F470440

General Info

Members Datasets Scaffolds Average Seq Length
626 327 569 272

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100264189|Ga0070697_1002641892
Length 295
Sequence MRAGFAISPAQQAARISGNGLVWLATGLFVFNVLALIAAVIVNSFATRWLGTWLPAGFTFRWYSSAWTEFQLDSVLIVTVETVFAVVAISLLVGVPAAYAMARRDFRYKRAVLLLFVLPLLVPPMTYGIPLATVLYRLHLAGTMSGVILANLVPAVPFVVLVMTPFVEQIDPRIEAAARVFGASTLRLFVHVLVPLLSPGMLAAGLLVLVRTIAMFELTFLTAGPDSQTLVVALYYTVFAAGVRAGQSVDAMAVIYMATTLVWLLIALRGGFTIQDRRLPDLRTEGNAGNPRPDI

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
5 2534681786 Brucella suis 92/29 Isolate Unclassified
6 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
7 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
8 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
9 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
10 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
11 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
12 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
13 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
14 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
15 2643221599 Rhizobium sp. Root708 Isolate Unclassified
16 2643221607 Rhizobium sp. Root73 Isolate Unclassified
17 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
18 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
19 2643221688 Rhizobium sp. Root482 Isolate Unclassified
20 2643221733 Bosea sp. Root381 Isolate Unclassified
21 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
22 2751185800 Brucella pituitosa AA2 Isolate Unclassified
23 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
24 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
25 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
26 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
27 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
28 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
29 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
30 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
31 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
32 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
33 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
34 2854911287 Brucella lupini LUP21 Isolate Unclassified
35 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
36 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
37 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
38 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
39 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
40 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
41 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
42 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
43 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
44 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
45 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
46 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
47 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
48 2996887358 Rhizobium sp. R711 Isolate Nodule
49 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
50 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
51 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
52 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
199 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
307 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
313 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
314 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
319 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 8005258706 Rhizobium sp. R693 Isolate Nodule
323 8005321885 Rhizobium sp. R72 Isolate Nodule
324 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
325 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
326 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
327 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.73
Metatranscriptomes 0.16
Isolates 9.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.79
Nodule 2.56
Rhizoplane 2.72
Rhizosphere 73.48
Stem 0
Stem Tuber 0
Unclassified 12.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000410 3300002773 Bacteria 25994
2 JGI25160J50197_1021613 3300003354 Bacteria 1907
3 Ga0055526_1035552 3300003771 Bacteria 1339
4 Ga0055524_1002912 3300003775 Bacteria 8552
5 Ga0065165_1003097 3300005262 Bacteria 12383
6 Ga0070658_10010697 3300005327 Bacteria 7350
7 Ga0070658_10013631 3300005327 Bacteria 6522
8 Ga0070658_10015120 3300005327 Bacteria 6176
9 Ga0070658_10145389 3300005327 Bacteria 1982
10 Ga0070683_100157912 3300005329 Bacteria 2151
11 Ga0070683_100206237 3300005329 Bacteria 1867
12 Ga0070680_100137470 3300005336 Bacteria 2047
13 Ga0070682_100042699 3300005337 Bacteria 2801
14 Ga0070660_100013816 3300005339 Bacteria 5807
15 Ga0070660_100036236 3300005339 Bacteria 3736
16 Ga0070660_100058731 3300005339 Bacteria 2982
17 Ga0070661_100001193 3300005344 Bacteria 18336
18 Ga0070661_100007769 3300005344 Bacteria 7399
19 Ga0070661_100041480 3300005344 Bacteria 3358
20 Ga0070668_100043787 3300005347 Bacteria 3433
21 Ga0070671_100044754 3300005355 Bacteria 3678
22 Ga0070659_100031437 3300005366 Bacteria 4111
23 Ga0070667_100254658 3300005367 Bacteria 1570
24 Ga0070714_100011647 3300005435 Bacteria 6982
25 Ga0070714_100061500 3300005435 Bacteria 3226
26 Ga0070714_100312998 3300005435 Bacteria 1466
27 Ga0070713_100080154 3300005436 Bacteria 2783
28 Ga0070713_100178170 3300005436 Bacteria 1909
29 Ga0070713_100313361 3300005436 Bacteria 1447
30 Ga0070710_10003781 3300005437 Bacteria 7161
31 Ga0070710_10071051 3300005437 Bacteria 2006
32 Ga0070711_100070122 3300005439 Bacteria 2467
33 Ga0070711_100073377 3300005439 Bacteria 2417
34 Ga0070681_10070752 3300005458 Bacteria 3453
35 Ga0070707_100560963 3300005468 Bacteria 1104
36 Ga0070699_100484887 3300005518 Bacteria 1122
37 Ga0070699_100527902 3300005518 Bacteria 1073
38 Ga0070679_100009436 3300005530 Bacteria 9230
39 Ga0070679_100050231 3300005530 Bacteria 4154
40 Ga0070679_100175184 3300005530 Bacteria 2117
41 Ga0070679_100229403 3300005530 Bacteria 1816
42 Ga0070697_100264189 3300005536 Bacteria 1474
43 Ga0068853_100021441 3300005539 Bacteria 5387
44 Ga0068853_100034662 3300005539 Bacteria 4285
45 Ga0068853_100089985 3300005539 Bacteria 2696
46 Ga0068853_100370060 3300005539 Bacteria 1337
47 Ga0070665_100014503 3300005548 Bacteria 7905
48 Ga0068855_100007729 3300005563 Bacteria 12985
49 Ga0068855_100026066 3300005563 Bacteria 6993
50 Ga0068855_100036681 3300005563 Bacteria 5832
51 Ga0068855_100060029 3300005563 Bacteria 4448
52 Ga0068855_100069306 3300005563 Bacteria 4104
53 Ga0068855_100721683 3300005563 Bacteria 1065
54 Ga0068855_100784851 3300005563 Bacteria 1013
55 Ga0070664_100143863 3300005564 Bacteria 2101
56 Ga0068857_100210874 3300005577 Bacteria 1773
57 Ga0068854_100008132 3300005578 Bacteria 6729
58 Ga0068854_100017058 3300005578 Bacteria 4854
59 Ga0068854_100148554 3300005578 Bacteria 1805
60 Ga0068854_100287557 3300005578 Bacteria 1326
61 Ga0068856_100051031 3300005614 Bacteria 4079
62 Ga0068856_100053239 3300005614 Bacteria 3991
63 Ga0068856_100120682 3300005614 Bacteria 2623
64 Ga0068856_100629264 3300005614 Bacteria 1094
65 Ga0068852_100090644 3300005616 Bacteria 2734
66 Ga0068852_100118271 3300005616 Bacteria 2421
67 Ga0068852_100481308 3300005616 Bacteria 1233
68 Ga0068859_100083150 3300005617 Bacteria 3244
69 Ga0068859_100228403 3300005617 Bacteria 1949
70 Ga0068861_100052007 3300005719 Bacteria 3112
71 Ga0068851_10002009 3300005834 Bacteria 8964
72 Ga0068851_10136541 3300005834 Bacteria 1330
73 Ga0068860_100000317 3300005843 Bacteria 65673
74 Ga0068862_100009817 3300005844 Bacteria 7909
75 Ga0081539_10000121 3300005985 Bacteria 183432
76 Ga0070717_10166330 3300006028 Bacteria 1916
77 Ga0070717_10490913 3300006028 Bacteria 1109
78 Ga0075365_10006487 3300006038 Bacteria 6441
79 Ga0075365_10150650 3300006038 Bacteria 1618
80 Ga0075368_10001006 3300006042 Bacteria 8820
81 Ga0075363_100059539 3300006048 Bacteria 2054
82 Ga0075363_100208098 3300006048 Bacteria 1119
83 Ga0075364_10032489 3300006051 Bacteria 3355
84 Ga0070716_100003339 3300006173 Bacteria 7541
85 Ga0070716_100077438 3300006173 Bacteria 1974
86 Ga0070712_100061747 3300006175 Bacteria 2648
87 Ga0070712_100065347 3300006175 Bacteria 2582
88 Ga0070712_100196866 3300006175 Bacteria 1580
89 Ga0075362_10035134 3300006177 Bacteria 2187
90 Ga0075367_10001020 3300006178 Bacteria 11516
91 Ga0075367_10004105 3300006178 Bacteria 7056
92 Ga0075367_10058470 3300006178 Bacteria 2294
93 Ga0075367_10105778 3300006178 Bacteria 1723
94 Ga0075369_10001864 3300006186 Bacteria 7365
95 Ga0097621_100369182 3300006237 Bacteria 1280
96 Ga0075370_10011868 3300006353 Bacteria 4587
97 Ga0075428_100001811 3300006844 Bacteria 22863
98 Ga0075431_100015775 3300006847 Bacteria 7661
99 Ga0068865_100419465 3300006881 Bacteria 1100
100 Ga0075436_100154699 3300006914 Bacteria 1615
101 Ga0097620_100083151 3300006931 Bacteria 3244
102 Ga0097620_100228427 3300006931 Bacteria 1949
103 Ga0105240_10019472 3300009093 Bacteria 9066
104 Ga0105240_10123841 3300009093 Bacteria 3110
105 Ga0105240_10185543 3300009093 Bacteria 2450
106 Ga0105240_10259391 3300009093 Bacteria 2006
107 Ga0105240_10279975 3300009093 Bacteria 1916
108 Ga0105245_10086811 3300009098 Bacteria 2870
109 Ga0105247_10247026 3300009101 Bacteria 1218
110 Ga0105241_10003612 3300009174 Bacteria 11497
111 Ga0105242_10822132 3300009176 Bacteria 922
112 Ga0105248_10182083 3300009177 Bacteria 2367
113 Ga0105237_10018004 3300009545 Bacteria 7318
114 Ga0105237_10058956 3300009545 Bacteria 3841
115 Ga0105237_10106784 3300009545 Bacteria 2792
116 Ga0105237_10471509 3300009545 Bacteria 1261
117 Ga0105238_10004736 3300009551 Bacteria 13456
118 Ga0105238_10125530 3300009551 Bacteria 2545
119 Ga0099796_10121008 3300010159 Bacteria 1006
120 Ga0105239_10031987 3300010375 Bacteria 5781
121 Ga0105239_10094535 3300010375 Bacteria 3301
122 Ga0105239_10454841 3300010375 Bacteria 1453
123 Ga0105246_10074947 3300011119 Bacteria 2394
124 Ga0157371_10005646 3300013102 Bacteria 10502
125 Ga0157370_10070121 3300013104 Bacteria 3309
126 Ga0157370_10272688 3300013104 Bacteria 1563
127 Ga0157370_10344827 3300013104 Bacteria 1373
128 Ga0157370_10595047 3300013104 Bacteria 1013
129 Ga0157369_10178795 3300013105 Bacteria 2233
130 Ga0157369_10221447 3300013105 Bacteria 1981
131 Ga0157374_10164522 3300013296 Bacteria 2162
132 Ga0163163_10735759 3300014325 Bacteria 1050
133 Ga0157380_10566419 3300014326 Bacteria 1117
134 Ga0206354_10965140 3300020081 Bacteria 1993
135 Ga0213876_10001630 3300021384 Bacteria 13688
136 Ga0213876_10001735 3300021384 Bacteria 13237
137 Ga0213875_10003253 3300021388 Bacteria 9314
138 Ga0213875_10003260 3300021388 Bacteria 9298
139 Ga0213875_10026039 3300021388 Bacteria 2784
140 Ga0213875_10123589 3300021388 Bacteria 1209
141 Ga0209129_1004455 3300025258 Bacteria 5453
142 Ga0209455_1002995 3300025272 Bacteria 6205
143 Ga0209673_1009112 3300025273 Bacteria 4334
144 Ga0209675_1006994 3300025291 Bacteria 4411
145 Ga0209025_1003423 3300025294 Bacteria 15051
146 Ga0209025_1030732 3300025294 Bacteria 2562
147 Ga0209025_1044186 3300025294 Bacteria 1866
148 Ga0209564_1014968 3300025295 Bacteria 3188
149 Ga0209758_1012686 3300025297 Bacteria 4683
150 Ga0209256_1000359 3300025299 Bacteria 74498
151 Ga0209256_1010727 3300025299 Bacteria 3784
152 Ga0209256_1012131 3300025299 Bacteria 3346
153 Ga0209256_1025983 3300025299 Bacteria 1697
154 Ga0207426_1001175 3300025302 Bacteria 23419
155 Ga0209051_1008293 3300025303 Bacteria 5516
156 Ga0207656_10022300 3300025321 Bacteria 2539
157 Ga0207692_10002516 3300025898 Bacteria 7042
158 Ga0207647_10008336 3300025904 Bacteria 7432
159 Ga0207699_10000538 3300025906 Bacteria 18736
160 Ga0207699_10069984 3300025906 Bacteria 2141
161 Ga0207705_10023565 3300025909 Bacteria 4391
162 Ga0207705_10081786 3300025909 Bacteria 2354
163 Ga0207705_10110845 3300025909 Bacteria 2027
164 Ga0207705_10334328 3300025909 Bacteria 1165
165 Ga0207707_10028294 3300025912 Bacteria 4899
166 Ga0207707_10039144 3300025912 Bacteria 4145
167 Ga0207707_10064657 3300025912 Bacteria 3185
168 Ga0207695_10004277 3300025913 Bacteria 19595
169 Ga0207695_10091689 3300025913 Bacteria 3052
170 Ga0207695_10416502 3300025913 Bacteria 1228
171 Ga0207671_10000392 3300025914 Bacteria 61214
172 Ga0207671_10058630 3300025914 Bacteria 2854
173 Ga0207671_10061672 3300025914 Bacteria 2783
174 Ga0207693_10030646 3300025915 Bacteria 4249
175 Ga0207693_10091474 3300025915 Bacteria 2385
176 Ga0207693_10212967 3300025915 Bacteria 1519
177 Ga0207663_10007793 3300025916 Bacteria 5578
178 Ga0207660_10309084 3300025917 Bacteria 1260
179 Ga0207657_10010880 3300025919 Bacteria 9053
180 Ga0207657_10011821 3300025919 Bacteria 8644
181 Ga0207657_10121636 3300025919 Bacteria 2148
182 Ga0207649_10196727 3300025920 Bacteria 1421
183 Ga0207649_10308266 3300025920 Bacteria 1159
184 Ga0207652_10029911 3300025921 Bacteria 4559
185 Ga0207652_10280277 3300025921 Bacteria 1504
186 Ga0207646_10688187 3300025922 Bacteria 915
187 Ga0207694_10001464 3300025924 Bacteria 20187
188 Ga0207694_10008057 3300025924 Bacteria 7970
189 Ga0207694_10017676 3300025924 Bacteria 5390
190 Ga0207687_10072537 3300025927 Bacteria 2463
191 Ga0207687_10375725 3300025927 Bacteria 1163
192 Ga0207700_10083725 3300025928 Bacteria 2498
193 Ga0207664_10011846 3300025929 Bacteria 6219
194 Ga0207664_10030517 3300025929 Bacteria 4116
195 Ga0207664_10367426 3300025929 Bacteria 1276
196 Ga0207644_10029557 3300025931 Bacteria 3803
197 Ga0207690_10247592 3300025932 Bacteria 1375
198 Ga0207690_10292823 3300025932 Bacteria 1271
199 Ga0207665_10001825 3300025939 Bacteria 14343
200 Ga0207665_10355185 3300025939 Bacteria 1107
201 Ga0207711_10174873 3300025941 Bacteria 1950
202 Ga0207661_10005391 3300025944 Bacteria 9005
203 Ga0207667_10008389 3300025949 Bacteria 12278
204 Ga0207667_10016957 3300025949 Bacteria 8217
205 Ga0207667_10026639 3300025949 Bacteria 6310
206 Ga0207667_10046697 3300025949 Bacteria 4586
207 Ga0207667_10067728 3300025949 Bacteria 3719
208 Ga0207667_10200628 3300025949 Bacteria 2046
209 Ga0207667_10259137 3300025949 Bacteria 1778
210 Ga0207667_10531071 3300025949 Bacteria 1191
211 Ga0207668_10015491 3300025972 Bacteria 4738
212 Ga0207668_10075560 3300025972 Bacteria 2423
213 Ga0207640_10014039 3300025981 Bacteria 4603
214 Ga0207640_10019880 3300025981 Bacteria 3977
215 Ga0207640_10056626 3300025981 Bacteria 2575
216 Ga0207640_10127343 3300025981 Bacteria 1835
217 Ga0207658_10187385 3300025986 Bacteria 1717
218 Ga0207703_10384994 3300026035 Bacteria 1298
219 Ga0207639_10046304 3300026041 Bacteria 3281
220 Ga0207639_10132217 3300026041 Bacteria 2067
221 Ga0207639_10215446 3300026041 Bacteria 1655
222 Ga0207639_10477836 3300026041 Bacteria 1135
223 Ga0207678_10085675 3300026067 Bacteria 2693
224 Ga0207702_10028407 3300026078 Bacteria 4650
225 Ga0207702_10297236 3300026078 Bacteria 1531
226 Ga0207641_10048742 3300026088 Bacteria 3577
227 Ga0207674_10030453 3300026116 Bacteria 5672
228 Ga0207674_10046147 3300026116 Bacteria 4476
229 Ga0207675_100075031 3300026118 Bacteria 3165
230 Ga0207698_10018312 3300026142 Bacteria 4770
231 Ga0207698_10031681 3300026142 Bacteria 3820
232 Ga0207698_10052718 3300026142 Bacteria 3118
233 Ga0209813_10001615 3300027866 Bacteria 5078
234 Ga0268266_10065615 3300028379 Bacteria 3138
235 Ga0268265_10022622 3300028380 Bacteria 4419
236 Ga0268264_10000035 3300028381 Bacteria 398196
237 Ga0265337_1006919 3300028556 Bacteria 4306
238 Ga0265318_10007282 3300028577 Bacteria 5017
239 Ga0307515_10013701 3300028794 Bacteria 15109
240 Ga0265338_10193313 3300028800 Bacteria 1541
241 Ga0307511_10072487 3300030521 Bacteria 2501
242 Ga0307511_10108399 3300030521 Bacteria 1782
243 Ga0307512_10011149 3300030522 Bacteria 8531
244 Ga0265330_10031036 3300031235 Bacteria 2396
245 Ga0265332_10083699 3300031238 Bacteria 1352
246 Ga0265320_10129361 3300031240 Bacteria 1147
247 Ga0265325_10115994 3300031241 Bacteria 1296
248 Ga0265331_10055787 3300031250 Bacteria 1878
249 Ga0265331_10086629 3300031250 Bacteria 1451
250 Ga0307509_10161039 3300031507 Bacteria 2141
251 Ga0265313_10000007 3300031595 Bacteria 178640
252 Ga0265313_10009853 3300031595 Bacteria 6148
253 Ga0265313_10011102 3300031595 Bacteria 5619
254 Ga0265313_10047331 3300031595 Bacteria 2082
255 Ga0265313_10051959 3300031595 Bacteria 1958
256 Ga0307508_10049429 3300031616 Bacteria 3745
257 Ga0307508_10109357 3300031616 Bacteria 2363
258 Ga0265314_10051549 3300031711 Bacteria 2866
259 Ga0265342_10000687 3300031712 Bacteria 35389
260 Ga0265342_10145819 3300031712 Bacteria 1318
261 Ga0307516_10010888 3300031730 Bacteria 9950
262 Ga0307406_10018217 3300031901 Bacteria 4099
263 Ga0307409_100467338 3300031995 Bacteria 1221
264 Ga0307414_10181563 3300032004 Bacteria 1693
265 Ga0307507_10020656 3300033179 Bacteria 7365
266 Ga0373950_0003966 3300034818 Bacteria 2150
267 Ga0373926_0006798 3300035083 Bacteria 3801
268 Ga0373934_0075502 3300035086 Bacteria 1351
269 Ga0373944_0065996 3300035089 Bacteria 1170
270 Ga0373941_0008414 3300035115 Bacteria 2560
271 Ga0373945_0052880 3300035116 Bacteria 1498
272 Ga0373945_0091259 3300035116 Bacteria 1180
273 Ga0373953_0017993 3300035117 Bacteria 2607
274 Ga0373954_0031232 3300035118 Bacteria 2458
275 Ga0373957_0023576 3300035120 Bacteria 2203
276 Ga0373943_0064473 3300035170 Bacteria 1840
277 Ga0373955_0021509 3300035172 Bacteria 3258
278 Ga0373931_0392763 3300035691 Bacteria 877
279 Ga0373927_0213156 3300035695 Bacteria 1269
280 Ga0373947_0144365 3300035725 Bacteria 1529
281 Ga0373937_0006458 3300036401 Bacteria 10120
282 Ga0373937_0010664 3300036401 Bacteria 8035
283 Ga0373937_0067622 3300036401 Bacteria 3292
284 Ga0373925_0093610 3300037068 Bacteria 2300
285 Ga0395899_0024603 3300037312 Bacteria 4551
286 Ga0395899_0081733 3300037312 Bacteria 2350
287 Ga0395900_0191615 3300037418 Bacteria 2073
288 Ga0395900_0654767 3300037418 Bacteria 987
289 Ga0395898_0063413 3300037466 Bacteria 3586
290 Ga0395898_0235128 3300037466 Bacteria 1747
291 Ga0395905_0007978 3300037471 Bacteria 10467
292 Ga0395905_0079409 3300037471 Bacteria 3076
293 Ga0436364_0022735 3300037853 Bacteria 162985
294 Ga0436364_0180265 3300037853 Bacteria 21128
295 Ga0436364_0814348 3300037853 Bacteria 4780
296 Ga0436364_0834731 3300037853 Bacteria 3034
297 Ga0436364_1016854 3300037853 Bacteria 3945
298 Ga0436364_1485304 3300037853 Bacteria 1785
299 Ga0395901_0067883 3300038443 Bacteria 3714
300 Ga0395901_0190679 3300038443 Bacteria 2150
301 Ga0395901_0389163 3300038443 Bacteria 1434
302 Ga0395901_0685661 3300038443 Bacteria 1024
303 Ga0436365_0162634 3300039437 Bacteria 18491
304 Ga0436365_0697045 3300039437 Bacteria 35162
305 Ga0436365_0882074 3300039437 Bacteria 2181
306 Ga0436365_0917056 3300039437 Bacteria 16389
307 Ga0436360_1319645 3300039438 Unclassified 1448
308 Ga0436361_0042892 3300039447 Bacteria 7014
309 Ga0436361_0255094 3300039447 Plasmid 2774
310 Ga0436361_0893122 3300039447 Bacteria 3593
311 Ga0436361_1028012 3300039447 Bacteria 6349
312 Ga0436361_1124158 3300039447 Bacteria 10072
313 Ga0436361_1161316 3300039447 Bacteria 2893
314 Ga0436361_1174688 3300039447 Bacteria 3666
315 Ga0436363_0283533 3300039450 Unclassified 3780
316 Ga0436363_1022276 3300039450 Bacteria 10376
317 Ga0436362_0093620 3300039453 Bacteria 2020
318 Ga0436362_0228851 3300039453 Bacteria 5282
319 Ga0436362_0769224 3300039453 Bacteria 5735
320 Ga0466972_0000382 3300044658 Bacteria 23692
321 Ga0466972_0099446 3300044658 Bacteria 1377
322 Ga0466966_0077561 3300044684 Bacteria 2073
323 Ga0466963_0028435 3300044694 Bacteria 3589
324 Ga0466968_0019159 3300044735 Bacteria 2753
325 Ga0466968_0136291 3300044735 Bacteria 1120
326 Ga0466970_0038214 3300044765 Bacteria 2545
327 Ga0466959_0077701 3300045049 Bacteria 2395
328 Ga0466967_0122792 3300045976 Bacteria 2402
329 Ga0466967_0140406 3300045976 Bacteria 2250
330 Ga0466967_0374280 3300045976 Bacteria 1382
331 Ga0495603_0036430 3300046455 Bacteria 2954
332 Ga0495651_0000958 3300046462 Bacteria 22344
333 Ga0495651_0031655 3300046462 Bacteria 4125
334 Ga0495651_0224009 3300046462 Bacteria 1300
335 Ga0495653_0133425 3300046463 Bacteria 1754
336 Ga0495650_0100694 3300046471 Bacteria 1085
337 Ga0495594_0056513 3300046499 Bacteria 2166
338 Ga0495606_0017192 3300046507 Bacteria 5479
339 Ga0495610_0000572 3300046512 Bacteria 36651
340 Ga0495618_0078331 3300046514 Bacteria 2107
341 Ga0495628_0012214 3300046516 Bacteria 7240
342 Ga0495628_0103921 3300046516 Bacteria 2190
343 Ga0495652_0034289 3300046529 Bacteria 4425
344 Ga0495652_0054685 3300046529 Bacteria 3398
345 Ga0495640_0044158 3300046533 Bacteria 3100
346 Ga0495668_0047887 3300046616 Bacteria 2373
347 Ga0495634_0072862 3300046642 Bacteria 2259
348 Ga0495625_0138568 3300046660 Bacteria 1643
349 Ga0495613_0185336 3300046689 Bacteria 1473
350 Ga0495624_0199548 3300046690 Bacteria 1216
351 Ga0495600_0202266 3300046809 Bacteria 1275
352 Ga0495636_0016419 3300047318 Bacteria 2957
353 Ga0495674_0551751 3300047319 Bacteria 917
354 Ga0495680_0023683 3300047322 Bacteria 5101
355 Ga0495680_0194601 3300047322 Bacteria 1457
356 Ga0495675_0162343 3300047444 Bacteria 1375
357 Ga0495673_0072934 3300047469 Bacteria 1440
358 Ga0495681_0051558 3300047470 Bacteria 1935
359 Ga0495686_0016226 3300047472 Bacteria 5056
360 Ga0495593_0049085 3300047673 Bacteria 2241
361 Ga0495602_0267429 3300048088 Bacteria 1265
362 Ga0496104_0000562 3300048907 Bacteria 31660
363 Ga0496104_0099936 3300048907 Bacteria 2777
364 Ga0496105_0011494 3300048908 Bacteria 6997
365 Ga0496105_0034027 3300048908 Bacteria 4189
366 Ga0496105_0306468 3300048908 Bacteria 1276
367 Ga0496108_0005748 3300048911 Bacteria 10044
368 Ga0496109_0001052 3300048912 Bacteria 22806
369 Ga0496110_0001022 3300048913 Bacteria 19712
370 Ga0496110_0049480 3300048913 Bacteria 3687
371 Ga0496111_0004100 3300048914 Bacteria 9147
372 Ga0496112_0047274 3300048915 Bacteria 4221
373 Ga0496112_0166274 3300048915 Bacteria 2172
374 Ga0496112_0335492 3300048915 Bacteria 1456
375 Ga0496113_0015367 3300048916 Bacteria 5259
376 Ga0496113_0159345 3300048916 Bacteria 1784
377 Ga0496114_0141681 3300048917 Bacteria 2082
378 Ga0496116_0002317 3300048919 Bacteria 20186
379 Ga0496116_0120213 3300048919 Bacteria 1522
380 Ga0496117_0002604 3300048920 Bacteria 22423
381 Ga0496117_0057813 3300048920 Bacteria 2690
382 Ga0496118_0003936 3300048921 Bacteria 18163
383 Ga0496118_0009618 3300048921 Bacteria 9730
384 Ga0496119_0003028 3300048922 Bacteria 17790
385 Ga0496121_0098874 3300048924 Bacteria 2256
386 Ga0496121_0145762 3300048924 Bacteria 1749
387 Ga0496121_0250935 3300048924 Bacteria 1227
388 Ga0496122_0013111 3300048925 Bacteria 8155
389 Ga0496122_0039563 3300048925 Bacteria 3759
390 Ga0496122_0045562 3300048925 Bacteria 3407
391 Ga0496124_0001457 3300048927 Bacteria 34907
392 Ga0496124_0034994 3300048927 Bacteria 4398
393 Ga0496124_0098523 3300048927 Bacteria 2372
394 Ga0496124_0119457 3300048927 Bacteria 2108
395 Ga0496124_0147079 3300048927 Bacteria 1853
396 Ga0496124_0203655 3300048927 Bacteria 1502
397 Ga0496125_0043738 3300048928 Bacteria 3796
398 Ga0496126_0133843 3300048929 Bacteria 2140
399 Ga0496126_0172896 3300048929 Bacteria 1839
400 Ga0496126_0201606 3300048929 Bacteria 1680
401 Ga0495678_046587 3300049459 Bacteria 1703
402 Ga0501031_0028499 3300049568 Bacteria 3640
403 Ga0501031_0198300 3300049568 Bacteria 1310
404 Ga0501032_0009184 3300049569 Bacteria 7167
405 Ga0501032_0034821 3300049569 Bacteria 3444
406 Ga0501032_0172136 3300049569 Bacteria 1419
407 Ga0501033_0010079 3300049570 Bacteria 7251
408 Ga0501033_0022969 3300049570 Bacteria 4702
409 Ga0501033_0026644 3300049570 Bacteria 4349
410 Ga0501033_0099731 3300049570 Bacteria 2120
411 Ga0501033_0166430 3300049570 Bacteria 1585
412 Ga0501033_0267106 3300049570 Bacteria 1210
413 Ga0501034_0002210 3300049571 Bacteria 24070
414 Ga0501034_0004935 3300049571 Bacteria 14684
415 Ga0501034_0012305 3300049571 Bacteria 8838
416 Ga0501034_0047469 3300049571 Bacteria 4336
417 Ga0501034_0063941 3300049571 Bacteria 3693
418 Ga0501034_0073110 3300049571 Bacteria 3437
419 Ga0501034_0085180 3300049571 Bacteria 3162
420 Ga0501034_0085540 3300049571 Bacteria 3155
421 Ga0501034_0100124 3300049571 Bacteria 2892
422 Ga0501034_0101715 3300049571 Bacteria 2867
423 Ga0501034_0126977 3300049571 Bacteria 2535
424 Ga0501034_0209566 3300049571 Bacteria 1904
425 Ga0501034_0225553 3300049571 Bacteria 1824
426 Ga0501034_0276868 3300049571 Bacteria 1618
427 Ga0501036_0000499 3300049572 Bacteria 28121
428 Ga0501036_0004466 3300049572 Bacteria 11304
429 Ga0501036_0289912 3300049572 Bacteria 1369
430 Ga0501037_0004304 3300049573 Bacteria 10327
431 Ga0501037_0012221 3300049573 Bacteria 6319
432 Ga0501037_0052935 3300049573 Bacteria 2968
433 Ga0501037_0084640 3300049573 Bacteria 2296
434 Ga0501037_0176807 3300049573 Bacteria 1515
435 Ga0501038_0004987 3300049574 Bacteria 12332
436 Ga0501038_0022684 3300049574 Bacteria 5620
437 Ga0501038_0034070 3300049574 Bacteria 4479
438 Ga0501038_0037339 3300049574 Bacteria 4259
439 Ga0501038_0062209 3300049574 Bacteria 3189
440 Ga0501038_0175242 3300049574 Bacteria 1733
441 Ga0501038_0305174 3300049574 Bacteria 1248
442 Ga0501039_0054998 3300049575 Bacteria 3082
443 Ga0501039_0264131 3300049575 Bacteria 1353
444 Ga0501043_0001994 3300049579 Bacteria 17420
445 Ga0501043_0005803 3300049579 Bacteria 9934
446 Ga0501043_0006182 3300049579 Bacteria 9620
447 Ga0501043_0054319 3300049579 Bacteria 3145
448 Ga0501043_0095890 3300049579 Bacteria 2331
449 Ga0501046_0046876 3300049580 Bacteria 3429
450 Ga0501046_0050265 3300049580 Bacteria 3294
451 Ga0501047_0006121 3300049581 Bacteria 11306
452 Ga0501047_0010682 3300049581 Bacteria 8676
453 Ga0501047_0022327 3300049581 Bacteria 6079
454 Ga0501047_0059695 3300049581 Bacteria 3682
455 Ga0501047_0075156 3300049581 Bacteria 3251
456 Ga0501047_0086941 3300049581 Bacteria 3004
457 Ga0501047_0482232 3300049581 Bacteria 1068
458 Ga0501048_0000256 3300049582 Bacteria 35566
459 Ga0501048_0192308 3300049582 Bacteria 1446
460 Ga0501067_0001088 3300049583 Bacteria 14648
461 Ga0501067_0010717 3300049583 Bacteria 5071
462 Ga0501067_0062826 3300049583 Bacteria 2056
463 Ga0501067_0083433 3300049583 Bacteria 1773
464 Ga0501068_0033394 3300049584 Bacteria 3064
465 Ga0501068_0046315 3300049584 Bacteria 2622
466 Ga0501068_0050280 3300049584 Bacteria 2520
467 Ga0501068_0257617 3300049584 Bacteria 1112
468 Ga0501069_0028868 3300049585 Bacteria 3043
469 Ga0501069_0036100 3300049585 Bacteria 2724
470 Ga0501069_0102273 3300049585 Bacteria 1627
471 Ga0501070_0002811 3300049586 Bacteria 15192
472 Ga0501070_0002854 3300049586 Bacteria 15068
473 Ga0501070_0010685 3300049586 Bacteria 7762
474 Ga0501070_0060887 3300049586 Bacteria 3128
475 Ga0501070_0087704 3300049586 Bacteria 2575
476 Ga0501070_0177284 3300049586 Bacteria 1754
477 Ga0501070_0181343 3300049586 Bacteria 1733
478 Ga0501070_0218705 3300049586 Bacteria 1562
479 Ga0501071_0085225 3300049587 Bacteria 2316
480 Ga0501072_0070481 3300049588 Bacteria 2761
481 Ga0501073_0001733 3300049589 Bacteria 16214
482 Ga0501073_0044297 3300049589 Bacteria 3136
483 Ga0501073_0049670 3300049589 Bacteria 2941
484 Ga0501073_0054956 3300049589 Bacteria 2787
485 Ga0501073_0108900 3300049589 Bacteria 1922
486 Ga0501073_0145143 3300049589 Bacteria 1644
487 Ga0501073_0196120 3300049589 Bacteria 1396
488 Ga0501074_0003043 3300049590 Bacteria 11819
489 Ga0501074_0007421 3300049590 Bacteria 7932
490 Ga0501074_0033078 3300049590 Bacteria 3747
491 Ga0501076_0190405 3300049592 Bacteria 1674
492 Ga0501077_0019036 3300049593 Bacteria 4341
493 Ga0501077_0048964 3300049593 Bacteria 2686
494 Ga0501077_0233626 3300049593 Bacteria 1169
495 Ga0501080_0000628 3300049742 Bacteria 27971
496 Ga0501080_0007139 3300049742 Bacteria 10081
497 Ga0501080_0014229 3300049742 Bacteria 7325
498 Ga0501080_0048133 3300049742 Bacteria 3969
499 Ga0501080_0075571 3300049742 Bacteria 3133
500 Ga0501080_0079689 3300049742 Bacteria 3044
501 Ga0501080_0081298 3300049742 Bacteria 3010
502 Ga0501080_0085679 3300049742 Bacteria 2927
503 Ga0501080_0148158 3300049742 Bacteria 2170
504 Ga0501080_0159986 3300049742 Bacteria 2080
505 Ga0501080_0390696 3300049742 Bacteria 1252
506 Ga0501083_0000105 3300049744 Bacteria 56997
507 Ga0501083_0000704 3300049744 Bacteria 21763
508 Ga0501083_0002567 3300049744 Bacteria 12486
509 Ga0501083_0004374 3300049744 Bacteria 9955
510 Ga0501083_0022408 3300049744 Bacteria 4384
511 Ga0501083_0034844 3300049744 Bacteria 3441
512 Ga0501083_0115558 3300049744 Bacteria 1762
513 Ga0501083_0129684 3300049744 Bacteria 1653
514 Ga0501083_0169386 3300049744 Bacteria 1428
515 Ga0501083_0304493 3300049744 Bacteria 1036
516 Ga0501035_0000459 3300049822 Bacteria 45702
517 Ga0501035_0060091 3300049822 Bacteria 3384
518 Ga0501035_0061347 3300049822 Bacteria 3346
519 Ga0501035_0092974 3300049822 Bacteria 2653
520 Ga0501035_0100750 3300049822 Bacteria 2536
521 Ga0501035_0179386 3300049822 Bacteria 1825
522 Ga0501044_0002515 3300049823 Bacteria 20891
523 Ga0501044_0006496 3300049823 Bacteria 12918
524 Ga0501044_0077358 3300049823 Bacteria 3375
525 Ga0501044_0103984 3300049823 Bacteria 2854
526 Ga0501044_0116825 3300049823 Bacteria 2672
527 Ga0501044_0233065 3300049823 Bacteria 1788
528 Ga0501044_0238577 3300049823 Bacteria 1763
529 Ga0501044_0299732 3300049823 Bacteria 1536
530 Ga0501044_0368418 3300049823 Bacteria 1353
531 Ga0501044_0375996 3300049823 Bacteria 1336
532 nmdc:mga03n38_15359_c1 3300050490 Bacteria 2955
533 nmdc:mga03n38_81916_c1 3300050490 Bacteria 1518
534 nmdc:mga00v17_21739_c1 3300050491 Bacteria 3692
535 nmdc:mga0yw44_15216_c1 3300050492 Bacteria 4112
536 nmdc:mga0yw44_214832_c1 3300050492 Bacteria 1273
537 nmdc:mga0yw44_58539_c1 3300050492 Bacteria 2354
538 nmdc:mga06z11_128859_c1 3300050494 Bacteria 1419
539 nmdc:mga06z11_155049_c1 3300050494 Bacteria 1305
540 nmdc:mga06z11_72_c1 3300050494 Bacteria 42329
541 nmdc:mga06z11_933_c1 3300050494 Bacteria 10623
542 nmdc:mga04h51_437_c1 3300050495 Bacteria 10012
543 nmdc:mga06r32_69491_c1 3300050510 Bacteria 3404
544 Ga0495601_0004567 3300053077 Bacteria 8007
545 Ga0495595_0001657 3300053084 Bacteria 8708
546 Ga0495619_0000048 3300053085 Bacteria 102117
547 Ga0495619_0179016 3300053085 Bacteria 1467
548 Ga0500643_025301 3300053087 Bacteria 1874
549 Ga0500644_0182550 3300053088 Bacteria 859
550 Ga0500618_003104 3300053125 Bacteria 5866
551 Ga0500568_0000825 3300053139 Bacteria 21796
552 Ga0500577_0011624 3300053142 Bacteria 2633
553 Ga0500616_0000294 3300053153 Bacteria 72551
554 Ga0500616_0005323 3300053153 Bacteria 8770
555 Ga0500616_0073397 3300053153 Bacteria 1737
556 Ga0500622_0026820 3300053156 Bacteria 3038
557 Ga0500624_018738 3300053157 Bacteria 1094
558 Ga0501084_0001717 3300054114 Bacteria 17403
559 Ga0501084_0018160 3300054114 Bacteria 5856
560 Ga0501084_0052285 3300054114 Bacteria 3419
561 Ga0501084_0088810 3300054114 Bacteria 2594
562 Ga0501084_0174900 3300054114 Bacteria 1812
563 Ga0501082_0001282 3300060353 Bacteria 22071
564 Ga0501082_0003674 3300060353 Bacteria 13411
565 Ga0501082_0016701 3300060353 Bacteria 6321
566 Ga0501082_0033430 3300060353 Bacteria 4437
567 Ga0501082_0048939 3300060353 Bacteria 3644
568 Ga0501082_0438333 3300060353 Bacteria 1141
569 Ga0501082_0485081 3300060353 Bacteria 1080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10000121 Ga0081539_1000012139 193
2 3300046462 Ga0495651_0000958 Ga0495651_0000958_14219_15097 215
3 3300046516 Ga0495628_0012214 Ga0495628_0012214_5095_5973 215
4 3300046529 Ga0495652_0054685 Ga0495652_0054685_2223_3101 215
5 3300048927 Ga0496124_0147079 Ga0496124_0147079_29_769 218
6 3300010375 Ga0105239_10094535 Ga0105239_100945352 220
7 3300053088 Ga0500644_0182550 Ga0500644_0182550_22_807 220
8 3300025922 Ga0207646_10688187 Ga0207646_106881871 223
9 3300053142 Ga0500577_0011624 Ga0500577_0011624_1393_2214 223
10 3300005578 Ga0068854_100017058 Ga0068854_1000170585 227
11 3300005439 Ga0070711_100070122 Ga0070711_1000701222 228
12 3300025972 Ga0207668_10075560 Ga0207668_100755602 228
13 3300034818 Ga0373950_0003966 Ga0373950_0003966_481_1323 228
14 3300005539 Ga0068853_100021441 Ga0068853_1000214412 232
15 3300005548 Ga0070665_100014503 Ga0070665_1000145033 232
16 3300005563 Ga0068855_100026066 Ga0068855_1000260665 232
17 3300005834 Ga0068851_10136541 Ga0068851_101365412 232
18 3300009093 Ga0105240_10019472 Ga0105240_100194726 232
19 3300009174 Ga0105241_10003612 Ga0105241_100036126 232
20 3300009551 Ga0105238_10004736 Ga0105238_100047367 232
21 3300013296 Ga0157374_10164522 Ga0157374_101645222 232
22 3300025904 Ga0207647_10008336 Ga0207647_100083365 232
23 3300025913 Ga0207695_10004277 Ga0207695_100042778 232
24 3300025914 Ga0207671_10000392 Ga0207671_1000039230 232
25 3300025924 Ga0207694_10001464 Ga0207694_1000146414 232
26 3300025949 Ga0207667_10016957 Ga0207667_100169574 232
27 3300025981 Ga0207640_10014039 Ga0207640_100140394 232
28 3300026041 Ga0207639_10477836 Ga0207639_104778362 232
29 3300026067 Ga0207678_10085675 Ga0207678_100856752 232
30 3300028379 Ga0268266_10065615 Ga0268266_100656153 232
31 3300031995 Ga0307409_100467338 Ga0307409_1004673381 234
32 3300006914 Ga0075436_100154699 Ga0075436_1001546992 235
33 3300030522 Ga0307512_10011149 Ga0307512_100111494 235
34 3300035691 Ga0373931_0392763 Ga0373931_0392763_36_830 236
35 3300048919 Ga0496116_0120213 Ga0496116_0120213_712_1485 236
36 3300011119 Ga0105246_10074947 Ga0105246_100749472 237
37 3300046455 Ga0495603_0036430 Ga0495603_0036430_1896_2735 237
38 3300046462 Ga0495651_0224009 Ga0495651_0224009_181_1038 237
39 3300046499 Ga0495594_0056513 Ga0495594_0056513_741_1580 237
40 3300053085 Ga0495619_0179016 Ga0495619_0179016_281_1138 237
41 3300005355 Ga0070671_100044754 Ga0070671_1000447543 238
42 3300025931 Ga0207644_10029557 Ga0207644_100295573 238
43 3300028556 Ga0265337_1006919 Ga0265337_10069194 238
44 3300053087 Ga0500643_025301 Ga0500643_025301_568_1449 238
45 3300031235 Ga0265330_10031036 Ga0265330_100310362 239
46 3300031240 Ga0265320_10129361 Ga0265320_101293612 239
47 3300031250 Ga0265331_10055787 Ga0265331_100557872 239
48 3300031595 Ga0265313_10009853 Ga0265313_100098533 239
49 3300035083 Ga0373926_0006798 Ga0373926_0006798_266_1090 239
50 3300036401 Ga0373937_0067622 Ga0373937_0067622_1683_2507 239
51 3300035170 Ga0373943_0064473 Ga0373943_0064473_120_944 240
52 3300046689 Ga0495613_0185336 Ga0495613_0185336_307_1131 240
53 3300046809 Ga0495600_0202266 Ga0495600_0202266_236_1087 240
54 3300005327 Ga0070658_10015120 Ga0070658_100151204 241
55 3300005329 Ga0070683_100157912 Ga0070683_1001579122 241
56 3300005337 Ga0070682_100042699 Ga0070682_1000426992 241
57 3300005344 Ga0070661_100007769 Ga0070661_1000077692 241
58 3300005458 Ga0070681_10070752 Ga0070681_100707522 241
59 3300005530 Ga0070679_100050231 Ga0070679_1000502312 241
60 3300005564 Ga0070664_100143863 Ga0070664_1001438632 241
61 3300005614 Ga0068856_100053239 Ga0068856_1000532393 241
62 3300025909 Ga0207705_10334328 Ga0207705_103343282 241
63 3300025920 Ga0207649_10196727 Ga0207649_101967272 241
64 3300025932 Ga0207690_10247592 Ga0207690_102475922 241
65 3300025944 Ga0207661_10005391 Ga0207661_100053916 241
66 3300026116 Ga0207674_10030453 Ga0207674_100304532 241
67 3300045976 Ga0466967_0140406 Ga0466967_0140406_1344_2231 241
68 3300048915 Ga0496112_0335492 Ga0496112_0335492_253_1155 241
69 3300048916 Ga0496113_0159345 Ga0496113_0159345_398_1300 241
70 3300050492 nmdc:mga0yw44_15216_c1 nmdc:mga0yw44_15216_c1_1479_2285 241
71 3300025299 Ga0209256_1025983 Ga0209256_10259832 242
72 3300025927 Ga0207687_10375725 Ga0207687_103757251 242
73 3300039447 Ga0436361_0893122 Ga0436361_0893122_655_1446 242
74 3300048924 Ga0496121_0145762 Ga0496121_0145762_757_1584 242
75 3300048927 Ga0496124_0203655 Ga0496124_0203655_188_1015 242
76 3300005347 Ga0070668_100043787 Ga0070668_1000437873 243
77 3300005367 Ga0070667_100254658 Ga0070667_1002546582 243
78 3300005617 Ga0068859_100228403 Ga0068859_1002284032 243
79 3300005719 Ga0068861_100052007 Ga0068861_1000520073 243
80 3300005844 Ga0068862_100009817 Ga0068862_1000098173 243
81 3300006042 Ga0075368_10001006 Ga0075368_100010066 243
82 3300006048 Ga0075363_100059539 Ga0075363_1000595391 243
83 3300006178 Ga0075367_10001020 Ga0075367_1000102011 243
84 3300006931 Ga0097620_100228427 Ga0097620_1002284272 243
85 3300025972 Ga0207668_10015491 Ga0207668_100154913 243
86 3300025986 Ga0207658_10187385 Ga0207658_101873852 243
87 3300026118 Ga0207675_100075031 Ga0207675_1000750313 243
88 3300027866 Ga0209813_10001615 Ga0209813_100016154 243
89 3300028380 Ga0268265_10022622 Ga0268265_100226225 243
90 3300050490 nmdc:mga03n38_15359_c1 nmdc:mga03n38_15359_c1_99_938 243
91 3300050494 nmdc:mga06z11_72_c1 nmdc:mga06z11_72_c1_5958_6797 243
92 3300050495 nmdc:mga04h51_437_c1 nmdc:mga04h51_437_c1_3364_4203 243
93 3300031730 Ga0307516_10010888 Ga0307516_100108886 244
94 3300037418 Ga0395900_0654767 Ga0395900_0654767_91_933 244
95 3300038443 Ga0395901_0389163 Ga0395901_0389163_388_1230 244
96 3300038443 Ga0395901_0685661 Ga0395901_0685661_23_820 244
97 3300039437 Ga0436365_0697045 Ga0436365_0697045_7618_8448 244
98 3300039447 Ga0436361_1124158 Ga0436361_1124158_6511_7329 244
99 3300044658 Ga0466972_0000382 Ga0466972_0000382_22705_23547 244
100 3300044658 Ga0466972_0099446 Ga0466972_0099446_379_1221 244
101 3300044735 Ga0466968_0019159 Ga0466968_0019159_1655_2497 244
102 3300048908 Ga0496105_0306468 Ga0496105_0306468_157_1014 244
103 3300048917 Ga0496114_0141681 Ga0496114_0141681_488_1345 244
104 3300005436 Ga0070713_100313361 Ga0070713_1003133612 245
105 3300005539 Ga0068853_100370060 Ga0068853_1003700601 245
106 3300006038 Ga0075365_10006487 Ga0075365_100064872 245
107 3300009101 Ga0105247_10247026 Ga0105247_102470261 245
108 3300025294 Ga0209025_1044186 Ga0209025_10441862 245
109 3300025299 Ga0209256_1000359 Ga0209256_100035969 245
110 3300025915 Ga0207693_10091474 Ga0207693_100914742 245
111 3300035118 Ga0373954_0031232 Ga0373954_0031232_112_936 245
112 3300035120 Ga0373957_0023576 Ga0373957_0023576_451_1275 245
113 3300036401 Ga0373937_0006458 Ga0373937_0006458_1363_2187 245
114 3300046516 Ga0495628_0103921 Ga0495628_0103921_1281_2105 245
115 3300048088 Ga0495602_0267429 Ga0495602_0267429_215_1039 245
116 3300050492 nmdc:mga0yw44_58539_c1 nmdc:mga0yw44_58539_c1_182_1021 245
117 3300031595 Ga0265313_10011102 Ga0265313_100111022 246
118 3300035086 Ga0373934_0075502 Ga0373934_0075502_308_1132 246
119 3300037471 Ga0395905_0079409 Ga0395905_0079409_2007_2849 246
120 3300039438 Ga0436360_1319645 Ga0436360_1319645_410_1237 246
121 3300039447 Ga0436361_0042892 Ga0436361_0042892_5924_6751 246
122 3300005518 Ga0070699_100484887 Ga0070699_1004848871 247
123 3300021384 Ga0213876_10001630 Ga0213876_100016308 247
124 3300021384 Ga0213876_10001735 Ga0213876_1000173512 247
125 3300021388 Ga0213875_10026039 Ga0213875_100260391 247
126 3300031595 Ga0265313_10000007 Ga0265313_100000075 247
127 3300037853 Ga0436364_0814348 Ga0436364_0814348_1928_2758 247
128 3300037853 Ga0436364_0834731 Ga0436364_0834731_2023_2853 247
129 3300039437 Ga0436365_0162634 Ga0436365_0162634_6451_7293 247
130 3300039437 Ga0436365_0917056 Ga0436365_0917056_7227_8057 247
131 3300039453 Ga0436362_0228851 Ga0436362_0228851_779_1621 247
132 3300039453 Ga0436362_0769224 Ga0436362_0769224_19_849 247
133 3300044694 Ga0466963_0028435 Ga0466963_0028435_2665_3507 247
134 3300045976 Ga0466967_0122792 Ga0466967_0122792_1344_2186 247
135 3300039450 Ga0436363_1022276 Ga0436363_1022276_2611_3441 248
136 3300039453 Ga0436362_0093620 Ga0436362_0093620_752_1582 248
137 3300046616 Ga0495668_0047887 Ga0495668_0047887_1312_2157 248
138 3300050491 nmdc:mga00v17_21739_c1 nmdc:mga00v17_21739_c1_863_1702 248
139 3300050494 nmdc:mga06z11_933_c1 nmdc:mga06z11_933_c1_1064_1903 248
140 3300005327 Ga0070658_10145389 Ga0070658_101453892 249
141 3300005339 Ga0070660_100058731 Ga0070660_1000587312 249
142 3300005578 Ga0068854_100148554 Ga0068854_1001485542 249
143 3300009093 Ga0105240_10259391 Ga0105240_102593912 249
144 3300013104 Ga0157370_10272688 Ga0157370_102726882 249
145 3300014325 Ga0163163_10735759 Ga0163163_107357591 249
146 3300020081 Ga0206354_10965140 Ga0206354_109651402 249
147 3300025909 Ga0207705_10110845 Ga0207705_101108452 249
148 3300025913 Ga0207695_10416502 Ga0207695_104165021 249
149 3300025917 Ga0207660_10309084 Ga0207660_103090842 249
150 3300025919 Ga0207657_10121636 Ga0207657_101216362 249
151 3300025949 Ga0207667_10531071 Ga0207667_105310711 249
152 3300025981 Ga0207640_10127343 Ga0207640_101273432 249
153 3300035116 Ga0373945_0052880 Ga0373945_0052880_32_871 249
154 3300035172 Ga0373955_0021509 Ga0373955_0021509_1674_2486 249
155 3300046462 Ga0495651_0031655 Ga0495651_0031655_654_1466 249
156 3300047319 Ga0495674_0551751 Ga0495674_0551751_69_881 249
157 3300047322 Ga0495680_0194601 Ga0495680_0194601_635_1447 249
158 3300053156 Ga0500622_0026820 Ga0500622_0026820_308_1135 249
159 3300048915 Ga0496112_0166274 Ga0496112_0166274_143_994 250
160 3300049822 Ga0501035_0000459 Ga0501035_0000459_6887_7729 250
161 3300006028 Ga0070717_10166330 Ga0070717_101663301 251
162 3300006038 Ga0075365_10150650 Ga0075365_101506502 251
163 3300025929 Ga0207664_10367426 Ga0207664_103674262 251
164 3300039447 Ga0436361_1028012 Ga0436361_1028012_473_1354 251
165 3300039450 Ga0436363_0283533 Ga0436363_0283533_1079_1939 251
166 3300046660 Ga0495625_0138568 Ga0495625_0138568_443_1288 251
167 iso_pu_bacteria 2643221733 2644727653 251
168 iso_pu_bacteria 2841911363 2841915970 251
169 iso_pu_bacteria 2841917233 2841921650 251
170 iso_pu_bacteria 2915650412 2915653829 251
171 3300005435 Ga0070714_100312998 Ga0070714_1003129981 252
172 3300005436 Ga0070713_100178170 Ga0070713_1001781701 252
173 3300005437 Ga0070710_10071051 Ga0070710_100710511 252
174 3300005439 Ga0070711_100073377 Ga0070711_1000733771 252
175 3300005468 Ga0070707_100560963 Ga0070707_1005609631 252
176 3300005518 Ga0070699_100527902 Ga0070699_1005279021 252
177 3300006028 Ga0070717_10490913 Ga0070717_104909131 252
178 3300006173 Ga0070716_100077438 Ga0070716_1000774381 252
179 3300006175 Ga0070712_100196866 Ga0070712_1001968662 252
180 3300009545 Ga0105237_10106784 Ga0105237_101067843 252
181 3300010159 Ga0099796_10121008 Ga0099796_101210081 252
182 3300025906 Ga0207699_10069984 Ga0207699_100699841 252
183 3300025914 Ga0207671_10061672 Ga0207671_100616723 252
184 3300025915 Ga0207693_10212967 Ga0207693_102129672 252
185 3300025928 Ga0207700_10083725 Ga0207700_100837253 252
186 3300025939 Ga0207665_10355185 Ga0207665_103551852 252
187 3300026088 Ga0207641_10048742 Ga0207641_100487424 252
188 3300031595 Ga0265313_10047331 Ga0265313_100473312 252
189 3300033179 Ga0307507_10020656 Ga0307507_100206569 252
190 3300035117 Ga0373953_0017993 Ga0373953_0017993_1662_2504 252
191 3300036401 Ga0373937_0010664 Ga0373937_0010664_37_879 252
192 3300039447 Ga0436361_0255094 Ga0436361_0255094_125_976 252
193 3300046463 Ga0495653_0133425 Ga0495653_0133425_329_1171 252
194 3300046514 Ga0495618_0078331 Ga0495618_0078331_584_1426 252
195 3300046529 Ga0495652_0034289 Ga0495652_0034289_1708_2550 252
196 3300046533 Ga0495640_0044158 Ga0495640_0044158_2052_2894 252
197 3300046642 Ga0495634_0072862 Ga0495634_0072862_1400_2242 252
198 3300047322 Ga0495680_0023683 Ga0495680_0023683_490_1332 252
199 3300047444 Ga0495675_0162343 Ga0495675_0162343_214_1056 252
200 3300047673 Ga0495593_0049085 Ga0495593_0049085_281_1123 252
201 3300049744 Ga0501083_0034844 Ga0501083_0034844_1094_1936 252
202 3300049744 Ga0501083_0169386 Ga0501083_0169386_133_975 252
203 3300053077 Ga0495601_0004567 Ga0495601_0004567_2548_3390 252
204 3300053084 Ga0495595_0001657 Ga0495595_0001657_3366_4208 252
205 3300053085 Ga0495619_0000048 Ga0495619_0000048_98700_99542 252
206 iso_pu_bacteria 8054002106 8054007825 252
207 3300006175 Ga0070712_100065347 Ga0070712_1000653472 253
208 3300028800 Ga0265338_10193313 Ga0265338_101933132 253
209 3300031241 Ga0265325_10115994 Ga0265325_101159941 253
210 3300035116 Ga0373945_0091259 Ga0373945_0091259_328_1152 253
211 3300035695 Ga0373927_0213156 Ga0373927_0213156_262_1086 253
212 3300037853 Ga0436364_1016854 Ga0436364_1016854_1801_2625 253
213 3300049571 Ga0501034_0101715 Ga0501034_0101715_12_854 253
214 3300049586 Ga0501070_0002811 Ga0501070_0002811_10537_11388 253
215 3300049586 Ga0501070_0177284 Ga0501070_0177284_231_1073 253
216 3300049742 Ga0501080_0075571 Ga0501080_0075571_1392_2234 253
217 3300049744 Ga0501083_0129684 Ga0501083_0129684_334_1176 253
218 3300049823 Ga0501044_0233065 Ga0501044_0233065_119_961 253
219 3300009545 Ga0105237_10471509 Ga0105237_104715092 254
220 3300039447 Ga0436361_1161316 Ga0436361_1161316_1550_2377 254
221 3300039447 Ga0436361_1174688 Ga0436361_1174688_345_1172 254
222 iso_pu_bacteria 2643221551 2643775400 254
223 iso_pu_bacteria 2643221555 2643793846 254
224 iso_pu_bacteria 2751185800 2753360550 254
225 iso_pu_bacteria 2758568016 2758642990 254
226 iso_pu_bacteria 2854911287 2854913368 254
227 iso_pu_bacteria 2996310559 2996314633 254
228 3300005536 Ga0070697_100264189 Ga0070697_1002641892 255
229 3300009545 Ga0105237_10058956 Ga0105237_100589563 255
230 3300031711 Ga0265314_10051549 Ga0265314_100515492 255
231 3300035089 Ga0373944_0065996 Ga0373944_0065996_82_966 255
232 3300044765 Ga0466970_0038214 Ga0466970_0038214_453_1289 255
233 3300045976 Ga0466967_0374280 Ga0466967_0374280_299_1129 255
234 3300049570 Ga0501033_0022969 Ga0501033_0022969_3501_4340 255
235 3300049574 Ga0501038_0022684 Ga0501038_0022684_1269_2108 255
236 3300049586 Ga0501070_0181343 Ga0501070_0181343_781_1620 255
237 iso_pu_bacteria 2508501050 2508732982 255
238 iso_pu_bacteria 2511231027 2511391967 255
239 iso_pu_bacteria 2513237087 2513591940 255
240 iso_pu_bacteria 2513237138 2513867349 255
241 iso_pu_bacteria 2534681786 2535486755 255
242 iso_pu_bacteria 2534681796 2535520071 255
243 iso_pu_bacteria 2582581283 2585169196 255
244 iso_pu_bacteria 2582581304 2585255641 255
245 iso_pu_bacteria 2582581306 2585267275 255
246 iso_pu_bacteria 2582581865 2585386344 255
247 iso_pu_bacteria 2582581867 2585401583 255
248 iso_pu_bacteria 2585427590 2585821277 255
249 iso_pu_bacteria 2643221599 2644003558 255
250 iso_pu_bacteria 2643221607 2644050394 255
251 iso_pu_bacteria 2643221636 2644205622 255
252 iso_pu_bacteria 2643221686 2644483312 255
253 iso_pu_bacteria 2643221688 2644495158 255
254 iso_pu_bacteria 2671180139 2671691926 255
255 iso_pu_bacteria 2767802442 2770196428 255
256 iso_pu_bacteria 2775506901 2776260035 255
257 iso_pu_bacteria 2775506902 2776269435 255
258 iso_pu_bacteria 2775506904 2776282365 255
259 iso_pu_bacteria 2835312727 2835319254 255
260 iso_pu_bacteria 2839993093 2839993495 255
261 iso_pu_bacteria 2840764183 2840766505 255
262 iso_pu_bacteria 2844315083 2844320262 255
263 iso_pu_bacteria 2894232714 2894242795 255
264 iso_pu_bacteria 2894652903 2894653539 255
265 iso_pu_bacteria 2903727486 2903731146 255
266 iso_pu_bacteria 2904578770 2904579858 255
267 iso_pu_bacteria 2906602504 2906608349 255
268 iso_pu_bacteria 2919119836 2919120472 255
269 iso_pu_bacteria 2923556063 2923556829 255
270 iso_pu_bacteria 2935769743 2935776734 255
271 iso_pu_bacteria 2935785616 2935792576 255
272 iso_pu_bacteria 2935793552 2935800628 255
273 iso_pu_bacteria 2939669807 2939674179 255
274 iso_pu_bacteria 2996887358 2996887614 255
275 iso_pu_bacteria 3002141150 3002141847 255
276 iso_pu_bacteria 3003665799 3003672266 255
277 iso_pu_bacteria 3005452660 3005458421 255
278 iso_pu_bacteria 8005258706 8005258962 255
279 iso_pu_bacteria 8005321885 8005322141 255
280 iso_pu_bacteria 8005542996 8005547808 255
281 iso_pu_bacteria 8019648815 8019659292 255
282 iso_pu_bacteria 8056967851 8056974799 255
283 3300025291 Ga0209675_1006994 Ga0209675_10069943 256
284 3300037471 Ga0395905_0007978 Ga0395905_0007978_860_1693 256
285 3300049570 Ga0501033_0166430 Ga0501033_0166430_19_852 256
286 3300049581 Ga0501047_0482232 Ga0501047_0482232_26_859 256
287 3300049583 Ga0501067_0001088 Ga0501067_0001088_1914_2747 256
288 3300049583 Ga0501067_0062826 Ga0501067_0062826_1008_1841 256
289 3300049583 Ga0501067_0083433 Ga0501067_0083433_393_1226 256
290 3300049589 Ga0501073_0054956 Ga0501073_0054956_104_937 256
291 3300049592 Ga0501076_0190405 Ga0501076_0190405_155_988 256
292 3300049593 Ga0501077_0019036 Ga0501077_0019036_2442_3275 256
293 3300049593 Ga0501077_0048964 Ga0501077_0048964_227_1060 256
294 3300049742 Ga0501080_0148158 Ga0501080_0148158_779_1612 256
295 3300049744 Ga0501083_0002567 Ga0501083_0002567_9745_10578 256
296 3300049744 Ga0501083_0022408 Ga0501083_0022408_894_1727 256
297 3300054114 Ga0501084_0018160 Ga0501084_0018160_2988_3821 256
298 3300054114 Ga0501084_0052285 Ga0501084_0052285_1538_2371 256
299 3300060353 Ga0501082_0003674 Ga0501082_0003674_9389_10222 256
300 3300005329 Ga0070683_100206237 Ga0070683_1002062372 257
301 3300005344 Ga0070661_100001193 Ga0070661_1000011932 257
302 3300005578 Ga0068854_100008132 Ga0068854_1000081325 257
303 3300005578 Ga0068854_100287557 Ga0068854_1002875571 257
304 3300005834 Ga0068851_10002009 Ga0068851_100020093 257
305 3300006178 Ga0075367_10058470 Ga0075367_100584701 257
306 3300006237 Ga0097621_100369182 Ga0097621_1003691822 257
307 3300009093 Ga0105240_10123841 Ga0105240_101238412 257
308 3300009098 Ga0105245_10086811 Ga0105245_100868112 257
309 3300009176 Ga0105242_10822132 Ga0105242_108221321 257
310 3300009545 Ga0105237_10018004 Ga0105237_100180047 257
311 3300010375 Ga0105239_10031987 Ga0105239_100319874 257
312 3300014326 Ga0157380_10566419 Ga0157380_105664192 257
313 3300025321 Ga0207656_10022300 Ga0207656_100223002 257
314 3300025914 Ga0207671_10058630 Ga0207671_100586302 257
315 3300025924 Ga0207694_10008057 Ga0207694_100080572 257
316 3300025927 Ga0207687_10072537 Ga0207687_100725371 257
317 3300025981 Ga0207640_10019880 Ga0207640_100198802 257
318 3300026041 Ga0207639_10046304 Ga0207639_100463042 257
319 3300050490 nmdc:mga03n38_81916_c1 nmdc:mga03n38_81916_c1_242_1081 257
320 3300050494 nmdc:mga06z11_128859_c1 nmdc:mga06z11_128859_c1_512_1351 257
321 3300005530 Ga0070679_100009436 Ga0070679_1000094364 258
322 3300006051 Ga0075364_10032489 Ga0075364_100324892 258
323 3300006881 Ga0068865_100419465 Ga0068865_1004194652 258
324 3300013104 Ga0157370_10070121 Ga0157370_100701214 258
325 3300021388 Ga0213875_10003253 Ga0213875_100032533 258
326 3300021388 Ga0213875_10123589 Ga0213875_101235892 258
327 3300025912 Ga0207707_10028294 Ga0207707_100282944 258
328 3300025921 Ga0207652_10029911 Ga0207652_100299114 258
329 3300028577 Ga0265318_10007282 Ga0265318_100072824 258
330 3300028794 Ga0307515_10013701 Ga0307515_1001370114 258
331 3300031238 Ga0265332_10083699 Ga0265332_100836991 258
332 3300031250 Ga0265331_10086629 Ga0265331_100866293 258
333 3300031712 Ga0265342_10145819 Ga0265342_101458192 258
334 3300037853 Ga0436364_0180265 Ga0436364_0180265_5379_6218 258
335 3300037853 Ga0436364_1485304 Ga0436364_1485304_461_1300 258
336 3300039437 Ga0436365_0882074 Ga0436365_0882074_873_1712 258
337 3300044735 Ga0466968_0136291 Ga0466968_0136291_131_973 258
338 3300046690 Ga0495624_0199548 Ga0495624_0199548_275_1114 258
339 3300048922 Ga0496119_0003028 Ga0496119_0003028_13570_14412 258
340 3300048925 Ga0496122_0045562 Ga0496122_0045562_2045_2887 258
341 3300053157 Ga0500624_018738 Ga0500624_018738_74_916 258
342 3300002773 JGI25152J39213_1000410 JGI25152J39213_100041011 259
343 3300003354 JGI25160J50197_1021613 JGI25160J50197_10216133 259
344 3300003771 Ga0055526_1035552 Ga0055526_10355521 259
345 3300003775 Ga0055524_1002912 Ga0055524_10029123 259
346 3300005262 Ga0065165_1003097 Ga0065165_10030974 259
347 3300005327 Ga0070658_10010697 Ga0070658_100106972 259
348 3300005327 Ga0070658_10013631 Ga0070658_100136313 259
349 3300005336 Ga0070680_100137470 Ga0070680_1001374702 259
350 3300005339 Ga0070660_100013816 Ga0070660_1000138165 259
351 3300005339 Ga0070660_100036236 Ga0070660_1000362362 259
352 3300005344 Ga0070661_100041480 Ga0070661_1000414802 259
353 3300005366 Ga0070659_100031437 Ga0070659_1000314372 259
354 3300005435 Ga0070714_100011647 Ga0070714_1000116475 259
355 3300005435 Ga0070714_100061500 Ga0070714_1000615002 259
356 3300005436 Ga0070713_100080154 Ga0070713_1000801542 259
357 3300005437 Ga0070710_10003781 Ga0070710_100037813 259
358 3300005530 Ga0070679_100175184 Ga0070679_1001751842 259
359 3300005530 Ga0070679_100229403 Ga0070679_1002294031 259
360 3300005539 Ga0068853_100034662 Ga0068853_1000346622 259
361 3300005539 Ga0068853_100089985 Ga0068853_1000899852 259
362 3300005563 Ga0068855_100007729 Ga0068855_1000077293 259
363 3300005563 Ga0068855_100036681 Ga0068855_1000366816 259
364 3300005563 Ga0068855_100060029 Ga0068855_1000600294 259
365 3300005563 Ga0068855_100069306 Ga0068855_1000693064 259
366 3300005563 Ga0068855_100721683 Ga0068855_1007216832 259
367 3300005563 Ga0068855_100784851 Ga0068855_1007848511 259
368 3300005577 Ga0068857_100210874 Ga0068857_1002108742 259
369 3300005614 Ga0068856_100051031 Ga0068856_1000510313 259
370 3300005614 Ga0068856_100120682 Ga0068856_1001206822 259
371 3300005614 Ga0068856_100629264 Ga0068856_1006292642 259
372 3300005616 Ga0068852_100090644 Ga0068852_1000906442 259
373 3300005616 Ga0068852_100118271 Ga0068852_1001182712 259
374 3300005616 Ga0068852_100481308 Ga0068852_1004813082 259
375 3300005617 Ga0068859_100083150 Ga0068859_1000831503 259
376 3300005843 Ga0068860_100000317 Ga0068860_10000031732 259
377 3300006048 Ga0075363_100208098 Ga0075363_1002080982 259
378 3300006173 Ga0070716_100003339 Ga0070716_1000033393 259
379 3300006175 Ga0070712_100061747 Ga0070712_1000617472 259
380 3300006177 Ga0075362_10035134 Ga0075362_100351342 259
381 3300006178 Ga0075367_10004105 Ga0075367_100041057 259
382 3300006178 Ga0075367_10105778 Ga0075367_101057782 259
383 3300006186 Ga0075369_10001864 Ga0075369_100018643 259
384 3300006353 Ga0075370_10011868 Ga0075370_100118682 259
385 3300006844 Ga0075428_100001811 Ga0075428_1000018118 259
386 3300006847 Ga0075431_100015775 Ga0075431_1000157753 259
387 3300006931 Ga0097620_100083151 Ga0097620_1000831513 259
388 3300009093 Ga0105240_10185543 Ga0105240_101855432 259
389 3300009093 Ga0105240_10279975 Ga0105240_102799752 259
390 3300009177 Ga0105248_10182083 Ga0105248_101820833 259
391 3300009551 Ga0105238_10125530 Ga0105238_101255302 259
392 3300010375 Ga0105239_10454841 Ga0105239_104548412 259
393 3300013102 Ga0157371_10005646 Ga0157371_1000564612 259
394 3300013104 Ga0157370_10344827 Ga0157370_103448272 259
395 3300013104 Ga0157370_10595047 Ga0157370_105950471 259
396 3300013105 Ga0157369_10178795 Ga0157369_101787952 259
397 3300013105 Ga0157369_10221447 Ga0157369_102214472 259
398 3300021388 Ga0213875_10003260 Ga0213875_100032607 259
399 3300025258 Ga0209129_1004455 Ga0209129_10044552 259
400 3300025272 Ga0209455_1002995 Ga0209455_10029951 259
401 3300025273 Ga0209673_1009112 Ga0209673_10091124 259
402 3300025294 Ga0209025_1003423 Ga0209025_10034232 259
403 3300025294 Ga0209025_1030732 Ga0209025_10307323 259
404 3300025295 Ga0209564_1014968 Ga0209564_10149683 259
405 3300025297 Ga0209758_1012686 Ga0209758_10126863 259
406 3300025299 Ga0209256_1010727 Ga0209256_10107273 259
407 3300025299 Ga0209256_1012131 Ga0209256_10121313 259
408 3300025302 Ga0207426_1001175 Ga0207426_10011756 259
409 3300025303 Ga0209051_1008293 Ga0209051_10082937 259
410 3300025898 Ga0207692_10002516 Ga0207692_100025164 259
411 3300025906 Ga0207699_10000538 Ga0207699_100005381 259
412 3300025909 Ga0207705_10023565 Ga0207705_100235652 259
413 3300025909 Ga0207705_10081786 Ga0207705_100817862 259
414 3300025912 Ga0207707_10039144 Ga0207707_100391441 259
415 3300025912 Ga0207707_10064657 Ga0207707_100646573 259
416 3300025913 Ga0207695_10091689 Ga0207695_100916893 259
417 3300025915 Ga0207693_10030646 Ga0207693_100306463 259
418 3300025916 Ga0207663_10007793 Ga0207663_100077934 259
419 3300025919 Ga0207657_10010880 Ga0207657_100108802 259
420 3300025919 Ga0207657_10011821 Ga0207657_100118217 259
421 3300025920 Ga0207649_10308266 Ga0207649_103082661 259
422 3300025921 Ga0207652_10280277 Ga0207652_102802772 259
423 3300025924 Ga0207694_10017676 Ga0207694_100176762 259
424 3300025929 Ga0207664_10011846 Ga0207664_100118464 259
425 3300025929 Ga0207664_10030517 Ga0207664_100305173 259
426 3300025932 Ga0207690_10292823 Ga0207690_102928231 259
427 3300025939 Ga0207665_10001825 Ga0207665_100018259 259
428 3300025941 Ga0207711_10174873 Ga0207711_101748732 259
429 3300025949 Ga0207667_10008389 Ga0207667_100083897 259
430 3300025949 Ga0207667_10026639 Ga0207667_100266394 259
431 3300025949 Ga0207667_10046697 Ga0207667_100466974 259
432 3300025949 Ga0207667_10067728 Ga0207667_100677283 259
433 3300025949 Ga0207667_10200628 Ga0207667_102006283 259
434 3300025949 Ga0207667_10259137 Ga0207667_102591372 259
435 3300025981 Ga0207640_10056626 Ga0207640_100566263 259
436 3300026035 Ga0207703_10384994 Ga0207703_103849941 259
437 3300026041 Ga0207639_10132217 Ga0207639_101322172 259
438 3300026041 Ga0207639_10215446 Ga0207639_102154462 259
439 3300026078 Ga0207702_10028407 Ga0207702_100284073 259
440 3300026078 Ga0207702_10297236 Ga0207702_102972362 259
441 3300026116 Ga0207674_10046147 Ga0207674_100461474 259
442 3300026142 Ga0207698_10018312 Ga0207698_100183123 259
443 3300026142 Ga0207698_10031681 Ga0207698_100316813 259
444 3300026142 Ga0207698_10052718 Ga0207698_100527183 259
445 3300028381 Ga0268264_10000035 Ga0268264_1000003574 259
446 3300030521 Ga0307511_10072487 Ga0307511_100724872 259
447 3300030521 Ga0307511_10108399 Ga0307511_101083992 259
448 3300031507 Ga0307509_10161039 Ga0307509_101610391 259
449 3300031595 Ga0265313_10051959 Ga0265313_100519592 259
450 3300031616 Ga0307508_10049429 Ga0307508_100494292 259
451 3300031616 Ga0307508_10109357 Ga0307508_101093573 259
452 3300031712 Ga0265342_10000687 Ga0265342_1000068732 259
453 3300031901 Ga0307406_10018217 Ga0307406_100182172 259
454 3300032004 Ga0307414_10181563 Ga0307414_101815632 259
455 3300035115 Ga0373941_0008414 Ga0373941_0008414_1608_2453 259
456 3300035725 Ga0373947_0144365 Ga0373947_0144365_515_1357 259
457 3300037068 Ga0373925_0093610 Ga0373925_0093610_1115_1957 259
458 3300037312 Ga0395899_0024603 Ga0395899_0024603_3361_4206 259
459 3300037312 Ga0395899_0081733 Ga0395899_0081733_140_982 259
460 3300037418 Ga0395900_0191615 Ga0395900_0191615_830_1675 259
461 3300037466 Ga0395898_0063413 Ga0395898_0063413_752_1597 259
462 3300037466 Ga0395898_0235128 Ga0395898_0235128_147_989 259
463 3300037853 Ga0436364_0022735 Ga0436364_0022735_39074_39934 259
464 3300038443 Ga0395901_0067883 Ga0395901_0067883_1990_2835 259
465 3300038443 Ga0395901_0190679 Ga0395901_0190679_478_1320 259
466 3300044684 Ga0466966_0077561 Ga0466966_0077561_532_1374 259
467 3300045049 Ga0466959_0077701 Ga0466959_0077701_1088_1930 259
468 3300046471 Ga0495650_0100694 Ga0495650_0100694_150_992 259
469 3300046507 Ga0495606_0017192 Ga0495606_0017192_2410_3252 259
470 3300046512 Ga0495610_0000572 Ga0495610_0000572_30344_31186 259
471 3300047318 Ga0495636_0016419 Ga0495636_0016419_1431_2273 259
472 3300047469 Ga0495673_0072934 Ga0495673_0072934_165_1007 259
473 3300047470 Ga0495681_0051558 Ga0495681_0051558_67_909 259
474 3300047472 Ga0495686_0016226 Ga0495686_0016226_3291_4133 259
475 3300048907 Ga0496104_0000562 Ga0496104_0000562_22471_23316 259
476 3300048907 Ga0496104_0099936 Ga0496104_0099936_984_1826 259
477 3300048908 Ga0496105_0011494 Ga0496105_0011494_5811_6656 259
478 3300048908 Ga0496105_0034027 Ga0496105_0034027_1274_2116 259
479 3300048911 Ga0496108_0005748 Ga0496108_0005748_5381_6226 259
480 3300048912 Ga0496109_0001052 Ga0496109_0001052_18625_19470 259
481 3300048913 Ga0496110_0001022 Ga0496110_0001022_5727_6572 259
482 3300048913 Ga0496110_0049480 Ga0496110_0049480_392_1234 259
483 3300048914 Ga0496111_0004100 Ga0496111_0004100_1352_2197 259
484 3300048915 Ga0496112_0047274 Ga0496112_0047274_508_1353 259
485 3300048916 Ga0496113_0015367 Ga0496113_0015367_1742_2587 259
486 3300048919 Ga0496116_0002317 Ga0496116_0002317_7520_8362 259
487 3300048920 Ga0496117_0002604 Ga0496117_0002604_13286_14128 259
488 3300048920 Ga0496117_0057813 Ga0496117_0057813_44_886 259
489 3300048921 Ga0496118_0003936 Ga0496118_0003936_8409_9251 259
490 3300048921 Ga0496118_0009618 Ga0496118_0009618_6938_7780 259
491 3300048924 Ga0496121_0098874 Ga0496121_0098874_257_1099 259
492 3300048924 Ga0496121_0250935 Ga0496121_0250935_349_1191 259
493 3300048925 Ga0496122_0013111 Ga0496122_0013111_1688_2530 259
494 3300048925 Ga0496122_0039563 Ga0496122_0039563_2692_3534 259
495 3300048927 Ga0496124_0001457 Ga0496124_0001457_10490_11332 259
496 3300048927 Ga0496124_0034994 Ga0496124_0034994_1175_2017 259
497 3300048927 Ga0496124_0098523 Ga0496124_0098523_1259_2104 259
498 3300048927 Ga0496124_0119457 Ga0496124_0119457_284_1126 259
499 3300048928 Ga0496125_0043738 Ga0496125_0043738_480_1322 259
500 3300048929 Ga0496126_0133843 Ga0496126_0133843_309_1151 259
501 3300048929 Ga0496126_0172896 Ga0496126_0172896_801_1643 259
502 3300048929 Ga0496126_0201606 Ga0496126_0201606_359_1204 259
503 3300049459 Ga0495678_046587 Ga0495678_046587_448_1290 259
504 3300049568 Ga0501031_0028499 Ga0501031_0028499_1242_2084 259
505 3300049568 Ga0501031_0198300 Ga0501031_0198300_334_1179 259
506 3300049569 Ga0501032_0009184 Ga0501032_0009184_178_1026 259
507 3300049569 Ga0501032_0034821 Ga0501032_0034821_28_873 259
508 3300049569 Ga0501032_0172136 Ga0501032_0172136_521_1366 259
509 3300049570 Ga0501033_0010079 Ga0501033_0010079_3132_3977 259
510 3300049570 Ga0501033_0026644 Ga0501033_0026644_2661_3506 259
511 3300049570 Ga0501033_0099731 Ga0501033_0099731_837_1679 259
512 3300049570 Ga0501033_0267106 Ga0501033_0267106_128_1003 259
513 3300049571 Ga0501034_0002210 Ga0501034_0002210_19930_20775 259
514 3300049571 Ga0501034_0004935 Ga0501034_0004935_2093_2941 259
515 3300049571 Ga0501034_0012305 Ga0501034_0012305_1869_2744 259
516 3300049571 Ga0501034_0047469 Ga0501034_0047469_243_1088 259
517 3300049571 Ga0501034_0063941 Ga0501034_0063941_2253_3098 259
518 3300049571 Ga0501034_0073110 Ga0501034_0073110_462_1304 259
519 3300049571 Ga0501034_0085180 Ga0501034_0085180_1972_2814 259
520 3300049571 Ga0501034_0085540 Ga0501034_0085540_1996_2838 259
521 3300049571 Ga0501034_0100124 Ga0501034_0100124_703_1545 259
522 3300049571 Ga0501034_0126977 Ga0501034_0126977_1011_1859 259
523 3300049571 Ga0501034_0209566 Ga0501034_0209566_674_1519 259
524 3300049571 Ga0501034_0225553 Ga0501034_0225553_834_1679 259
525 3300049571 Ga0501034_0276868 Ga0501034_0276868_67_915 259
526 3300049572 Ga0501036_0000499 Ga0501036_0000499_15803_16651 259
527 3300049572 Ga0501036_0004466 Ga0501036_0004466_663_1538 259
528 3300049572 Ga0501036_0289912 Ga0501036_0289912_169_1014 259
529 3300049573 Ga0501037_0004304 Ga0501037_0004304_9103_9978 259
530 3300049573 Ga0501037_0012221 Ga0501037_0012221_2008_2850 259
531 3300049573 Ga0501037_0052935 Ga0501037_0052935_1512_2360 259
532 3300049573 Ga0501037_0084640 Ga0501037_0084640_931_1776 259
533 3300049573 Ga0501037_0176807 Ga0501037_0176807_116_961 259
534 3300049574 Ga0501038_0004987 Ga0501038_0004987_7899_8741 259
535 3300049574 Ga0501038_0034070 Ga0501038_0034070_2640_3485 259
536 3300049574 Ga0501038_0037339 Ga0501038_0037339_1843_2718 259
537 3300049574 Ga0501038_0062209 Ga0501038_0062209_968_1813 259
538 3300049574 Ga0501038_0175242 Ga0501038_0175242_512_1360 259
539 3300049574 Ga0501038_0305174 Ga0501038_0305174_265_1110 259
540 3300049575 Ga0501039_0054998 Ga0501039_0054998_1217_2059 259
541 3300049575 Ga0501039_0264131 Ga0501039_0264131_282_1124 259
542 3300049579 Ga0501043_0001994 Ga0501043_0001994_4567_5415 259
543 3300049579 Ga0501043_0005803 Ga0501043_0005803_8934_9821 259
544 3300049579 Ga0501043_0006182 Ga0501043_0006182_6106_6951 259
545 3300049579 Ga0501043_0054319 Ga0501043_0054319_1096_1938 259
546 3300049579 Ga0501043_0095890 Ga0501043_0095890_1300_2145 259
547 3300049580 Ga0501046_0046876 Ga0501046_0046876_2087_2962 259
548 3300049580 Ga0501046_0050265 Ga0501046_0050265_129_977 259
549 3300049581 Ga0501047_0006121 Ga0501047_0006121_2404_3252 259
550 3300049581 Ga0501047_0010682 Ga0501047_0010682_6518_7393 259
551 3300049581 Ga0501047_0022327 Ga0501047_0022327_2165_3007 259
552 3300049581 Ga0501047_0059695 Ga0501047_0059695_389_1234 259
553 3300049581 Ga0501047_0075156 Ga0501047_0075156_1476_2321 259
554 3300049581 Ga0501047_0086941 Ga0501047_0086941_1656_2498 259
555 3300049582 Ga0501048_0000256 Ga0501048_0000256_16546_17394 259
556 3300049582 Ga0501048_0192308 Ga0501048_0192308_88_933 259
557 3300049583 Ga0501067_0010717 Ga0501067_0010717_3343_4185 259
558 3300049584 Ga0501068_0033394 Ga0501068_0033394_1703_2548 259
559 3300049584 Ga0501068_0046315 Ga0501068_0046315_185_1030 259
560 3300049584 Ga0501068_0050280 Ga0501068_0050280_1224_2069 259
561 3300049584 Ga0501068_0257617 Ga0501068_0257617_138_983 259
562 3300049585 Ga0501069_0028868 Ga0501069_0028868_591_1436 259
563 3300049585 Ga0501069_0036100 Ga0501069_0036100_815_1660 259
564 3300049585 Ga0501069_0102273 Ga0501069_0102273_763_1611 259
565 3300049586 Ga0501070_0002854 Ga0501070_0002854_14069_14959 259
566 3300049586 Ga0501070_0010685 Ga0501070_0010685_6741_7616 259
567 3300049586 Ga0501070_0060887 Ga0501070_0060887_1571_2419 259
568 3300049586 Ga0501070_0087704 Ga0501070_0087704_577_1419 259
569 3300049586 Ga0501070_0218705 Ga0501070_0218705_299_1144 259
570 3300049587 Ga0501071_0085225 Ga0501071_0085225_192_1037 259
571 3300049588 Ga0501072_0070481 Ga0501072_0070481_172_1017 259
572 3300049589 Ga0501073_0001733 Ga0501073_0001733_754_1596 259
573 3300049589 Ga0501073_0044297 Ga0501073_0044297_754_1602 259
574 3300049589 Ga0501073_0049670 Ga0501073_0049670_475_1362 259
575 3300049589 Ga0501073_0108900 Ga0501073_0108900_949_1791 259
576 3300049589 Ga0501073_0145143 Ga0501073_0145143_381_1226 259
577 3300049589 Ga0501073_0196120 Ga0501073_0196120_419_1264 259
578 3300049590 Ga0501074_0003043 Ga0501074_0003043_10708_11550 259
579 3300049590 Ga0501074_0007421 Ga0501074_0007421_6597_7442 259
580 3300049590 Ga0501074_0033078 Ga0501074_0033078_312_1160 259
581 3300049593 Ga0501077_0233626 Ga0501077_0233626_175_1017 259
582 3300049742 Ga0501080_0000628 Ga0501080_0000628_6131_6979 259
583 3300049742 Ga0501080_0007139 Ga0501080_0007139_147_1022 259
584 3300049742 Ga0501080_0014229 Ga0501080_0014229_6022_6864 259
585 3300049742 Ga0501080_0048133 Ga0501080_0048133_2966_3808 259
586 3300049742 Ga0501080_0079689 Ga0501080_0079689_424_1269 259
587 3300049742 Ga0501080_0081298 Ga0501080_0081298_1314_2159 259
588 3300049742 Ga0501080_0085679 Ga0501080_0085679_144_989 259
589 3300049742 Ga0501080_0159986 Ga0501080_0159986_328_1170 259
590 3300049742 Ga0501080_0390696 Ga0501080_0390696_334_1179 259
591 3300049744 Ga0501083_0000105 Ga0501083_0000105_54063_54905 259
592 3300049744 Ga0501083_0000704 Ga0501083_0000704_10324_11172 259
593 3300049744 Ga0501083_0004374 Ga0501083_0004374_1128_1970 259
594 3300049744 Ga0501083_0115558 Ga0501083_0115558_101_946 259
595 3300049744 Ga0501083_0304493 Ga0501083_0304493_121_966 259
596 3300049822 Ga0501035_0060091 Ga0501035_0060091_720_1565 259
597 3300049822 Ga0501035_0061347 Ga0501035_0061347_1314_2159 259
598 3300049822 Ga0501035_0092974 Ga0501035_0092974_179_1021 259
599 3300049822 Ga0501035_0100750 Ga0501035_0100750_138_986 259
600 3300049822 Ga0501035_0179386 Ga0501035_0179386_833_1678 259
601 3300049823 Ga0501044_0002515 Ga0501044_0002515_17952_18800 259
602 3300049823 Ga0501044_0006496 Ga0501044_0006496_2020_2865 259
603 3300049823 Ga0501044_0077358 Ga0501044_0077358_621_1469 259
604 3300049823 Ga0501044_0103984 Ga0501044_0103984_1149_1991 259
605 3300049823 Ga0501044_0116825 Ga0501044_0116825_144_989 259
606 3300049823 Ga0501044_0238577 Ga0501044_0238577_651_1496 259
607 3300049823 Ga0501044_0299732 Ga0501044_0299732_114_989 259
608 3300049823 Ga0501044_0368418 Ga0501044_0368418_278_1123 259
609 3300049823 Ga0501044_0375996 Ga0501044_0375996_393_1238 259
610 3300050492 nmdc:mga0yw44_214832_c1 nmdc:mga0yw44_214832_c1_44_889 259
611 3300050494 nmdc:mga06z11_155049_c1 nmdc:mga06z11_155049_c1_120_962 259
612 3300050510 nmdc:mga06r32_69491_c1 nmdc:mga06r32_69491_c1_1394_2239 259
613 3300053125 Ga0500618_003104 Ga0500618_003104_2238_3080 259
614 3300053139 Ga0500568_0000825 Ga0500568_0000825_15730_16572 259
615 3300053153 Ga0500616_0000294 Ga0500616_0000294_30783_31628 259
616 3300053153 Ga0500616_0005323 Ga0500616_0005323_5330_6172 259
617 3300053153 Ga0500616_0073397 Ga0500616_0073397_624_1469 259
618 3300054114 Ga0501084_0001717 Ga0501084_0001717_13121_13963 259
619 3300054114 Ga0501084_0088810 Ga0501084_0088810_768_1610 259
620 3300054114 Ga0501084_0174900 Ga0501084_0174900_764_1609 259
621 3300060353 Ga0501082_0001282 Ga0501082_0001282_17137_17979 259
622 3300060353 Ga0501082_0016701 Ga0501082_0016701_1165_2007 259
623 3300060353 Ga0501082_0033430 Ga0501082_0033430_2065_2907 259
624 3300060353 Ga0501082_0048939 Ga0501082_0048939_2569_3414 259
625 3300060353 Ga0501082_0438333 Ga0501082_0438333_274_1119 259
626 3300060353 Ga0501082_0485081 Ga0501082_0485081_191_1036 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

90

279

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.7366 72 178
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.6624 71 214
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.6368 13 177
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.6074 67 210
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.5599 65 210
ID Description Score Start End Superfamily
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7526 71 177 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.745 71 178 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6812 80 210 1.10.3720.10
af_P07654_38_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6563 70 214 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6518 72 222 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A4Q2KS29-F1-model_v4 deleted 0.9359 68 161
AF-A0A382Q3J4-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9358 55 165 GO:0005886
GO:0015423
GO:0042956
AF-A0A7C4MA68-F1-model_v4 Carbohydrate ABC transporter permease 0.9298 53 160 GO:0005886
GO:0055085
AF-X1CCM5-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9284 53 166 GO:0005886
GO:0055085
AF-A0A536I989-F1-model_v4 Carbohydrate ABC transporter permease 0.9275 53 161 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
78.99 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map