959 3300048921 Bacteria 719
514 Ga0496119_0000091 3300048922 Bacteria 133090
515 Ga0496119_0022069 3300048922 Bacteria 4573
516 Ga0496119_0047773 3300048922 Bacteria 2660
517 Ga0496120_0005081 3300048923 Bacteria 10647
518 Ga0496121_0088639 3300048924 Bacteria 2425
519 Ga0496122_0000615 3300048925 Bacteria 73137
520 Ga0496124_0364042 3300048927 Bacteria 1018
521 Ga0496125_0000069 3300048928 Bacteria 246981
522 Ga0496126_0116669 3300048929 Bacteria 2320
523 Ga0501317_074115 3300049533 Bacteria 579
524 Ga0501031_0007997 3300049568 Bacteria 6885
525 Ga0501031_0038662 3300049568 Bacteria 3114
526 Ga0501031_0241461 3300049568 Bacteria 1174
527 Ga0501031_1042986 3300049568 Bacteria 522
528 Ga0501032_0001905 3300049569 Bacteria 16469
529 Ga0501032_0004933 3300049569 Bacteria 9981
530 Ga0501033_0186042 3300049570 Bacteria 1488
531 Ga0501033_0275377 3300049570 Bacteria 1189
532 Ga0501033_0277701 3300049570 Bacteria 1183
533 Ga0501034_0096678 3300049571 Bacteria 2949
534 Ga0501034_0351406 3300049571 Bacteria 1402
535 Ga0501034_0802707 3300049571 Bacteria 834
536 Ga0501036_0066115 3300049572 Bacteria 3059
537 Ga0501036_0134184 3300049572 Bacteria 2089
538 Ga0501036_0334651 3300049572 Bacteria 1264
539 Ga0501036_1455825 3300049572 Bacteria 555
540 Ga0501037_0026027 3300049573 Bacteria 4323
541 Ga0501037_0750944 3300049573 Bacteria 646
542 Ga0501037_0991710 3300049573 Bacteria 547
543 Ga0501038_0000544 3300049574 Bacteria 33088
544 Ga0501038_0005369 3300049574 Bacteria 11903
545 Ga0501038_0249991 3300049574 Bacteria 1405
546 Ga0501039_0059299 3300049575 Bacteria 2965
547 Ga0501039_0671433 3300049575 Bacteria 811
548 Ga0501041_0138969 3300049577 Bacteria 1514
549 Ga0501042_0166539 3300049578 Bacteria 1590
550 Ga0501042_0345984 3300049578 Bacteria 1075
551 Ga0501042_1113777 3300049578 Bacteria 576
552 Ga0501043_0022047 3300049579 Bacteria 4997
553 Ga0501043_0083783 3300049579 Bacteria 2506
554 Ga0501043_0559036 3300049579 Bacteria 849
555 Ga0501043_1277607 3300049579 Bacteria 513
556 Ga0501046_0004176 3300049580 Bacteria 13148
557 Ga0501046_0094178 3300049580 Bacteria 2302
558 Ga0501047_0010629 3300049581 Bacteria 8702
559 Ga0501047_0036160 3300049581 Bacteria 4771
560 Ga0501047_0261859 3300049581 Bacteria 1577
561 Ga0501047_1320137 3300049581 Bacteria 536
562 Ga0501048_0000090 3300049582 Bacteria 48441
563 Ga0501048_0190769 3300049582 Bacteria 1452
564 Ga0501048_0475726 3300049582 Bacteria 895
565 Ga0501067_0178482 3300049583 Bacteria 1183
566 Ga0501067_0630487 3300049583 Bacteria 601
567 Ga0501067_0714032 3300049583 Bacteria 564
568 Ga0501069_0423997 3300049585 Bacteria 789
569 Ga0501069_0459364 3300049585 Bacteria 757
570 Ga0501070_0069070 3300049586 Bacteria 2925
571 Ga0501070_0543564 3300049586 Bacteria 930
572 Ga0501070_1219140 3300049586 Bacteria 577
573 Ga0501071_0097091 3300049587 Bacteria 2169
574 Ga0501071_0335169 3300049587 Bacteria 1150
575 Ga0501072_0071677 3300049588 Bacteria 2738
576 Ga0501073_0231910 3300049589 Bacteria 1275
577 Ga0501074_0529549 3300049590 Bacteria 834
578 Ga0501074_0776599 3300049590 Bacteria 675
579 Ga0501074_1296820 3300049590 Bacteria 510
580 Ga0501075_0029819 3300049591 Bacteria 4036
581 Ga0501076_0223905 3300049592 Bacteria 1537
582 Ga0501076_0919954 3300049592 Bacteria 721
583 Ga0501077_0342016 3300049593 Bacteria 954
584 Ga0501079_0082804 3300049741 Bacteria 2482
585 Ga0501080_0195538 3300049742 Bacteria 1858
586 Ga0501081_0040477 3300049743 Bacteria 3191
587 Ga0501083_0029316 3300049744 Bacteria 3786
588 Ga0501035_0021274 3300049822 Bacteria 5963
589 Ga0501035_0157396 3300049822 Bacteria 1968
590 Ga0501035_0218128 3300049822 Bacteria 1630
591 Ga0501035_1474296 3300049822 Bacteria 519
592 Ga0501044_0009188 3300049823 Bacteria 10797
593 Ga0501044_0033912 3300049823 Bacteria 5359
594 Ga0501044_0215886 3300049823 Bacteria 1870
595 Ga0501045_0051995 3300049824 Bacteria 2990
596 Ga0501045_0097091 3300049824 Bacteria 2180
597 nmdc:mga0yw44_630634_c1 3300050492 Bacteria 728
598 nmdc:mga07m45_112298_c1 3300050496 Bacteria 1570
599 nmdc:mga07m45_688000_c1 3300050496 Bacteria 588
600 Ga0495655_0237899 3300053083 Bacteria 608
601 Ga0495619_0192184 3300053085 Bacteria 1413
602 Ga0500620_115894 3300053155 Bacteria 939
603 Ga0500627_0122615 3300053158 Bacteria 1173
604 Ga0501084_0056160 3300054114 Bacteria 3294
605 Ga0501084_0395165 3300054114 Bacteria 1168
606 Ga0501082_0007943 3300060353 Bacteria 9162
607 Ga0501082_0059008 3300060353 Bacteria 3307
608 Ga0466962_0028229 3300061719 Bacteria 2689
609 Ga0466962_0028828 3300061719 Bacteria 2658
610 Ga0466962_0033161 3300061719 Bacteria 2470
611 Ga0466962_0213595 3300061719 Bacteria 944
612 Ga0466962_0221122 3300061719 Bacteria 928
613 Ga0466962_0222803 3300061719 Bacteria 924
614 Ga0466962_0363782 3300061719 Bacteria 721
615 Ga0466962_0677652 3300061719 Bacteria 528
616 Ga0530510_0422377 3300061734 Bacteria 1006
617 Ga0530510_1072923 3300061734 Bacteria 617
618 2644080828 2643221613 Bacteria 4622396
619 2644663855 2643221721 Bacteria 4486924
620 2644667807 2643221722 Bacteria 4247614
621 2731909105 2731639228 Bacteria 4187555
622 2799185810 2799112218 Bacteria 4315149
623 2812362607 2811994880 Bacteria 4147780
624 2816505867 2816332139 Bacteria 9138787
625 2839987033 2839986021 Bacteria 3685650
626 2932434437 2932431166 Bacteria 4215299
627 Ga0373945_0081578
628 JGI24737J22298_10095623
629 JGI24735J21928_10053969
630 Ga0070658_10310099
631 Ga0070658_10510634
632 Ga0070683_100145352
633 Ga0070683_100305198
634 Ga0070683_100499108
635 Ga0070683_100645150
636 Ga0070683_100856257
637 Ga0070680_100014434
638 Ga0070680_100187008
639 Ga0070680_100277356
640 Ga0070682_100143255
641 Ga0070682_100390350
642 Ga0070682_100618225
643 Ga0070660_100570516
644 Ga0070660_100692658
645 Ga0070660_100994039
646 Ga0070687_100355592
647 Ga0070692_11394541
648 Ga0070668_100326144
649 Ga0070671_101055390
650 Ga0070659_100387602
651 Ga0070714_100000010
652 Ga0070714_101841911
653 Ga0070713_101347438
654 Ga0070710_10453441
655 Ga0070701_11042171
656 Ga0070708_100305573
657 Ga0070663_100092750
658 Ga0070663_100494426
659 Ga0070663_100636148
660 Ga0070663_100753169
661 Ga0070678_100363398
662 Ga0070681_10010044
663 Ga0070681_10315449
664 Ga0070681_10390741
665 Ga0070685_10465226
666 Ga0070706_101423448
667 Ga0070679_100005832
668 Ga0070679_100064024
669 Ga0070679_100130181
670 Ga0070679_100219072
671 Ga0070679_100310395
672 Ga0070679_100455761
673 Ga0070684_100314072
674 Ga0070684_100708568
675 Ga0070684_101947369
676 Ga0068853_102288055
677 Ga0070672_100663912
678 Ga0070696_100003113
679 Ga0070693_100122110
680 Ga0070693_100122846
681 Ga0070665_100169321
682 Ga0070665_100323322
683 Ga0070665_100948714
684 Ga0070704_101470429
685 Ga0068855_100266254
686 Ga0068855_100510149
687 Ga0070664_100498759
688 Ga0070664_101176606
689 Ga0068857_100214008
690 Ga0068854_100247533
691 Ga0068854_100780719
692 Ga0068856_100081943
693 Ga0068856_100175950
694 Ga0068856_101684205
695 Ga0068856_102303943
696 Ga0068856_102341065
697 Ga0068852_100013367
698 Ga0068852_100482649
699 Ga0068852_101629102
700 Ga0068864_102508121
701 Ga0068866_10180415
702 Ga0068851_10854338
703 Ga0068870_10452167
704 Ga0068870_10916938
705 Ga0068858_100860558
706 Ga0075363_100174372
707 Ga0070716_100456104
708 Ga0070712_100887705
709 Ga0070712_101828220
710 Ga0097621_101182537
711 Ga0068865_100882298
712 Ga0105240_10132520
713 Ga0105240_11156589
714 Ga0105240_11487337
715 Ga0105240_11799359
716 Ga0111539_11247115
717 Ga0105245_10423117
718 Ga0105245_10756319
719 Ga0105245_11094066
720 Ga0105245_11242285
721 Ga0105247_10026514
722 Ga0105243_10325620
723 Ga0105243_10337867
724 Ga0105241_10142610
725 Ga0105241_11495697
726 Ga0105248_10276341
727 Ga0105248_11903469
728 Ga0105248_11949918
729 Ga0105237_10480559
730 Ga0105237_11151535
731 Ga0105237_11526929
732 Ga0105237_12219400
733 Ga0105238_10502562
734 Ga0105249_10600177
735 Ga0105249_11321984
736 Ga0105249_11397955
737 Ga0105239_10197122
738 Ga0105239_10640366
739 Ga0105246_10791789
740 Ga0157373_10654083
741 Ga0157370_10502624
742 Ga0157370_11014623
743 Ga0157370_11056459
744 Ga0157369_10032493
745 Ga0157369_10115868
746 Ga0157369_10211325
747 Ga0157369_10234110
748 Ga0157369_10762451
749 Ga0157369_10855897
750 Ga0157369_11568368
751 Ga0157374_10751349
752 Ga0157374_11111854
753 Ga0163162_10899923
754 Ga0163162_10990218
755 Ga0157372_10524261
756 Ga0157372_10541263
757 Ga0157372_10968222
758 Ga0157372_12453838
759 Ga0157375_10007894
760 Ga0157375_10290779
761 Ga0157375_10351461
762 Ga0157375_10652433
763 Ga0157375_12597656
764 Ga0157375_13765980
765 Ga0163163_10058078
766 Ga0163163_10509694
767 Ga0157380_12121954
768 Ga0157380_13240049
769 Ga0182008_10638512
770 Ga0157377_10542408
771 Ga0157379_11207618
772 Ga0157376_10514012
773 Ga0163161_10026453
774 Ga0197907_10701904
775 Ga0197907_10917757
776 Ga0197907_11302365
777 Ga0206356_10244213
778 Ga0206356_10317816
779 Ga0206356_10893727
780 Ga0206349_1876287
781 Ga0206350_10812855
782 Ga0206354_10351692
783 Ga0206354_10638130
784 Ga0206354_10901839
785 Ga0206354_11710813
786 Ga0206353_10173779
787 Ga0206353_10277316
788 Ga0206353_10964427
789 Ga0206353_11258726
790 Ga0206353_11609099
791 Ga0206353_12042904
792 Ga0213876_10061655
793 Ga0224712_10294360
794 Ga0224712_10443418
795 Ga0224712_10590411
796 Ga0207692_10375263
797 Ga0207642_10418385
798 Ga0207710_10012319
799 Ga0207680_11112138
800 Ga0207647_10344229
801 Ga0207647_10492070
802 Ga0207643_10426591
803 Ga0207643_10912612
804 Ga0207705_10425844
805 Ga0207654_11011513
806 Ga0207707_10078539
807 Ga0207707_10481438
808 Ga0207707_10557762
809 Ga0207707_10733637
810 Ga0207695_10128309
811 Ga0207695_10836988
812 Ga0207671_10708223
813 Ga0207660_10071612
814 Ga0207660_10138311
815 Ga0207660_10829596
816 Ga0207660_11133874
817 Ga0207660_11146026
818 Ga0207662_10296509
819 Ga0207657_10104989
820 Ga0207657_10123760
821 Ga0207657_10967975
822 Ga0207652_10031624
823 Ga0207652_10127893
824 Ga0207652_10415418
825 Ga0207652_11774101
826 Ga0207652_11880100
827 Ga0207694_10289113
828 Ga0207694_10586231
829 Ga0207687_10066706
830 Ga0207687_10958013
831 Ga0207700_11116506
832 Ga0207664_10000009
833 Ga0207664_10784182
834 Ga0207644_10793168
835 Ga0207644_11379525
836 Ga0207690_10122138
837 Ga0207709_11343961
838 Ga0207704_10236620
839 Ga0207691_10451813
840 Ga0207711_11638681
841 Ga0207711_11966998
842 Ga0207661_10316689
843 Ga0207661_10409150
844 Ga0207661_10521156
845 Ga0207661_10822931
846 Ga0207661_11346483
847 Ga0207679_10282135
848 Ga0207679_10611184
849 Ga0207679_10645570
850 Ga0207667_10052548
851 Ga0207667_10088545
852 Ga0207667_10330606
853 Ga0207667_10351638
854 Ga0207712_10489669
855 Ga0207668_10254653
856 Ga0207677_10396112
857 Ga0207677_10695943
858 Ga0207639_10345563
859 Ga0207639_11186448
860 Ga0207639_12093070
861 Ga0207678_10421513
862 Ga0207678_10712868
863 Ga0207702_10038959
864 Ga0207702_10748059
865 Ga0207702_11058328
866 Ga0207702_11386252
867 Ga0207702_12268584
868 Ga0207674_10140446
869 Ga0207674_10311236
870 Ga0207683_10256659
871 Ga0207683_10802541
872 Ga0207698_10024260
873 Ga0207698_10200576
874 Ga0207698_10950229
875 Ga0207698_12197664
876 Ga0268266_10239575
877 Ga0268264_10866789
878 Ga0307515_10869658
879 Ga0307513_10140170
880 Ga0316575_10029775
881 Ga0316579_10004462
882 Ga0316579_10021273
883 Ga0316576_10002480
884 Ga0316576_10063258
885 Ga0316578_10011944
886 Ga0316578_10022067
887 Ga0307405_10021175
888 Ga0316577_10079136
889 Ga0316577_10126766
890 Ga0307413_11465124
891 Ga0307413_11852353
892 Ga0307410_10317934
893 Ga0307407_11362095
894 Ga0307412_10830372
895 Ga0307409_100549955
896 Ga0307409_101445090
897 Ga0307409_102424934
898 Ga0307416_100166658
899 Ga0307416_101554351
900 Ga0307411_11828333
901 Ga0307415_100669245
902 Ga0307415_101397904
903 Ga0316583_10057532
904 Ga0316585_10001789
905 Ga0316585_10006913
906 Ga0316580_10029033
907 Ga0316580_10039029
908 Ga0373943_0589675
909 Ga0316574_0094295
910 Ga0316574_0499597
911 Ga0316574_0769199
912 Ga0316574_0815398
913 Ga0316582_0006356
914 Ga0316582_0009834
915 Ga0316584_0015015
916 Ga0316584_0038685
917 Ga0316584_0586919
918 Ga0316581_0001949
919 Ga0436365_0779088
920 Ga0439436_0189074
921 Ga0451787_210124
922 Ga0451791_1660553
923 Ga0451793_0751648
924 Ga0451797_0658121
925 Ga0451797_1209429
926 Ga0451802_1357028
927 Ga0451807_1158303
928 Ga0451841_1236843
929 Ga0451847_0741165
930 Ga0451853_3643746
931 Ga0439431_0242065
932 Ga0439449_0041534
933 Ga0439462_0024815
934 Ga0466969_0038907
935 Ga0466969_0146072
936 Ga0466969_0510545
937 Ga0466972_0016237
938 Ga0466972_0053943
939 Ga0466972_0248132
940 Ga0466972_0515694
941 Ga0466965_0053244
942 Ga0466965_0159293
943 Ga0466966_0008575
944 Ga0466966_0009202
945 Ga0466966_0030629
946 Ga0466966_0040771
947 Ga0466966_0053855
948 Ga0466966_0173885
949 Ga0466966_0245887
950 Ga0466966_0277947
951 Ga0466966_0443536
952 Ga0466966_0455862
953 Ga0466961_0013336
954 Ga0466961_0013777
955 Ga0466961_0017982
956 Ga0466961_0025565
957 Ga0466961_0036961
958 Ga0466961_0039894
959 Ga0466961_0054253
960 Ga0466961_0065557
961 Ga0466961_0087703
962 Ga0466961_0109684
963 Ga0466961_0129512
964 Ga0466961_0202563
965 Ga0466961_0446667
966 Ga0466963_0023698
967 Ga0466963_0035562
968 Ga0466963_0052194
969 Ga0466963_0079087
970 Ga0466963_0102033
971 Ga0466963_0233722
972 Ga0466963_0250710
973 Ga0466963_0318594
974 Ga0466963_1328435
975 Ga0466964_0011435
976 Ga0466964_0024894
977 Ga0466964_0089994
978 Ga0466964_0102355
979 Ga0466964_0319268
980 Ga0466964_0612938
981 Ga0466971_0011469
982 Ga0466971_0024472
983 Ga0466971_0036102
984 Ga0466971_0041775
985 Ga0466971_0243649
986 Ga0466971_0323461
987 Ga0466971_0431977
988 Ga0466968_0190203
989 Ga0466968_0503874
990 Ga0466970_0021343
991 Ga0466970_0028421
992 Ga0466970_0231976
993 Ga0466970_0497501
994 Ga0466957_0007445
995 Ga0466957_0024221
996 Ga0466957_0037002
997 Ga0466957_0135547
998 Ga0466957_0218772
999 Ga0466957_0478015
1000 Ga0466957_0490285
1001 Ga0466957_0675856
1002 Ga0466957_1115497
1003 Ga0466960_0027851
1004 Ga0466960_0073871
1005 Ga0466960_0105365
1006 Ga0466960_0147587
1007 Ga0466960_0194193
1008 Ga0466960_0270048
1009 Ga0466960_0342771
1010 Ga0466959_0146847
1011 Ga0466959_0154139
1012 Ga0466959_0169849
1013 Ga0466959_0224305
1014 Ga0466959_0267271
1015 Ga0466959_0448734
1016 Ga0466959_0515924
1017 Ga0466959_0519225
1018 Ga0466959_0571521
1019 Ga0466959_0589434
1020 Ga0466959_0746953
1021 Ga0466958_0008070
1022 Ga0466958_0026241
1023 Ga0466958_0040967
1024 Ga0466958_0085002
1025 Ga0466958_0129093
1026 Ga0466958_0161582
1027 Ga0466958_0175888
1028 Ga0466958_0909473
1029 Ga0466967_0005628
1030 Ga0466967_0021302
1031 Ga0466967_0076707
1032 Ga0466967_0103319
1033 Ga0466967_0107114
1034 Ga0466967_0116246
1035 Ga0466967_0141535
1036 Ga0466967_0163670
1037 Ga0466967_0188014
1038 Ga0466967_0191352
1039 Ga0466967_0210847
1040 Ga0466967_0221778
1041 Ga0466967_0405726
1042 Ga0466967_0539017
1043 Ga0466967_0627678
1044 Ga0466967_0735522
1045 Ga0466967_0873288
1046 Ga0466967_0978747
1047 Ga0466967_1095674
1048 Ga0495629_0256022
1049 Ga0495582_0504684
1050 Ga0495582_0603705
1051 Ga0495608_0538427
1052 Ga0495657_0491479
1053 Ga0495647_0160771
1054 Ga0495669_0002278
1055 Ga0495613_0544607
1056 Ga0495600_0508192
1057 Ga0495581_0040087
1058 Ga0495614_0404070
1059 Ga0496100_0098780
1060 Ga0496100_0266465
1061 Ga0496100_1268514
1062 Ga0496100_1304107
1063 Ga0496100_1568059
1064 Ga0496101_0030867
1065 Ga0496101_0268987
1066 Ga0496101_0620492
1067 Ga0496101_1521608
1068 Ga0496102_0000023
1069 Ga0496102_0000814
1070 Ga0496102_0013010
1071 Ga0496102_0142753
1072 Ga0496102_0239286
1073 Ga0496102_0253623
1074 Ga0496103_0000189
1075 Ga0496103_0181379
1076 Ga0496103_0621819
1077 Ga0496104_0117362
1078 Ga0496104_0263661
1079 Ga0496104_0405723
1080 Ga0496104_0425735
1081 Ga0496105_0021433
1082 Ga0496105_0533153
1083 Ga0496106_1459769
1084 Ga0496107_0086088
1085 Ga0496107_0547834
1086 Ga0496107_0578337
1087 Ga0496107_0983036
1088 Ga0496108_0112016
1089 Ga0496108_0119036
1090 Ga0496108_0275677
1091 Ga0496108_0362979
1092 Ga0496108_0469631
1093 Ga0496108_0590114
1094 Ga0496108_1026604
1095 Ga0496109_0038134
1096 Ga0496109_0076964
1097 Ga0496109_0086184
1098 Ga0496109_0147673
1099 Ga0496109_0175998
1100 Ga0496109_0513123
1101 Ga0496109_0526006
1102 Ga0496109_0553156
1103 Ga0496109_1322613
1104 Ga0496110_0007657
1105 Ga0496110_0052536
1106 Ga0496110_0125547
1107 Ga0496110_0135564
1108 Ga0496110_0493619
1109 Ga0496110_0651623
1110 Ga0496110_1256971
1111 Ga0496111_0011756
1112 Ga0496111_0064575
1113 Ga0496111_0197014
1114 Ga0496111_0273813
1115 Ga0496111_0613380
1116 Ga0496111_0669099
1117 Ga0496111_1243184
1118 Ga0496112_0021172
1119 Ga0496112_0295381
1120 Ga0496112_0576378
1121 Ga0496113_0045377
1122 Ga0496113_0528082
1123 Ga0496113_0629218
1124 Ga0496114_0008482
1125 Ga0496114_0011690
1126 Ga0496114_0017862
1127 Ga0496114_0140368
1128 Ga0496114_0189785
1129 Ga0496114_0201422
1130 Ga0496114_0436249
1131 Ga0496115_0042981
1132 Ga0496115_0071990
1133 Ga0496115_0134194
1134 Ga0496115_0540274
1135 Ga0496117_0149570
1136 Ga0496117_0262162
1137 Ga0496118_0060605
1138 Ga0496118_0067262
1139 Ga0496118_0395959
1140 Ga0496119_0000091
1141 Ga0496119_0022069
1142 Ga0496119_0047773
1143 Ga0496120_0005081
1144 Ga0496121_0088639
1145 Ga0496122_0000615
1146 Ga0496124_0364042
1147 Ga0496125_0000069
1148 Ga0496126_0116669
1149 Ga0501317_074115
1150 Ga0501031_0007997
1151 Ga0501031_0038662
1152 Ga0501031_0241461
1153 Ga0501031_1042986
1154 Ga0501032_0001905
1155 Ga0501032_0004933
1156 Ga0501033_0186042
1157 Ga0501033_0275377
1158 Ga0501033_0277701
1159 Ga0501034_0096678
1160 Ga0501034_0351406
1161 Ga0501034_0802707
1162 Ga0501036_0066115
1163 Ga0501036_0134184
1164 Ga0501036_0334651
1165 Ga0501036_1455825
1166 Ga0501037_0026027
1167 Ga0501037_0750944
1168 Ga0501037_0991710
1169 Ga0501038_0000544
1170 Ga0501038_0005369
1171 Ga0501038_0249991
1172 Ga0501039_0059299
1173 Ga0501039_0671433
1174 Ga0501041_0138969
1175 Ga0501042_0166539
1176 Ga0501042_0345984
1177 Ga0501042_1113777
1178 Ga0501043_0022047
1179 Ga0501043_0083783
1180 Ga0501043_0559036
1181 Ga0501043_1277607
1182 Ga0501046_0004176
1183 Ga0501046_0094178
1184 Ga0501047_0010629
1185 Ga0501047_0036160
1186 Ga0501047_0261859
1187 Ga0501047_1320137
1188 Ga0501048_0000090
1189 Ga0501048_0190769
1190 Ga0501048_0475726
1191 Ga0501067_0178482
1192 Ga0501067_0630487
1193 Ga0501067_0714032
1194 Ga0501069_0423997
1195 Ga0501069_0459364
1196 Ga0501070_0069070
1197 Ga0501070_0543564
1198 Ga0501070_1219140
1199 Ga0501071_0097091
1200 Ga0501071_0335169
1201 Ga0501072_0071677
1202 Ga0501073_0231910
1203 Ga0501074_0529549
1204 Ga0501074_0776599
1205 Ga0501074_1296820
1206 Ga0501075_0029819
1207 Ga0501076_0223905
1208 Ga0501076_0919954
1209 Ga0501077_0342016
1210 Ga0501079_0082804
1211 Ga0501080_0195538
1212 Ga0501081_0040477
1213 Ga0501083_0029316
1214 Ga0501035_0021274
1215 Ga0501035_0157396
1216 Ga0501035_0218128
1217 Ga0501035_1474296
1218 Ga0501044_0009188
1219 Ga0501044_0033912
1220 Ga0501044_0215886
1221 Ga0501045_0051995
1222 Ga0501045_0097091
1223 nmdc:mga0yw44_630634_c1
1224 nmdc:mga07m45_112298_c1
1225 nmdc:mga07m45_688000_c1
1226 Ga0495655_0237899
1227 Ga0495619_0192184
1228 Ga0500620_115894
1229 Ga0500627_0122615
1230 Ga0501084_0056160
1231 Ga0501084_0395165
1232 Ga0501082_0007943
1233 Ga0501082_0059008
1234 Ga0466962_0028229
1235 Ga0466962_0028828
1236 Ga0466962_0033161
1237 Ga0466962_0213595
1238 Ga0466962_0221122
1239 Ga0466962_0222803
1240 Ga0466962_0363782
1241 Ga0466962_0677652
1242 Ga0530510_0422377
1243 Ga0530510_1072923
1244 2644080828
1245 2644663855
1246 2644667807
1247 2731909105
1248 2799185810
1249 2812362607
1250 2816505867
1251 2839987033
1252 2932434437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11662

DUF3263

Protein of unknown function (DUF3263)

39

112

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d5v-assembly2.cif.gz_D whib6 bound to the sigmaar4-rnap beta flap tip chimera 0.6518 23 77
8cyf-assembly1.cif.gz_B whib3 bound to sigmaar4-rnap beta flap tip chimera and dna 0.5697 23 88
8cyf-assembly1.cif.gz_B whib3 bound to sigmaar4-rnap beta flap tip chimera and dna 0.4391 23 88
2lr8-assembly1.cif.gz_A solution nmr structure of casp8-associated protein 2 from homo sapiens, northeast structural genomics consortium (nesg) target hr8150a 0.404 9 71
8d5v-assembly2.cif.gz_D whib6 bound to the sigmaar4-rnap beta flap tip chimera 0.4031 23 77
ID Description Score Start End Superfamily
af_P96276_20_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.969 24 96 1.10.10.10
af_P96276_20_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9438 24 96 1.10.10.10
af_F1QD18_1925_1992_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.6202 25 69 1.10.10.60
4l5jA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4944 24 67 1.10.10.10
4l5jC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4773 22 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1H1R9M3-F1-model_v4 DUF3263 domain-containing protein 0.9707 28 91
AF-A0A1A3DGB1-F1-model_v4 DUF3263 domain-containing protein 0.9689 25 93
AF-A0A173LXK6-F1-model_v4 DUF3263 domain-containing protein 0.9665 25 99
AF-A0A542FV27-F1-model_v4 Uncharacterized protein DUF3263 0.9649 25 91
AF-A0A5B1L8V9-F1-model_v4 DUF3263 domain-containing protein 0.9634 25 98

Map