F470435

General Info

Members Datasets Scaffolds Average Seq Length
626 337 1252 227

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100444582|Ga0070713_1004445822
Length 241
Sequence VTGTATAADSGVSDSTGPTRVVLADDQDLVRAGLRLMIDRAPGLTVVGEAANGHDAVLLARQARADVVLMDIRMPVLDGLAATRRIAADDSLAGVRVLILTTFEVDEYVFEALRSGASGFLGKGARPDALIDAIRTVARGDALLSPSATRGLIARFLSLRDSEPVGTSPLLAALTDREREVTALVAEGMSNTDIARQLTLSPLTVKTHVNHAMTKLGARDRAQLVVFAYQSGLARAPRPRS

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
145 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
146 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
250 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
253 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
306 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
313 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
314 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
315 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
316 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
319 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
320 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
324 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
325 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
326 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
327 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
328 2808606448 Streptomyces sp. 193411 Isolate Unclassified
329 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
330 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
331 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
332 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
333 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
334 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
335 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
336 8002775197 Frankia nepalensis CN7 Isolate Nodule
337 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 1.12
Isolates 2.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 0.16
Rhizoplane 4.63
Rhizosphere 83.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100444582 3300005436 Bacteria 1217
2 JGI25407J50210_10035581 3300003373 Bacteria 1283
3 Ga0070658_10002383 3300005327 Bacteria 15788
4 Ga0070658_10016262 3300005327 Bacteria 5953
5 Ga0070658_10033605 3300005327 Bacteria 4127
6 Ga0070658_10242601 3300005327 Bacteria 1527
7 Ga0070683_100021466 3300005329 Bacteria 5765
8 Ga0070683_100251807 3300005329 Bacteria 1680
9 Ga0068869_100082285 3300005334 Bacteria 2406
10 Ga0070680_100003274 3300005336 Bacteria 12074
11 Ga0070680_100214382 3300005336 Bacteria 1625
12 Ga0070680_100619171 3300005336 Bacteria 929
13 Ga0070660_100125127 3300005339 Bacteria 2054
14 Ga0070689_100498032 3300005340 Bacteria 1043
15 Ga0070661_100029393 3300005344 Bacteria 3966
16 Ga0070661_100333510 3300005344 Bacteria 1187
17 Ga0070709_10003606 3300005434 Bacteria 8317
18 Ga0070714_100001157 3300005435 Bacteria 18993
19 Ga0070714_100005901 3300005435 Bacteria 9395
20 Ga0070714_100026820 3300005435 Bacteria 4764
21 Ga0070714_100031376 3300005435 Bacteria 4433
22 Ga0070714_100100919 3300005435 Bacteria 2542
23 Ga0070714_100102832 3300005435 Bacteria 2519
24 Ga0070714_100229112 3300005435 Bacteria 1711
25 Ga0070713_100011296 3300005436 Bacteria 6498
26 Ga0070713_100024968 3300005436 Bacteria 4665
27 Ga0070713_100026074 3300005436 Bacteria 4583
28 Ga0070713_100068406 3300005436 Bacteria 2992
29 Ga0070713_100094356 3300005436 Bacteria 2579
30 Ga0070713_100100441 3300005436 Bacteria 2505
31 Ga0070713_100116006 3300005436 Bacteria 2341
32 Ga0070713_100182592 3300005436 Bacteria 1886
33 Ga0070713_100211757 3300005436 Bacteria 1755
34 Ga0070713_100389610 3300005436 Bacteria 1300
35 Ga0070710_10003835 3300005437 Bacteria 7111
36 Ga0070710_10104574 3300005437 Bacteria 1691
37 Ga0070701_10180270 3300005438 Bacteria 1236
38 Ga0070711_100039893 3300005439 Bacteria 3164
39 Ga0070711_100401354 3300005439 Bacteria 1113
40 Ga0070711_100604644 3300005439 Bacteria 915
41 Ga0070708_100007142 3300005445 Bacteria 8913
42 Ga0070708_100010250 3300005445 Bacteria 7587
43 Ga0070708_100065833 3300005445 Bacteria 3250
44 Ga0070663_100046562 3300005455 Bacteria 3069
45 Ga0070662_100729883 3300005457 Bacteria 839
46 Ga0070681_10002087 3300005458 Bacteria 18149
47 Ga0070681_10152328 3300005458 Bacteria 2238
48 Ga0070681_10338101 3300005458 Bacteria 1415
49 Ga0070706_100020859 3300005467 Bacteria 6032
50 Ga0070706_100367518 3300005467 Bacteria 1340
51 Ga0070706_100410475 3300005467 Bacteria 1261
52 Ga0070707_100031681 3300005468 Bacteria 5038
53 Ga0070707_100187398 3300005468 Bacteria 2017
54 Ga0070698_100009584 3300005471 Bacteria 10364
55 Ga0070698_100012754 3300005471 Bacteria 8901
56 Ga0070698_100015098 3300005471 Bacteria 8165
57 Ga0070699_100001339 3300005518 Bacteria 22684
58 Ga0070699_100068364 3300005518 Bacteria 3085
59 Ga0070699_100263103 3300005518 Bacteria 1543
60 Ga0070679_100006465 3300005530 Bacteria 10920
61 Ga0070679_100013510 3300005530 Bacteria 7821
62 Ga0070679_100065301 3300005530 Bacteria 3628
63 Ga0070684_100019631 3300005535 Bacteria 5593
64 Ga0070684_100300308 3300005535 Bacteria 1473
65 Ga0070672_100262406 3300005543 Bacteria 1457
66 Ga0070665_100011342 3300005548 Bacteria 9014
67 Ga0068855_100022047 3300005563 Bacteria 7635
68 Ga0070664_100055343 3300005564 Bacteria 3368
69 Ga0070664_100349989 3300005564 Bacteria 1344
70 Ga0068857_100483360 3300005577 Bacteria 1161
71 Ga0068854_100000677 3300005578 Bacteria 20362
72 Ga0068856_100055685 3300005614 Bacteria 3903
73 Ga0070702_100315658 3300005615 Bacteria 1087
74 Ga0068852_100031165 3300005616 Bacteria 4397
75 Ga0068852_100232548 3300005616 Bacteria 1758
76 Ga0068852_100373638 3300005616 Bacteria 1397
77 Ga0068861_100396523 3300005719 Bacteria 1223
78 Ga0068870_10327861 3300005840 Bacteria 975
79 Ga0068863_100779726 3300005841 Bacteria 953
80 Ga0081455_10523751 3300005937 Bacteria 790
81 Ga0081538_10010484 3300005981 Bacteria 7601
82 Ga0081539_10001493 3300005985 Bacteria 39552
83 Ga0070717_10002764 3300006028 Bacteria 12404
84 Ga0070717_10005627 3300006028 Bacteria 9157
85 Ga0070717_10016843 3300006028 Bacteria 5673
86 Ga0070717_10039602 3300006028 Bacteria 3835
87 Ga0070717_10275378 3300006028 Bacteria 1491
88 Ga0075368_10025645 3300006042 Bacteria 2262
89 Ga0075364_10141153 3300006051 Bacteria 1620
90 Ga0070716_100031794 3300006173 Bacteria 2874
91 Ga0070716_100252798 3300006173 Bacteria 1201
92 Ga0070712_100022294 3300006175 Bacteria 4170
93 Ga0070712_100038153 3300006175 Bacteria 3281
94 Ga0075367_10010430 3300006178 Bacteria 4882
95 Ga0075431_100029947 3300006847 Bacteria 5605
96 Ga0105240_10028735 3300009093 Bacteria 7254
97 Ga0105240_10643679 3300009093 Bacteria 1163
98 Ga0105245_10154237 3300009098 Bacteria 2174
99 Ga0105245_10260316 3300009098 Bacteria 1688
100 Ga0105241_10002696 3300009174 Bacteria 13303
101 Ga0105248_10000814 3300009177 Bacteria 34970
102 Ga0105248_10726440 3300009177 Bacteria 1121
103 Ga0105237_10102288 3300009545 Bacteria 2857
104 Ga0105238_10004186 3300009551 Bacteria 14320
105 Ga0105239_10093090 3300010375 Bacteria 3327
106 Ga0157370_10022129 3300013104 Bacteria 6327
107 Ga0157370_10209708 3300013104 Bacteria 1806
108 Ga0157369_10041427 3300013105 Bacteria 5027
109 Ga0157369_10160332 3300013105 Bacteria 2374
110 Ga0157369_10249992 3300013105 Bacteria 1850
111 Ga0157369_10305813 3300013105 Bacteria 1654
112 Ga0157374_10104757 3300013296 Bacteria 2716
113 Ga0157378_12029149 3300013297 Bacteria 625
114 Ga0163162_10459326 3300013306 Bacteria 1405
115 Ga0163162_10629589 3300013306 Bacteria 1197
116 Ga0157372_10278507 3300013307 Bacteria 1944
117 Ga0157375_10005379 3300013308 Bacteria 11124
118 Ga0163163_10022000 3300014325 Bacteria 6029
119 Ga0163163_10270133 3300014325 Bacteria 1752
120 Ga0157380_10757282 3300014326 Bacteria 983
121 Ga0157377_10196863 3300014745 Bacteria 1277
122 Ga0182007_10001404 3300015262 Bacteria 12967
123 Ga0163161_10057538 3300017792 Bacteria 2825
124 Ga0206356_11131282 3300020070 Bacteria 882
125 Ga0206356_11639014 3300020070 Bacteria 1447
126 Ga0206353_11003533 3300020082 Bacteria 6591
127 Ga0154015_1059680 3300020610 Bacteria 1363
128 Ga0213876_10143859 3300021384 Bacteria 1268
129 Ga0213875_10017387 3300021388 Bacteria 3473
130 Ga0213875_10038338 3300021388 Bacteria 2258
131 Ga0207692_10013766 3300025898 Bacteria 3518
132 Ga0207692_10180741 3300025898 Bacteria 1229
133 Ga0207688_10167027 3300025901 Bacteria 1307
134 Ga0207688_10333773 3300025901 Bacteria 932
135 Ga0207647_10006234 3300025904 Bacteria 8689
136 Ga0207699_10049282 3300025906 Bacteria 2479
137 Ga0207699_10251440 3300025906 Bacteria 1218
138 Ga0207643_10479199 3300025908 Bacteria 794
139 Ga0207705_10002197 3300025909 Bacteria 15093
140 Ga0207705_10012093 3300025909 Bacteria 6237
141 Ga0207705_10016477 3300025909 Bacteria 5296
142 Ga0207705_10179197 3300025909 Bacteria 1598
143 Ga0207705_10191729 3300025909 Bacteria 1546
144 Ga0207705_10252670 3300025909 Bacteria 1345
145 Ga0207705_10264164 3300025909 Bacteria 1315
146 Ga0207684_10023768 3300025910 Bacteria 5231
147 Ga0207684_10527702 3300025910 Bacteria 1011
148 Ga0207654_10010621 3300025911 Bacteria 4688
149 Ga0207707_10003265 3300025912 Bacteria 14408
150 Ga0207707_10040962 3300025912 Bacteria 4045
151 Ga0207707_10075006 3300025912 Bacteria 2951
152 Ga0207695_10008999 3300025913 Bacteria 12422
153 Ga0207671_10000597 3300025914 Bacteria 48178
154 Ga0207693_10001202 3300025915 Bacteria 23078
155 Ga0207693_10023224 3300025915 Bacteria 4925
156 Ga0207693_10204839 3300025915 Bacteria 1551
157 Ga0207693_10480641 3300025915 Bacteria 970
158 Ga0207663_10082124 3300025916 Bacteria 2113
159 Ga0207660_10005634 3300025917 Bacteria 8131
160 Ga0207660_10023967 3300025917 Bacteria 4127
161 Ga0207657_10113997 3300025919 Bacteria 2230
162 Ga0207657_10162824 3300025919 Bacteria 1811
163 Ga0207652_10002307 3300025921 Bacteria 16169
164 Ga0207652_10025160 3300025921 Bacteria 4946
165 Ga0207652_10166907 3300025921 Bacteria 1974
166 Ga0207646_10049765 3300025922 Bacteria 3752
167 Ga0207646_10176053 3300025922 Bacteria 1932
168 Ga0207694_10002897 3300025924 Bacteria 13795
169 Ga0207694_10454486 3300025924 Bacteria 1069
170 Ga0207687_10097839 3300025927 Bacteria 2153
171 Ga0207700_10007660 3300025928 Bacteria 6626
172 Ga0207700_10023090 3300025928 Bacteria 4281
173 Ga0207700_10052482 3300025928 Bacteria 3049
174 Ga0207700_10089495 3300025928 Bacteria 2427
175 Ga0207700_10176515 3300025928 Bacteria 1786
176 Ga0207700_10257174 3300025928 Bacteria 1494
177 Ga0207700_10329066 3300025928 Bacteria 1326
178 Ga0207664_10000615 3300025929 Bacteria 24687
179 Ga0207664_10002164 3300025929 Bacteria 12923
180 Ga0207664_10008597 3300025929 Bacteria 7135
181 Ga0207664_10045686 3300025929 Bacteria 3435
182 Ga0207664_10058221 3300025929 Bacteria 3073
183 Ga0207664_10068152 3300025929 Bacteria 2857
184 Ga0207664_10108303 3300025929 Bacteria 2307
185 Ga0207664_10281664 3300025929 Bacteria 1459
186 Ga0207664_10407644 3300025929 Bacteria 1209
187 Ga0207664_10469074 3300025929 Bacteria 1125
188 Ga0207665_10013686 3300025939 Bacteria 5336
189 Ga0207665_10034500 3300025939 Bacteria 3357
190 Ga0207691_10086242 3300025940 Bacteria 2817
191 Ga0207711_10000742 3300025941 Bacteria 31977
192 Ga0207689_10073119 3300025942 Bacteria 2817
193 Ga0207661_10297680 3300025944 Bacteria 1446
194 Ga0207679_10304280 3300025945 Bacteria 1375
195 Ga0207667_10594977 3300025949 Bacteria 1116
196 Ga0207667_11135340 3300025949 Bacteria 763
197 Ga0207651_10799711 3300025960 Bacteria 836
198 Ga0207712_10264337 3300025961 Bacteria 1397
199 Ga0207640_10007166 3300025981 Bacteria 6144
200 Ga0207639_10096542 3300026041 Bacteria 2378
201 Ga0207678_10044694 3300026067 Bacteria 3831
202 Ga0207678_10062527 3300026067 Bacteria 3199
203 Ga0207702_10052603 3300026078 Bacteria 3446
204 Ga0207702_10529174 3300026078 Bacteria 1151
205 Ga0207648_10181212 3300026089 Bacteria 1865
206 Ga0207674_10355843 3300026116 Bacteria 1415
207 Ga0207675_100397029 3300026118 Bacteria 1358
208 Ga0207683_10707619 3300026121 Bacteria 934
209 Ga0207698_10189778 3300026142 Bacteria 1829
210 Ga0207698_10833070 3300026142 Bacteria 926
211 Ga0209813_10011908 3300027866 Bacteria 2285
212 Ga0268266_10035596 3300028379 Bacteria 4236
213 Ga0265337_1000105 3300028556 Bacteria 41898
214 Ga0265337_1000173 3300028556 Bacteria 33851
215 Ga0265337_1002151 3300028556 Bacteria 9263
216 Ga0265326_10001061 3300028558 Bacteria 9793
217 Ga0265326_10001064 3300028558 Bacteria 9778
218 Ga0265326_10001758 3300028558 Bacteria 7496
219 Ga0265319_1001444 3300028563 Bacteria 14199
220 Ga0265319_1001458 3300028563 Bacteria 14150
221 Ga0265319_1002850 3300028563 Bacteria 9244
222 Ga0265334_10000107 3300028573 Bacteria 55523
223 Ga0265334_10000161 3300028573 Bacteria 41629
224 Ga0265334_10000297 3300028573 Bacteria 27857
225 Ga0265318_10022294 3300028577 Bacteria 2534
226 Ga0265318_10053822 3300028577 Bacteria 1508
227 Ga0265323_10030721 3300028653 Bacteria 1999
228 Ga0265322_10009499 3300028654 Bacteria 2825
229 Ga0265322_10011124 3300028654 Bacteria 2611
230 Ga0265322_10014829 3300028654 Bacteria 2252
231 Ga0265336_10004289 3300028666 Bacteria 5421
232 Ga0265336_10030111 3300028666 Bacteria 1692
233 Ga0265336_10040202 3300028666 Bacteria 1432
234 Ga0307515_10000032 3300028794 Bacteria 358317
235 Ga0307515_10012587 3300028794 Bacteria 15903
236 Ga0307515_10046188 3300028794 Bacteria 6665
237 Ga0307515_10095798 3300028794 Bacteria 3648
238 Ga0307515_10226063 3300028794 Bacteria 1676
239 Ga0265338_10001316 3300028800 Bacteria 40695
240 Ga0265338_10004585 3300028800 Bacteria 18587
241 Ga0265338_10008721 3300028800 Bacteria 12256
242 Ga0265324_10002747 3300029957 Bacteria 8739
243 Ga0265324_10003271 3300029957 Bacteria 7793
244 Ga0265324_10106893 3300029957 Bacteria 950
245 Ga0265332_10002469 3300031238 Bacteria 9415
246 Ga0265332_10053437 3300031238 Bacteria 1733
247 Ga0265320_10001169 3300031240 Bacteria 19320
248 Ga0265320_10008807 3300031240 Bacteria 6139
249 Ga0265320_10092640 3300031240 Bacteria 1398
250 Ga0265325_10011247 3300031241 Bacteria 5146
251 Ga0265340_10008848 3300031247 Bacteria 5423
252 Ga0265340_10010256 3300031247 Bacteria 5015
253 Ga0265340_10026795 3300031247 Bacteria 2910
254 Ga0265339_10029051 3300031249 Bacteria 3140
255 Ga0265331_10053527 3300031250 Bacteria 1925
256 Ga0265316_10005558 3300031344 Bacteria 12223
257 Ga0265316_10028232 3300031344 Bacteria 4631
258 Ga0265316_10145676 3300031344 Bacteria 1776
259 Ga0307513_10052705 3300031456 Bacteria 4378
260 Ga0307509_10013898 3300031507 Bacteria 9496
261 Ga0307509_10132246 3300031507 Bacteria 2448
262 Ga0307509_10183307 3300031507 Bacteria 1955
263 Ga0307408_100553214 3300031548 Bacteria 1016
264 Ga0265313_10015093 3300031595 Bacteria 4524
265 Ga0265313_10016601 3300031595 Bacteria 4226
266 Ga0307508_10016529 3300031616 Bacteria 6718
267 Ga0307508_10245867 3300031616 Bacteria 1386
268 Ga0307508_10505159 3300031616 Bacteria 804
269 Ga0265314_10003129 3300031711 Bacteria 16242
270 Ga0265314_10006342 3300031711 Bacteria 10493
271 Ga0265314_10025236 3300031711 Bacteria 4489
272 Ga0265342_10001735 3300031712 Bacteria 19907
273 Ga0265342_10006033 3300031712 Bacteria 9095
274 Ga0307516_10000167 3300031730 Bacteria 83099
275 Ga0307516_10000512 3300031730 Bacteria 51798
276 Ga0307516_10025692 3300031730 Bacteria 5993
277 Ga0307516_10184128 3300031730 Bacteria 1819
278 Ga0307405_10125996 3300031731 Bacteria 1761
279 Ga0307518_10132875 3300031838 Bacteria 1747
280 Ga0307409_100560926 3300031995 Bacteria 1123
281 Ga0307409_100895451 3300031995 Bacteria 901
282 Ga0307409_101226459 3300031995 Bacteria 774
283 Ga0307416_100195511 3300032002 Bacteria 1913
284 Ga0307416_100864828 3300032002 Bacteria 1003
285 Ga0307411_10466332 3300032005 Bacteria 1060
286 Ga0307510_10134939 3300033180 Bacteria 2129
287 Ga0307510_10212832 3300033180 Bacteria 1453
288 Ga0316214_1002990 3300033545 Bacteria 2108
289 Ga0316212_1003039 3300033547 Bacteria 2413
290 Ga0316216_1001297 3300033548 Bacteria 1838
291 Ga0373934_0045555 3300035086 Bacteria 1734
292 Ga0373944_0006743 3300035089 Bacteria 3056
293 Ga0373936_0003488 3300035113 Bacteria 5910
294 Ga0373936_0003658 3300035113 Bacteria 5769
295 Ga0373945_0004033 3300035116 Bacteria 4646
296 Ga0373954_0023681 3300035118 Bacteria 2795
297 Ga0373943_0010238 3300035170 Bacteria 4205
298 Ga0373946_0002723 3300035171 Bacteria 6249
299 Ga0373955_0019898 3300035172 Bacteria 3365
300 Ga0373942_0005275 3300035207 Bacteria 2995
301 Ga0373924_0286930 3300035410 Bacteria 730
302 Ga0373935_0022365 3300035692 Bacteria 3876
303 Ga0373927_0031256 3300035695 Bacteria 3471
304 Ga0373933_0296615 3300035724 Bacteria 1046
305 Ga0373947_0029445 3300035725 Bacteria 3222
306 Ga0373937_0102300 3300036401 Bacteria 2660
307 Ga0373937_0115825 3300036401 Bacteria 2496
308 Ga0372808_000706 3300036459 Bacteria 2927
309 Ga0372808_001919 3300036459 Bacteria 2292
310 Ga0372808_011676 3300036459 Bacteria 1243
311 Ga0373925_0000009 3300037068 Bacteria 243099
312 Ga0373925_0000020 3300037068 Bacteria 170299
313 Ga0373925_0135979 3300037068 Bacteria 1921
314 Ga0395898_0080197 3300037466 Bacteria 3148
315 Ga0436364_0102165 3300037853 Bacteria 21655
316 Ga0436364_0552677 3300037853 Bacteria 1024
317 Ga0436364_1083265 3300037853 Bacteria 7170
318 Ga0436364_1183999 3300037853 Bacteria 2183
319 Ga0395901_0513855 3300038443 Bacteria 1218
320 Ga0395901_0647163 3300038443 Bacteria 1061
321 Ga0395901_1102476 3300038443 Bacteria 764
322 Ga0436365_0937470 3300039437 Bacteria 2531
323 Ga0436362_0853242 3300039453 Bacteria 1094
324 Ga0439436_0000200 3300041404 Bacteria 14409
325 Ga0439439_0008401 3300041406 Bacteria 2438
326 Ga0451853_2587693 3300041512 Bacteria 1497
327 Ga0439433_0010051 3300041999 Bacteria 2065
328 Ga0439449_0033841 3300042007 Bacteria 1903
329 Ga0439457_001542 3300042014 Bacteria 6906
330 Ga0466969_0019147 3300044656 Bacteria 3562
331 Ga0466969_0041947 3300044656 Bacteria 2287
332 Ga0466972_0030831 3300044658 Bacteria 2639
333 Ga0466972_0110859 3300044658 Bacteria 1297
334 Ga0466965_0036883 3300044683 Bacteria 2399
335 Ga0466966_0026916 3300044684 Bacteria 3750
336 Ga0466966_0047023 3300044684 Bacteria 2753
337 Ga0466966_0056912 3300044684 Bacteria 2472
338 Ga0466961_0002379 3300044693 Bacteria 11683
339 Ga0466961_0012609 3300044693 Bacteria 5413
340 Ga0466961_0012945 3300044693 Bacteria 5335
341 Ga0466961_0018293 3300044693 Bacteria 4505
342 Ga0466961_0030021 3300044693 Bacteria 3493
343 Ga0466961_0050394 3300044693 Bacteria 2659
344 Ga0466961_0145023 3300044693 Bacteria 1485
345 Ga0466961_0295296 3300044693 Bacteria 990
346 Ga0466963_0208804 3300044694 Bacteria 1366
347 Ga0466971_0004818 3300044719 Bacteria 5842
348 Ga0466971_0141178 3300044719 Bacteria 1121
349 Ga0466971_0180134 3300044719 Bacteria 993
350 Ga0466970_0270041 3300044765 Bacteria 955
351 Ga0466957_0106890 3300044842 Bacteria 1771
352 Ga0466957_0160234 3300044842 Bacteria 1461
353 Ga0466957_0195944 3300044842 Bacteria 1325
354 Ga0466960_0088437 3300044901 Bacteria 1575
355 Ga0466960_0233342 3300044901 Bacteria 1016
356 Ga0466960_0432561 3300044901 Bacteria 762
357 Ga0466959_0019176 3300045049 Bacteria 5029
358 Ga0466959_0027107 3300045049 Bacteria 4250
359 Ga0466959_0027294 3300045049 Bacteria 4235
360 Ga0466959_0095333 3300045049 Bacteria 2134
361 Ga0466959_0389398 3300045049 Bacteria 948
362 Ga0466958_0014067 3300045836 Bacteria 4565
363 Ga0466958_0057681 3300045836 Bacteria 2360
364 Ga0466958_0059978 3300045836 Bacteria 2316
365 Ga0466967_0503822 3300045976 Bacteria 1188
366 Ga0495617_010910 3300046452 Bacteria 3108
367 Ga0495592_0082026 3300046454 Bacteria 2331
368 Ga0495592_0135012 3300046454 Bacteria 1722
369 Ga0495603_0000367 3300046455 Bacteria 24421
370 Ga0495603_0002967 3300046455 Bacteria 10036
371 Ga0495603_0016063 3300046455 Bacteria 4525
372 Ga0495629_0000659 3300046459 Bacteria 27936
373 Ga0495629_0002813 3300046459 Bacteria 13271
374 Ga0495629_0032806 3300046459 Bacteria 3675
375 Ga0495641_0008673 3300046461 Bacteria 6152
376 Ga0495651_0000426 3300046462 Bacteria 32565
377 Ga0495651_0003006 3300046462 Bacteria 13018
378 Ga0495651_0018777 3300046462 Bacteria 5357
379 Ga0495651_0232254 3300046462 Bacteria 1269
380 Ga0495651_0361322 3300046462 Bacteria 957
381 Ga0495653_0005377 3300046463 Bacteria 10420
382 Ga0495653_0055521 3300046463 Bacteria 3022
383 Ga0495653_0183919 3300046463 Bacteria 1431
384 Ga0495580_0009514 3300046472 Bacteria 7640
385 Ga0495605_0001863 3300046474 Bacteria 13489
386 Ga0495605_0025855 3300046474 Bacteria 3056
387 Ga0495662_0002236 3300046476 Bacteria 9767
388 Ga0495662_0002655 3300046476 Bacteria 9037
389 Ga0495664_0004972 3300046477 Bacteria 7278
390 Ga0495664_0065161 3300046477 Bacteria 2171
391 Ga0495664_0248860 3300046477 Bacteria 1075
392 Ga0495585_0152487 3300046492 Bacteria 1204
393 Ga0495594_0004309 3300046499 Bacteria 7311
394 Ga0495594_0037964 3300046499 Bacteria 2629
395 Ga0495594_0264795 3300046499 Bacteria 979
396 Ga0495596_0073625 3300046500 Bacteria 1326
397 Ga0495607_0035762 3300046501 Bacteria 3001
398 Ga0495583_0011588 3300046506 Bacteria 5054
399 Ga0495606_0008683 3300046507 Bacteria 8753
400 Ga0495608_0000374 3300046511 Bacteria 31246
401 Ga0495608_0346172 3300046511 Bacteria 915
402 Ga0495610_0121631 3300046512 Bacteria 1143
403 Ga0495616_0031870 3300046513 Bacteria 2757
404 Ga0495618_0075177 3300046514 Bacteria 2152
405 Ga0495620_0004542 3300046515 Bacteria 7812
406 Ga0495620_0008781 3300046515 Bacteria 5409
407 Ga0495628_0022681 3300046516 Bacteria 5155
408 Ga0495628_0035922 3300046516 Bacteria 3981
409 Ga0495628_0181519 3300046516 Bacteria 1592
410 Ga0495628_0238716 3300046516 Bacteria 1360
411 Ga0495630_0100943 3300046517 Bacteria 2183
412 Ga0495631_0008763 3300046518 Bacteria 5084
413 Ga0495643_0008983 3300046522 Bacteria 6278
414 Ga0495644_0076835 3300046523 Bacteria 1258
415 Ga0495648_0024218 3300046524 Bacteria 4140
416 Ga0495648_0064174 3300046524 Bacteria 2164
417 Ga0495666_0029195 3300046526 Bacteria 2713
418 Ga0495666_0059477 3300046526 Bacteria 1827
419 Ga0495652_0001890 3300046529 Bacteria 22269
420 Ga0495652_0003839 3300046529 Bacteria 14662
421 Ga0495652_0017632 3300046529 Bacteria 6371
422 Ga0495652_0038425 3300046529 Bacteria 4147
423 Ga0495652_0042990 3300046529 Bacteria 3894
424 Ga0495640_0021227 3300046533 Bacteria 4769
425 Ga0495640_0047252 3300046533 Bacteria 2979
426 Ga0495640_0243773 3300046533 Bacteria 1127
427 Ga0495587_0056490 3300046536 Bacteria 2309
428 Ga0495587_0068888 3300046536 Bacteria 2061
429 Ga0495609_0056828 3300046538 Bacteria 1733
430 Ga0495597_0012977 3300046542 Bacteria 4001
431 Ga0495597_0016716 3300046542 Bacteria 3463
432 Ga0495645_0038365 3300046543 Bacteria 3494
433 Ga0495645_0150280 3300046543 Bacteria 1619
434 Ga0495622_0008218 3300046557 Bacteria 4834
435 Ga0495622_0040930 3300046557 Bacteria 2155
436 Ga0495667_0003821 3300046559 Bacteria 10115
437 Ga0495667_0035176 3300046559 Bacteria 3348
438 Ga0495667_0330018 3300046559 Bacteria 965
439 Ga0495668_0002715 3300046616 Bacteria 14185
440 Ga0495634_0060351 3300046642 Bacteria 2523
441 Ga0495634_0075726 3300046642 Bacteria 2209
442 Ga0495634_0169998 3300046642 Bacteria 1370
443 Ga0495611_0055991 3300046648 Bacteria 1784
444 Ga0495625_0219153 3300046660 Bacteria 1247
445 Ga0495635_0014711 3300046663 Bacteria 5474
446 Ga0495635_0216286 3300046663 Bacteria 1297
447 Ga0495661_0067376 3300046665 Bacteria 2103
448 Ga0495588_0066201 3300046674 Bacteria 1875
449 Ga0495657_0004855 3300046675 Bacteria 10717
450 Ga0495657_0006382 3300046675 Bacteria 9229
451 Ga0495657_0025295 3300046675 Bacteria 4218
452 Ga0495657_0030618 3300046675 Bacteria 3766
453 Ga0495657_0052426 3300046675 Bacteria 2735
454 Ga0495657_0122888 3300046675 Bacteria 1633
455 Ga0495599_0108842 3300046678 Bacteria 1726
456 Ga0495623_0052267 3300046679 Bacteria 2582
457 Ga0495658_0365985 3300046683 Bacteria 917
458 Ga0495613_0000616 3300046689 Bacteria 28415
459 Ga0495613_0002500 3300046689 Bacteria 13867
460 Ga0495613_0002965 3300046689 Bacteria 12703
461 Ga0495613_0010081 3300046689 Bacteria 7020
462 Ga0495613_0014306 3300046689 Bacteria 5888
463 Ga0495613_0030285 3300046689 Bacteria 4020
464 Ga0495624_0048405 3300046690 Bacteria 2698
465 Ga0495624_0095589 3300046690 Bacteria 1831
466 Ga0495624_0120485 3300046690 Bacteria 1611
467 Ga0495671_0236504 3300046692 Bacteria 883
468 Ga0495649_0034844 3300046694 Bacteria 2769
469 Ga0495589_0004626 3300046794 Bacteria 7311
470 Ga0495589_0007316 3300046794 Bacteria 5785
471 Ga0495589_0024088 3300046794 Bacteria 3095
472 Ga0495600_0032354 3300046809 Bacteria 3393
473 Ga0495600_0051348 3300046809 Bacteria 2691
474 Ga0495600_0069637 3300046809 Bacteria 2299
475 Ga0495600_0121345 3300046809 Bacteria 1700
476 Ga0495660_0172523 3300046810 Bacteria 1052
477 Ga0495660_0220424 3300046810 Bacteria 894
478 Ga0495581_0053968 3300047315 Bacteria 2320
479 Ga0495604_0002273 3300047317 Bacteria 15386
480 Ga0495604_0055731 3300047317 Bacteria 3046
481 Ga0495604_0061898 3300047317 Bacteria 2861
482 Ga0495604_0390160 3300047317 Bacteria 918
483 Ga0495674_0061577 3300047319 Bacteria 3270
484 Ga0495674_0071733 3300047319 Bacteria 2988
485 Ga0495674_0103817 3300047319 Bacteria 2416
486 Ga0495674_0112140 3300047319 Bacteria 2311
487 Ga0495672_0111704 3300047320 Bacteria 1466
488 Ga0495676_0000549 3300047321 Bacteria 30836
489 Ga0495676_0006238 3300047321 Bacteria 10968
490 Ga0495676_0014696 3300047321 Bacteria 6997
491 Ga0495676_0050397 3300047321 Bacteria 3339
492 Ga0495676_0104457 3300047321 Bacteria 2090
493 Ga0495680_0002671 3300047322 Bacteria 18006
494 Ga0495680_0017494 3300047322 Bacteria 6119
495 Ga0495683_0129156 3300047323 Bacteria 1193
496 Ga0495687_001069 3300047443 Bacteria 27019
497 Ga0495687_001205 3300047443 Bacteria 24766
498 Ga0495687_004637 3300047443 Bacteria 9171
499 Ga0495687_040573 3300047443 Bacteria 2049
500 Ga0495687_063686 3300047443 Bacteria 1509
501 Ga0495687_083707 3300047443 Bacteria 1241
502 Ga0495675_0006633 3300047444 Bacteria 7087
503 Ga0495675_0346559 3300047444 Bacteria 874
504 Ga0495677_0015012 3300047445 Bacteria 2816
505 Ga0495685_001212 3300047447 Bacteria 7905
506 Ga0495685_020168 3300047447 Bacteria 2290
507 Ga0495685_022353 3300047447 Bacteria 2176
508 Ga0495684_0005985 3300047471 Bacteria 9451
509 Ga0495684_0022656 3300047471 Bacteria 4831
510 Ga0495684_0119178 3300047471 Bacteria 1988
511 Ga0495593_0013773 3300047673 Bacteria 4606
512 Ga0495593_0033299 3300047673 Bacteria 2806
513 Ga0495593_0123561 3300047673 Bacteria 1316
514 Ga0495602_0105026 3300048088 Bacteria 2309
515 Ga0495614_0000143 3300048089 Bacteria 25681
516 Ga0495614_0009488 3300048089 Bacteria 4303
517 Ga0495614_0054606 3300048089 Bacteria 1713
518 Ga0496100_0102120 3300048903 Bacteria 1978
519 Ga0496100_0410546 3300048903 Bacteria 1033
520 Ga0496101_0079739 3300048904 Bacteria 2417
521 Ga0496101_0171053 3300048904 Bacteria 1670
522 Ga0496101_0270741 3300048904 Bacteria 1326
523 Ga0496101_0466676 3300048904 Bacteria 996
524 Ga0496102_0000686 3300048905 Bacteria 33834
525 Ga0496102_0008135 3300048905 Bacteria 8974
526 Ga0496102_0022358 3300048905 Bacteria 5603
527 Ga0496103_0135780 3300048906 Bacteria 1572
528 Ga0496103_0188263 3300048906 Bacteria 1327
529 Ga0496104_0096849 3300048907 Bacteria 2823
530 Ga0496107_0163786 3300048910 Bacteria 1649
531 Ga0496108_0154375 3300048911 Bacteria 1982
532 Ga0496108_0233558 3300048911 Bacteria 1599
533 Ga0496108_0504932 3300048911 Bacteria 1056
534 Ga0496108_0634101 3300048911 Bacteria 930
535 Ga0496109_0006355 3300048912 Bacteria 9949
536 Ga0496109_1016398 3300048912 Bacteria 766
537 Ga0496110_0184126 3300048913 Bacteria 1896
538 Ga0496110_0612457 3300048913 Bacteria 987
539 Ga0496112_0102497 3300048915 Bacteria 2832
540 Ga0496112_0159297 3300048915 Bacteria 2224
541 Ga0496113_0169751 3300048916 Bacteria 1727
542 Ga0496113_0498962 3300048916 Bacteria 977
543 Ga0496114_0018398 3300048917 Bacteria 5648
544 Ga0496114_0037595 3300048917 Bacteria 4004
545 Ga0496114_0061268 3300048917 Bacteria 3146
546 Ga0496114_0240650 3300048917 Bacteria 1591
547 Ga0496116_0002207 3300048919 Bacteria 20736
548 Ga0496117_0011836 3300048920 Bacteria 7764
549 Ga0496117_0027600 3300048920 Bacteria 4418
550 Ga0496118_0000029 3300048921 Bacteria 340978
551 Ga0496118_0060133 3300048921 Bacteria 2823
552 Ga0496119_0005923 3300048922 Bacteria 11518
553 Ga0496121_0008474 3300048924 Bacteria 12069
554 Ga0496122_0000430 3300048925 Bacteria 88467
555 Ga0496123_0000807 3300048926 Bacteria 50548
556 Ga0496124_0000836 3300048927 Bacteria 50145
557 Ga0496126_0004198 3300048929 Bacteria 17358
558 Ga0496126_0006269 3300048929 Bacteria 13282
559 Ga0496126_0085394 3300048929 Bacteria 2782
560 Ga0496126_0350469 3300048929 Bacteria 1207
561 Ga0495678_021875 3300049459 Bacteria 2808
562 Ga0495678_063033 3300049459 Bacteria 1386
563 Ga0501033_0002176 3300049570 Bacteria 16916
564 Ga0501034_0033379 3300049571 Bacteria 5222
565 Ga0501034_0302086 3300049571 Bacteria 1537
566 Ga0501036_0017266 3300049572 Bacteria 6031
567 Ga0501037_0102203 3300049573 Bacteria 2067
568 Ga0501038_0094229 3300049574 Bacteria 2503
569 Ga0501038_0290064 3300049574 Bacteria 1286
570 Ga0501039_0026772 3300049575 Bacteria 4431
571 Ga0501040_0158866 3300049576 Bacteria 1597
572 Ga0501041_0028386 3300049577 Bacteria 3375
573 Ga0501043_0045427 3300049579 Bacteria 3455
574 Ga0501046_0087332 3300049580 Bacteria 2403
575 Ga0501047_0467820 3300049581 Bacteria 1089
576 Ga0501048_0062421 3300049582 Bacteria 2637
577 Ga0501068_0033570 3300049584 Bacteria 3056
578 Ga0501072_0051050 3300049588 Bacteria 3256
579 Ga0501073_0073259 3300049589 Bacteria 2385
580 Ga0501074_0244410 3300049590 Bacteria 1276
581 Ga0501075_0027217 3300049591 Bacteria 4213
582 Ga0501076_0037042 3300049592 Bacteria 3823
583 Ga0501079_0051282 3300049741 Bacteria 3185
584 Ga0501080_0196759 3300049742 Bacteria 1851
585 Ga0501081_0017918 3300049743 Bacteria 4697
586 Ga0501083_0170642 3300049744 Bacteria 1422
587 Ga0501035_0090183 3300049822 Bacteria 2699
588 Ga0501035_0200081 3300049822 Bacteria 1714
589 Ga0501045_0002747 3300049824 Bacteria 12022
590 nmdc:mga00v17_196616_c1 3300050491 Bacteria 1303
591 nmdc:mga06z11_6925_c1 3300050494 Bacteria 4643
592 nmdc:mga04h51_11723_c1 3300050495 Bacteria 2442
593 nmdc:mga07m45_183833_c1 3300050496 Bacteria 1215
594 nmdc:mga06r32_24170_c1 3300050510 Bacteria 5635
595 nmdc:mga0rr50_342919_c1 3300050513 Bacteria 1255
596 Ga0495595_0302138 3300053084 Bacteria 805
597 Ga0495619_0124941 3300053085 Bacteria 1765
598 Ga0495619_0202971 3300053085 Bacteria 1373
599 Ga0500644_0028054 3300053088 Bacteria 1757
600 Ga0500646_0000576 3300053090 Bacteria 10570
601 Ga0500646_0057230 3300053090 Bacteria 1139
602 Ga0500556_0055785 3300053104 Bacteria 1442
603 Ga0500569_014773 3300053109 Bacteria 1941
604 Ga0500652_118252 3300053131 Bacteria 1107
605 Ga0500568_0078516 3300053139 Bacteria 1255
606 Ga0500573_0083660 3300053140 Bacteria 1811
607 Ga0500588_0002904 3300053146 Bacteria 3557
608 Ga0500600_0059044 3300053149 Bacteria 2146
609 Ga0501084_0068098 3300054114 Bacteria 2980
610 Ga0466962_0010318 3300061719 Bacteria 4486
611 Ga0466962_0047238 3300061719 Bacteria 2057
612 Ga0530510_0097937 3300061734 Bacteria 2144
613 2585301768 2582581312 Bacteria 7308206
614 2616700907 2616644814 Bacteria 11555299
615 2616902916 2616644941 Bacteria 8510691
616 2644182030 2643221632 Bacteria 3406696
617 2809235082 2808606448 Bacteria 8656184
618 2837271812 2837268691 Bacteria 7850704
619 2852637484 2852635781 Bacteria 8251373
620 2862511105 2862507626 Bacteria 9425308
621 2883826451 2883821847 Bacteria 5121194
622 2891399531 2891395885 Bacteria 9251614
623 2947228445 2947224130 Bacteria 9938529
624 3006495984 3006493962 Bacteria 8825450
625 8002781842 8002775197 Bacteria 10728764
626 8056061317 8056060235 Bacteria 7259403
627 Ga0070713_100444582
628 JGI25407J50210_10035581
629 Ga0070658_10002383
630 Ga0070658_10016262
631 Ga0070658_10033605
632 Ga0070658_10242601
633 Ga0070683_100021466
634 Ga0070683_100251807
635 Ga0068869_100082285
636 Ga0070680_100003274
637 Ga0070680_100214382
638 Ga0070680_100619171
639 Ga0070660_100125127
640 Ga0070689_100498032
641 Ga0070661_100029393
642 Ga0070661_100333510
643 Ga0070709_10003606
644 Ga0070714_100001157
645 Ga0070714_100005901
646 Ga0070714_100026820
647 Ga0070714_100031376
648 Ga0070714_100100919
649 Ga0070714_100102832
650 Ga0070714_100229112
651 Ga0070713_100011296
652 Ga0070713_100024968
653 Ga0070713_100026074
654 Ga0070713_100068406
655 Ga0070713_100094356
656 Ga0070713_100100441
657 Ga0070713_100116006
658 Ga0070713_100182592
659 Ga0070713_100211757
660 Ga0070713_100389610
661 Ga0070710_10003835
662 Ga0070710_10104574
663 Ga0070701_10180270
664 Ga0070711_100039893
665 Ga0070711_100401354
666 Ga0070711_100604644
667 Ga0070708_100007142
668 Ga0070708_100010250
669 Ga0070708_100065833
670 Ga0070663_100046562
671 Ga0070662_100729883
672 Ga0070681_10002087
673 Ga0070681_10152328
674 Ga0070681_10338101
675 Ga0070706_100020859
676 Ga0070706_100367518
677 Ga0070706_100410475
678 Ga0070707_100031681
679 Ga0070707_100187398
680 Ga0070698_100009584
681 Ga0070698_100012754
682 Ga0070698_100015098
683 Ga0070699_100001339
684 Ga0070699_100068364
685 Ga0070699_100263103
686 Ga0070679_100006465
687 Ga0070679_100013510
688 Ga0070679_100065301
689 Ga0070684_100019631
690 Ga0070684_100300308
691 Ga0070672_100262406
692 Ga0070665_100011342
693 Ga0068855_100022047
694 Ga0070664_100055343
695 Ga0070664_100349989
696 Ga0068857_100483360
697 Ga0068854_100000677
698 Ga0068856_100055685
699 Ga0070702_100315658
700 Ga0068852_100031165
701 Ga0068852_100232548
702 Ga0068852_100373638
703 Ga0068861_100396523
704 Ga0068870_10327861
705 Ga0068863_100779726
706 Ga0081455_10523751
707 Ga0081538_10010484
708 Ga0081539_10001493
709 Ga0070717_10002764
710 Ga0070717_10005627
711 Ga0070717_10016843
712 Ga0070717_10039602
713 Ga0070717_10275378
714 Ga0075368_10025645
715 Ga0075364_10141153
716 Ga0070716_100031794
717 Ga0070716_100252798
718 Ga0070712_100022294
719 Ga0070712_100038153
720 Ga0075367_10010430
721 Ga0075431_100029947
722 Ga0105240_10028735
723 Ga0105240_10643679
724 Ga0105245_10154237
725 Ga0105245_10260316
726 Ga0105241_10002696
727 Ga0105248_10000814
728 Ga0105248_10726440
729 Ga0105237_10102288
730 Ga0105238_10004186
731 Ga0105239_10093090
732 Ga0157370_10022129
733 Ga0157370_10209708
734 Ga0157369_10041427
735 Ga0157369_10160332
736 Ga0157369_10249992
737 Ga0157369_10305813
738 Ga0157374_10104757
739 Ga0157378_12029149
740 Ga0163162_10459326
741 Ga0163162_10629589
742 Ga0157372_10278507
743 Ga0157375_10005379
744 Ga0163163_10022000
745 Ga0163163_10270133
746 Ga0157380_10757282
747 Ga0157377_10196863
748 Ga0182007_10001404
749 Ga0163161_10057538
750 Ga0206356_11131282
751 Ga0206356_11639014
752 Ga0206353_11003533
753 Ga0154015_1059680
754 Ga0213876_10143859
755 Ga0213875_10017387
756 Ga0213875_10038338
757 Ga0207692_10013766
758 Ga0207692_10180741
759 Ga0207688_10167027
760 Ga0207688_10333773
761 Ga0207647_10006234
762 Ga0207699_10049282
763 Ga0207699_10251440
764 Ga0207643_10479199
765 Ga0207705_10002197
766 Ga0207705_10012093
767 Ga0207705_10016477
768 Ga0207705_10179197
769 Ga0207705_10191729
770 Ga0207705_10252670
771 Ga0207705_10264164
772 Ga0207684_10023768
773 Ga0207684_10527702
774 Ga0207654_10010621
775 Ga0207707_10003265
776 Ga0207707_10040962
777 Ga0207707_10075006
778 Ga0207695_10008999
779 Ga0207671_10000597
780 Ga0207693_10001202
781 Ga0207693_10023224
782 Ga0207693_10204839
783 Ga0207693_10480641
784 Ga0207663_10082124
785 Ga0207660_10005634
786 Ga0207660_10023967
787 Ga0207657_10113997
788 Ga0207657_10162824
789 Ga0207652_10002307
790 Ga0207652_10025160
791 Ga0207652_10166907
792 Ga0207646_10049765
793 Ga0207646_10176053
794 Ga0207694_10002897
795 Ga0207694_10454486
796 Ga0207687_10097839
797 Ga0207700_10007660
798 Ga0207700_10023090
799 Ga0207700_10052482
800 Ga0207700_10089495
801 Ga0207700_10176515
802 Ga0207700_10257174
803 Ga0207700_10329066
804 Ga0207664_10000615
805 Ga0207664_10002164
806 Ga0207664_10008597
807 Ga0207664_10045686
808 Ga0207664_10058221
809 Ga0207664_10068152
810 Ga0207664_10108303
811 Ga0207664_10281664
812 Ga0207664_10407644
813 Ga0207664_10469074
814 Ga0207665_10013686
815 Ga0207665_10034500
816 Ga0207691_10086242
817 Ga0207711_10000742
818 Ga0207689_10073119
819 Ga0207661_10297680
820 Ga0207679_10304280
821 Ga0207667_10594977
822 Ga0207667_11135340
823 Ga0207651_10799711
824 Ga0207712_10264337
825 Ga0207640_10007166
826 Ga0207639_10096542
827 Ga0207678_10044694
828 Ga0207678_10062527
829 Ga0207702_10052603
830 Ga0207702_10529174
831 Ga0207648_10181212
832 Ga0207674_10355843
833 Ga0207675_100397029
834 Ga0207683_10707619
835 Ga0207698_10189778
836 Ga0207698_10833070
837 Ga0209813_10011908
838 Ga0268266_10035596
839 Ga0265337_1000105
840 Ga0265337_1000173
841 Ga0265337_1002151
842 Ga0265326_10001061
843 Ga0265326_10001064
844 Ga0265326_10001758
845 Ga0265319_1001444
846 Ga0265319_1001458
847 Ga0265319_1002850
848 Ga0265334_10000107
849 Ga0265334_10000161
850 Ga0265334_10000297
851 Ga0265318_10022294
852 Ga0265318_10053822
853 Ga0265323_10030721
854 Ga0265322_10009499
855 Ga0265322_10011124
856 Ga0265322_10014829
857 Ga0265336_10004289
858 Ga0265336_10030111
859 Ga0265336_10040202
860 Ga0307515_10000032
861 Ga0307515_10012587
862 Ga0307515_10046188
863 Ga0307515_10095798
864 Ga0307515_10226063
865 Ga0265338_10001316
866 Ga0265338_10004585
867 Ga0265338_10008721
868 Ga0265324_10002747
869 Ga0265324_10003271
870 Ga0265324_10106893
871 Ga0265332_10002469
872 Ga0265332_10053437
873 Ga0265320_10001169
874 Ga0265320_10008807
875 Ga0265320_10092640
876 Ga0265325_10011247
877 Ga0265340_10008848
878 Ga0265340_10010256
879 Ga0265340_10026795
880 Ga0265339_10029051
881 Ga0265331_10053527
882 Ga0265316_10005558
883 Ga0265316_10028232
884 Ga0265316_10145676
885 Ga0307513_10052705
886 Ga0307509_10013898
887 Ga0307509_10132246
888 Ga0307509_10183307
889 Ga0307408_100553214
890 Ga0265313_10015093
891 Ga0265313_10016601
892 Ga0307508_10016529
893 Ga0307508_10245867
894 Ga0307508_10505159
895 Ga0265314_10003129
896 Ga0265314_10006342
897 Ga0265314_10025236
898 Ga0265342_10001735
899 Ga0265342_10006033
900 Ga0307516_10000167
901 Ga0307516_10000512
902 Ga0307516_10025692
903 Ga0307516_10184128
904 Ga0307405_10125996
905 Ga0307518_10132875
906 Ga0307409_100560926
907 Ga0307409_100895451
908 Ga0307409_101226459
909 Ga0307416_100195511
910 Ga0307416_100864828
911 Ga0307411_10466332
912 Ga0307510_10134939
913 Ga0307510_10212832
914 Ga0316214_1002990
915 Ga0316212_1003039
916 Ga0316216_1001297
917 Ga0373934_0045555
918 Ga0373944_0006743
919 Ga0373936_0003488
920 Ga0373936_0003658
921 Ga0373945_0004033
922 Ga0373954_0023681
923 Ga0373943_0010238
924 Ga0373946_0002723
925 Ga0373955_0019898
926 Ga0373942_0005275
927 Ga0373924_0286930
928 Ga0373935_0022365
929 Ga0373927_0031256
930 Ga0373933_0296615
931 Ga0373947_0029445
932 Ga0373937_0102300
933 Ga0373937_0115825
934 Ga0372808_000706
935 Ga0372808_001919
936 Ga0372808_011676
937 Ga0373925_0000009
938 Ga0373925_0000020
939 Ga0373925_0135979
940 Ga0395898_0080197
941 Ga0436364_0102165
942 Ga0436364_0552677
943 Ga0436364_1083265
944 Ga0436364_1183999
945 Ga0395901_0513855
946 Ga0395901_0647163
947 Ga0395901_1102476
948 Ga0436365_0937470
949 Ga0436362_0853242
950 Ga0439436_0000200
951 Ga0439439_0008401
952 Ga0451853_2587693
953 Ga0439433_0010051
954 Ga0439449_0033841
955 Ga0439457_001542
956 Ga0466969_0019147
957 Ga0466969_0041947
958 Ga0466972_0030831
959 Ga0466972_0110859
960 Ga0466965_0036883
961 Ga0466966_0026916
962 Ga0466966_0047023
963 Ga0466966_0056912
964 Ga0466961_0002379
965 Ga0466961_0012609
966 Ga0466961_0012945
967 Ga0466961_0018293
968 Ga0466961_0030021
969 Ga0466961_0050394
970 Ga0466961_0145023
971 Ga0466961_0295296
972 Ga0466963_0208804
973 Ga0466971_0004818
974 Ga0466971_0141178
975 Ga0466971_0180134
976 Ga0466970_0270041
977 Ga0466957_0106890
978 Ga0466957_0160234
979 Ga0466957_0195944
980 Ga0466960_0088437
981 Ga0466960_0233342
982 Ga0466960_0432561
983 Ga0466959_0019176
984 Ga0466959_0027107
985 Ga0466959_0027294
986 Ga0466959_0095333
987 Ga0466959_0389398
988 Ga0466958_0014067
989 Ga0466958_0057681
990 Ga0466958_0059978
991 Ga0466967_0503822
992 Ga0495617_010910
993 Ga0495592_0082026
994 Ga0495592_0135012
995 Ga0495603_0000367
996 Ga0495603_0002967
997 Ga0495603_0016063
998 Ga0495629_0000659
999 Ga0495629_0002813
1000 Ga0495629_0032806
1001 Ga0495641_0008673
1002 Ga0495651_0000426
1003 Ga0495651_0003006
1004 Ga0495651_0018777
1005 Ga0495651_0232254
1006 Ga0495651_0361322
1007 Ga0495653_0005377
1008 Ga0495653_0055521
1009 Ga0495653_0183919
1010 Ga0495580_0009514
1011 Ga0495605_0001863
1012 Ga0495605_0025855
1013 Ga0495662_0002236
1014 Ga0495662_0002655
1015 Ga0495664_0004972
1016 Ga0495664_0065161
1017 Ga0495664_0248860
1018 Ga0495585_0152487
1019 Ga0495594_0004309
1020 Ga0495594_0037964
1021 Ga0495594_0264795
1022 Ga0495596_0073625
1023 Ga0495607_0035762
1024 Ga0495583_0011588
1025 Ga0495606_0008683
1026 Ga0495608_0000374
1027 Ga0495608_0346172
1028 Ga0495610_0121631
1029 Ga0495616_0031870
1030 Ga0495618_0075177
1031 Ga0495620_0004542
1032 Ga0495620_0008781
1033 Ga0495628_0022681
1034 Ga0495628_0035922
1035 Ga0495628_0181519
1036 Ga0495628_0238716
1037 Ga0495630_0100943
1038 Ga0495631_0008763
1039 Ga0495643_0008983
1040 Ga0495644_0076835
1041 Ga0495648_0024218
1042 Ga0495648_0064174
1043 Ga0495666_0029195
1044 Ga0495666_0059477
1045 Ga0495652_0001890
1046 Ga0495652_0003839
1047 Ga0495652_0017632
1048 Ga0495652_0038425
1049 Ga0495652_0042990
1050 Ga0495640_0021227
1051 Ga0495640_0047252
1052 Ga0495640_0243773
1053 Ga0495587_0056490
1054 Ga0495587_0068888
1055 Ga0495609_0056828
1056 Ga0495597_0012977
1057 Ga0495597_0016716
1058 Ga0495645_0038365
1059 Ga0495645_0150280
1060 Ga0495622_0008218
1061 Ga0495622_0040930
1062 Ga0495667_0003821
1063 Ga0495667_0035176
1064 Ga0495667_0330018
1065 Ga0495668_0002715
1066 Ga0495634_0060351
1067 Ga0495634_0075726
1068 Ga0495634_0169998
1069 Ga0495611_0055991
1070 Ga0495625_0219153
1071 Ga0495635_0014711
1072 Ga0495635_0216286
1073 Ga0495661_0067376
1074 Ga0495588_0066201
1075 Ga0495657_0004855
1076 Ga0495657_0006382
1077 Ga0495657_0025295
1078 Ga0495657_0030618
1079 Ga0495657_0052426
1080 Ga0495657_0122888
1081 Ga0495599_0108842
1082 Ga0495623_0052267
1083 Ga0495658_0365985
1084 Ga0495613_0000616
1085 Ga0495613_0002500
1086 Ga0495613_0002965
1087 Ga0495613_0010081
1088 Ga0495613_0014306
1089 Ga0495613_0030285
1090 Ga0495624_0048405
1091 Ga0495624_0095589
1092 Ga0495624_0120485
1093 Ga0495671_0236504
1094 Ga0495649_0034844
1095 Ga0495589_0004626
1096 Ga0495589_0007316
1097 Ga0495589_0024088
1098 Ga0495600_0032354
1099 Ga0495600_0051348
1100 Ga0495600_0069637
1101 Ga0495600_0121345
1102 Ga0495660_0172523
1103 Ga0495660_0220424
1104 Ga0495581_0053968
1105 Ga0495604_0002273
1106 Ga0495604_0055731
1107 Ga0495604_0061898
1108 Ga0495604_0390160
1109 Ga0495674_0061577
1110 Ga0495674_0071733
1111 Ga0495674_0103817
1112 Ga0495674_0112140
1113 Ga0495672_0111704
1114 Ga0495676_0000549
1115 Ga0495676_0006238
1116 Ga0495676_0014696
1117 Ga0495676_0050397
1118 Ga0495676_0104457
1119 Ga0495680_0002671
1120 Ga0495680_0017494
1121 Ga0495683_0129156
1122 Ga0495687_001069
1123 Ga0495687_001205
1124 Ga0495687_004637
1125 Ga0495687_040573
1126 Ga0495687_063686
1127 Ga0495687_083707
1128 Ga0495675_0006633
1129 Ga0495675_0346559
1130 Ga0495677_0015012
1131 Ga0495685_001212
1132 Ga0495685_020168
1133 Ga0495685_022353
1134 Ga0495684_0005985
1135 Ga0495684_0022656
1136 Ga0495684_0119178
1137 Ga0495593_0013773
1138 Ga0495593_0033299
1139 Ga0495593_0123561
1140 Ga0495602_0105026
1141 Ga0495614_0000143
1142 Ga0495614_0009488
1143 Ga0495614_0054606
1144 Ga0496100_0102120
1145 Ga0496100_0410546
1146 Ga0496101_0079739
1147 Ga0496101_0171053
1148 Ga0496101_0270741
1149 Ga0496101_0466676
1150 Ga0496102_0000686
1151 Ga0496102_0008135
1152 Ga0496102_0022358
1153 Ga0496103_0135780
1154 Ga0496103_0188263
1155 Ga0496104_0096849
1156 Ga0496107_0163786
1157 Ga0496108_0154375
1158 Ga0496108_0233558
1159 Ga0496108_0504932
1160 Ga0496108_0634101
1161 Ga0496109_0006355
1162 Ga0496109_1016398
1163 Ga0496110_0184126
1164 Ga0496110_0612457
1165 Ga0496112_0102497
1166 Ga0496112_0159297
1167 Ga0496113_0169751
1168 Ga0496113_0498962
1169 Ga0496114_0018398
1170 Ga0496114_0037595
1171 Ga0496114_0061268
1172 Ga0496114_0240650
1173 Ga0496116_0002207
1174 Ga0496117_0011836
1175 Ga0496117_0027600
1176 Ga0496118_0000029
1177 Ga0496118_0060133
1178 Ga0496119_0005923
1179 Ga0496121_0008474
1180 Ga0496122_0000430
1181 Ga0496123_0000807
1182 Ga0496124_0000836
1183 Ga0496126_0004198
1184 Ga0496126_0006269
1185 Ga0496126_0085394
1186 Ga0496126_0350469
1187 Ga0495678_021875
1188 Ga0495678_063033
1189 Ga0501033_0002176
1190 Ga0501034_0033379
1191 Ga0501034_0302086
1192 Ga0501036_0017266
1193 Ga0501037_0102203
1194 Ga0501038_0094229
1195 Ga0501038_0290064
1196 Ga0501039_0026772
1197 Ga0501040_0158866
1198 Ga0501041_0028386
1199 Ga0501043_0045427
1200 Ga0501046_0087332
1201 Ga0501047_0467820
1202 Ga0501048_0062421
1203 Ga0501068_0033570
1204 Ga0501072_0051050
1205 Ga0501073_0073259
1206 Ga0501074_0244410
1207 Ga0501075_0027217
1208 Ga0501076_0037042
1209 Ga0501079_0051282
1210 Ga0501080_0196759
1211 Ga0501081_0017918
1212 Ga0501083_0170642
1213 Ga0501035_0090183
1214 Ga0501035_0200081
1215 Ga0501045_0002747
1216 nmdc:mga00v17_196616_c1
1217 nmdc:mga06z11_6925_c1
1218 nmdc:mga04h51_11723_c1
1219 nmdc:mga07m45_183833_c1
1220 nmdc:mga06r32_24170_c1
1221 nmdc:mga0rr50_342919_c1
1222 Ga0495595_0302138
1223 Ga0495619_0124941
1224 Ga0495619_0202971
1225 Ga0500644_0028054
1226 Ga0500646_0000576
1227 Ga0500646_0057230
1228 Ga0500556_0055785
1229 Ga0500569_014773
1230 Ga0500652_118252
1231 Ga0500568_0078516
1232 Ga0500573_0083660
1233 Ga0500588_0002904
1234 Ga0500600_0059044
1235 Ga0501084_0068098
1236 Ga0466962_0010318
1237 Ga0466962_0047238
1238 Ga0530510_0097937
1239 2585301768
1240 2616700907
1241 2616902916
1242 2644182030
1243 2809235082
1244 2837271812
1245 2852637484
1246 2862511105
1247 2883826451
1248 2891399531
1249 2947228445
1250 3006495984
1251 8002781842
1252 8056061317

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

21

135

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

172

228

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

170

216

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9823 153 215
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9799 155 215
3eul-assembly2.cif.gz_B structure of the signal receiver domain of the putative response regulator narl from mycobacterium tuberculosis 0.9798 2 122
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9751 151 215
1zlk-assembly1.cif.gz_B crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain-dna complex 0.9743 152 209
ID Description Score Start End Superfamily
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9801 2 120 3.40.50.2300
1zlkB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9743 152 209 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9684 155 209 1.10.10.10
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9664 1 114 3.40.50.2300
4if4D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.965 2 122 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A838SGR7-F1-model_v4 Response regulator 0.9769 2 121 GO:0000160
GO:0016301
AF-A0A6I4N8B7-F1-model_v4 Response regulator 0.9586 2 219 GO:0000160
GO:0003677
GO:0006355
AF-A0A7W7HMD1-F1-model_v4 DNA-binding NarL/FixJ family response regulator 0.9524 1 219 GO:0000160
GO:0003677
GO:0006355
AF-W9GLQ1-F1-model_v4 LuxR family transcriptional regulator 0.9501 2 219 GO:0000160
GO:0003677
GO:0006355
AF-A0A4R1DQK2-F1-model_v4 deleted 0.9488 2 219

Map