F470391

General Info

Members Datasets Scaffolds Average Seq Length
625 371 553 314

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0092539|Ga0495597_0092539_16_1011
Length 331
Sequence MKAFTYERAKDPVGAARAVAGQPGAKFLAGGTNLLDLMKLQIETPVHLVDVQDIGLARIEPTADGGLRIGALVTNTDLASDRRVRRDYGVLSRAIVAGASGQLRNKATTAGNLLQRTRCPYFYDPNMPCNKRKPGSGCSAIGGFSRQLAVVGSSDHCIATNPSDMAVALRVLDATVETVKPDGSSRAIPIAEFHRLPGDTPHVETVLTPGELITGVTLPKPIGGFHHYEKVRDRASYAFALVSVAAVIQKDGSGRVALGGVAHKPWRIEEAEELLTGQPASEAAFEQAAERILRGARGHGQNDFKIPLAKNAIIQALTNAARKNELRGDKQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2511231011 Pseudomonas sp. GM30 Isolate Nodule
4 2511231023 Pseudomonas sp. GM80 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
10 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
11 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
12 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
13 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
14 2643221584 Caulobacter sp. Root656 Isolate Unclassified
15 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
16 2643221658 Variovorax sp. Root411 Isolate Unclassified
17 2643221664 Massilia sp. Root418 Isolate Unclassified
18 2643221672 Variovorax sp. Root434 Isolate Unclassified
19 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
20 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
21 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
22 2721755523 Delftia sp. HK171 Isolate Unclassified
23 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
24 2738541293 Rhizobium sp. GV031 Isolate Unclassified
25 2773857673 Pseudomonas sp. 443 Isolate Unclassified
26 2784132063 Pseudomonas sp. 424 Isolate Unclassified
27 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
28 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
29 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
30 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
31 2842747753 Variovorax sp. R-72060 Isolate Unclassified
32 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
33 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
34 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
35 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
36 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
37 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
38 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
39 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
40 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
41 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
42 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
43 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
44 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
45 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
46 2928037797 Variovorax sp. 1126 Isolate Unclassified
47 2928044640 Variovorax sp. 1128 Isolate Unclassified
48 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
49 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
50 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
51 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
52 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
53 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
54 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
55 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
56 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
57 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
58 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
59 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
60 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
61 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
62 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
63 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
64 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
65 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
66 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
67 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
68 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
69 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
70 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
71 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
73 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
74 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
75 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
76 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
77 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
78 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
79 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
86 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
87 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
90 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
91 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
94 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
95 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
212 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
213 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
214 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
218 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
219 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
220 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
221 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
222 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
223 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
224 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
225 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
226 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
227 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
236 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
254 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
298 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
304 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
305 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
306 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
307 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
308 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
309 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
315 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
336 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
337 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
338 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
339 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
350 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
353 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
354 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
355 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
356 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
357 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
358 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
361 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
362 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
363 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
366 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
367 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
368 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
369 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
370 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
371 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.62
Metatranscriptomes 0
Isolates 11.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 15.04
Nodule 3.52
Rhizoplane 1.28
Rhizosphere 67.84
Stem 0
Stem Tuber 0
Unclassified 11.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_351495 2162886007 Bacteria 17555
2 JGI24739J22299_10005304 3300001989 Bacteria 4909
3 JGI25152J39213_1000041 3300002773 Bacteria 88071
4 JGI25150J39212_1000399 3300002774 Bacteria 20346
5 JGI25150J39212_1000766 3300002774 Bacteria 11091
6 JGI25151J46595_10000141 3300003187 Bacteria 95351
7 JGI25151J46595_10007034 3300003187 Bacteria 5566
8 JGI25406J46586_10000117 3300003203 Bacteria 34556
9 JGI25153J46596_10000007 3300003215 Bacteria 377573
10 JGI25153J46596_10000106 3300003215 Bacteria 95351
11 rootH1_10004060 3300003316 Bacteria 9447
12 rootL2_10005700 3300003322 Bacteria 43298
13 rootL2_10194570 3300003322 Bacteria 2953
14 JGI25160J50197_1007309 3300003354 Bacteria 4342
15 Ga0055535_1003706 3300003761 Bacteria 4124
16 Ga0055542_1000003 3300003762 Bacteria 582721
17 Ga0055536_1000152 3300003781 Bacteria 59461
18 Ga0055536_1006686 3300003781 Bacteria 5303
19 Ga0055534_1004678 3300003784 Bacteria 3878
20 Ga0055530_10000292 3300003791 Bacteria 45623
21 Ga0055530_10002045 3300003791 Bacteria 13586
22 Ga0055531_10000792 3300003794 Bacteria 26275
23 Ga0055531_10001376 3300003794 Bacteria 18057
24 Ga0055531_10028400 3300003794 Bacteria 1930
25 Ga0065165_1007820 3300005262 Bacteria 5146
26 Ga0065704_10092405 3300005289 Bacteria 2656
27 Ga0070658_10121547 3300005327 Bacteria 2170
28 Ga0070676_10081866 3300005328 Bacteria 1960
29 Ga0070689_100020373 3300005340 Bacteria 4919
30 Ga0070687_100002160 3300005343 Bacteria 7276
31 Ga0070661_100290586 3300005344 Bacteria 1270
32 Ga0070668_100008374 3300005347 Bacteria 7680
33 Ga0070669_100001026 3300005353 Bacteria 20337
34 Ga0070669_100117011 3300005353 Bacteria 2029
35 Ga0070675_100003940 3300005354 Bacteria 11251
36 Ga0070671_100293753 3300005355 Bacteria 1383
37 Ga0070674_100000123 3300005356 Bacteria 35400
38 Ga0070673_100003883 3300005364 Bacteria 9391
39 Ga0070688_100012635 3300005365 Bacteria 4736
40 Ga0070667_100113364 3300005367 Bacteria 2353
41 Ga0068853_100003381 3300005539 Bacteria 12217
42 Ga0068853_100461093 3300005539 Bacteria 1196
43 Ga0070672_100004418 3300005543 Bacteria 9199
44 Ga0070664_100042088 3300005564 Bacteria 3857
45 Ga0068856_100006764 3300005614 Bacteria 11225
46 Ga0068852_100025737 3300005616 Bacteria 4772
47 Ga0068859_100001917 3300005617 Bacteria 21221
48 Ga0068859_100006701 3300005617 Bacteria 11698
49 Ga0068861_100000111 3300005719 Bacteria 41057
50 Ga0068858_100328227 3300005842 Bacteria 1463
51 Ga0068860_100025171 3300005843 Bacteria 5743
52 Ga0068860_100055883 3300005843 Bacteria 3753
53 Ga0068862_100016259 3300005844 Bacteria 6192
54 Ga0068862_100538832 3300005844 Bacteria 1113
55 Ga0081540_1000102 3300005983 Bacteria 91311
56 Ga0081539_10000922 3300005985 Bacteria 55364
57 Ga0081539_10002387 3300005985 Bacteria 26756
58 Ga0081539_10098484 3300005985 Bacteria 1495
59 Ga0075363_100002380 3300006048 Bacteria 7662
60 Ga0075364_10026973 3300006051 Bacteria 3667
61 Ga0075432_10000669 3300006058 Bacteria 10529
62 Ga0075367_10038008 3300006178 Bacteria 2800
63 Ga0075369_10011613 3300006186 Bacteria 3467
64 Ga0075366_10003003 3300006195 Bacteria 8797
65 Ga0075366_10013861 3300006195 Bacteria 4595
66 Ga0075370_10001294 3300006353 Bacteria 10693
67 Ga0075430_100023323 3300006846 Bacteria 5266
68 Ga0075430_100252785 3300006846 Bacteria 1460
69 Ga0075434_100092381 3300006871 Bacteria 3029
70 Ga0075429_100043432 3300006880 Bacteria 3912
71 Ga0097620_100001917 3300006931 Bacteria 21221
72 Ga0097620_100006701 3300006931 Bacteria 11698
73 Ga0079104_1000199 3300006946 Bacteria 84282
74 Ga0079104_1000357 3300006946 Bacteria 55345
75 Ga0079104_1014871 3300006946 Bacteria 2331
76 Ga0105244_10000473 3300009036 Bacteria 36586
77 Ga0105244_10015018 3300009036 Bacteria 4454
78 Ga0105244_10019023 3300009036 Bacteria 3843
79 Ga0105250_10001210 3300009092 Bacteria 14355
80 Ga0105240_10000215 3300009093 Bacteria 115967
81 Ga0105240_10019181 3300009093 Bacteria 9143
82 Ga0105243_10003779 3300009148 Bacteria 12132
83 Ga0105243_10012113 3300009148 Bacteria 6520
84 Ga0105242_10001114 3300009176 Bacteria 21176
85 Ga0105248_10002303 3300009177 Bacteria 21145
86 Ga0105248_10206643 3300009177 Bacteria 2212
87 Ga0105237_10021184 3300009545 Bacteria 6686
88 Ga0105238_10204923 3300009551 Bacteria 1948
89 Ga0105239_10000025 3300010375 Bacteria 254049
90 Ga0105246_10017860 3300011119 Bacteria 4513
91 Ga0157319_1000024 3300012497 Bacteria 65569
92 Ga0157373_10019013 3300013100 Bacteria 5000
93 Ga0157373_10020187 3300013100 Bacteria 4846
94 Ga0157371_10057805 3300013102 Bacteria 2751
95 Ga0157371_10109534 3300013102 Bacteria 1960
96 Ga0157370_10173759 3300013104 Bacteria 2002
97 Ga0157369_10001616 3300013105 Bacteria 27583
98 Ga0157369_10002918 3300013105 Bacteria 20446
99 Ga0157369_10418692 3300013105 Bacteria 1389
100 Ga0157372_10007682 3300013307 Bacteria 11470
101 Ga0157375_10022255 3300013308 Bacteria 5832
102 Ga0182008_10003319 3300014497 Bacteria 9781
103 Ga0182008_10012765 3300014497 Bacteria 4428
104 Ga0182007_10001830 3300015262 Bacteria 11091
105 Ga0182007_10003210 3300015262 Bacteria 7792
106 Ga0182005_1014080 3300015265 Bacteria 2243
107 Ga0183363_1001 3300015690 Bacteria 611534
108 Ga0163161_10001061 3300017792 Bacteria 20821
109 Ga0163161_10003979 3300017792 Bacteria 10350
110 Ga0209436_105330 3300025208 Bacteria 2980
111 Ga0209674_105302 3300025226 Bacteria 1931
112 Ga0209563_100523 3300025230 Bacteria 13015
113 Ga0207427_102500 3300025231 Bacteria 4885
114 Ga0207425_1000234 3300025245 Bacteria 42951
115 Ga0209677_101893 3300025253 Bacteria 8450
116 Ga0209148_1002232 3300025254 Bacteria 7083
117 Ga0209129_1000049 3300025258 Bacteria 268086
118 Ga0209233_1029575 3300025261 Bacteria 1301
119 Ga0209565_1002581 3300025263 Bacteria 6428
120 Ga0209565_1002865 3300025263 Bacteria 5925
121 Ga0209565_1003209 3300025263 Bacteria 5413
122 Ga0209673_1000477 3300025273 Bacteria 66849
123 Ga0209673_1002582 3300025273 Bacteria 12261
124 Ga0209130_1000267 3300025284 Bacteria 65435
125 Ga0209130_1001174 3300025284 Bacteria 18812
126 Ga0209130_1005825 3300025284 Bacteria 4161
127 Ga0209675_1004739 3300025291 Bacteria 5925
128 Ga0209675_1004897 3300025291 Bacteria 5781
129 Ga0209675_1008661 3300025291 Bacteria 3701
130 Ga0209676_1000065 3300025292 Bacteria 318605
131 Ga0209676_1000137 3300025292 Bacteria 179437
132 Ga0209676_1000154 3300025292 Bacteria 166013
133 Ga0209025_1000348 3300025294 Bacteria 100228
134 Ga0209025_1000481 3300025294 Bacteria 77405
135 Ga0209025_1011406 3300025294 Bacteria 5860
136 Ga0209564_1001368 3300025295 Bacteria 25567
137 Ga0209564_1001413 3300025295 Bacteria 24762
138 Ga0209758_1000017 3300025297 Bacteria 754393
139 Ga0209758_1000135 3300025297 Bacteria 177753
140 Ga0209050_1000015 3300025298 Bacteria 759102
141 Ga0209050_1000071 3300025298 Bacteria 295478
142 Ga0209256_1000075 3300025299 Bacteria 236149
143 Ga0209256_1000129 3300025299 Bacteria 163766
144 Ga0209256_1000604 3300025299 Bacteria 49837
145 Ga0207426_1000171 3300025302 Bacteria 163766
146 Ga0207426_1000185 3300025302 Bacteria 154146
147 Ga0209051_1000010 3300025303 Bacteria 641298
148 Ga0209257_1000026 3300025304 Bacteria 723225
149 Ga0209257_1000027 3300025304 Bacteria 703541
150 Ga0209257_1000244 3300025304 Bacteria 126098
151 Ga0207656_10004778 3300025321 Bacteria 4755
152 Ga0207696_1000002 3300025711 Bacteria 1098043
153 Ga0207655_1003447 3300025728 Bacteria 11763
154 Ga0207655_1004793 3300025728 Bacteria 9428
155 Ga0207713_1015091 3300025735 Bacteria 3982
156 Ga0207713_1015140 3300025735 Bacteria 3972
157 Ga0207643_10003052 3300025908 Bacteria 9000
158 Ga0207695_10000347 3300025913 Bacteria 107013
159 Ga0207695_10232021 3300025913 Bacteria 1749
160 Ga0207662_10004642 3300025918 Bacteria 7248
161 Ga0207649_10403143 3300025920 Bacteria 1024
162 Ga0207681_10005041 3300025923 Bacteria 8120
163 Ga0207681_10107908 3300025923 Bacteria 2020
164 Ga0207694_10122716 3300025924 Bacteria 2075
165 Ga0207650_10121242 3300025925 Bacteria 2036
166 Ga0207659_10009901 3300025926 Bacteria 5965
167 Ga0207644_10248888 3300025931 Bacteria 1417
168 Ga0207706_10012799 3300025933 Bacteria 7634
169 Ga0207709_10000131 3300025935 Bacteria 109649
170 Ga0207709_10007925 3300025935 Bacteria 5886
171 Ga0207670_10028975 3300025936 Bacteria 3521
172 Ga0207669_10000155 3300025937 Bacteria 32382
173 Ga0207691_10003193 3300025940 Bacteria 16012
174 Ga0207711_10000635 3300025941 Bacteria 35316
175 Ga0207711_10070319 3300025941 Bacteria 3035
176 Ga0207651_10006501 3300025960 Bacteria 6129
177 Ga0207651_10087041 3300025960 Bacteria 2273
178 Ga0207668_10000851 3300025972 Bacteria 18409
179 Ga0207640_10014688 3300025981 Bacteria 4513
180 Ga0207703_10275619 3300026035 Bacteria 1526
181 Ga0207639_10015366 3300026041 Bacteria 5401
182 Ga0207641_10007038 3300026088 Bacteria 9399
183 Ga0207676_10177470 3300026095 Bacteria 1862
184 Ga0207674_10088330 3300026116 Bacteria 3093
185 Ga0207674_10207077 3300026116 Bacteria 1911
186 Ga0207674_10283139 3300026116 Bacteria 1606
187 Ga0207675_100551477 3300026118 Bacteria 1152
188 Ga0207698_10332766 3300026142 Bacteria 1427
189 Ga0209281_1000293 3300027111 Bacteria 91386
190 Ga0209281_1000630 3300027111 Bacteria 39048
191 Ga0209281_1002110 3300027111 Bacteria 8835
192 Ga0207428_10043019 3300027907 Bacteria 3650
193 Ga0268264_10011531 3300028381 Bacteria 7302
194 Ga0316178_1089777 3300030735 Bacteria 12509
195 Ga0265325_10140856 3300031241 Bacteria 1147
196 Ga0307513_10001443 3300031456 Bacteria 34174
197 Ga0307408_100022917 3300031548 Bacteria 4249
198 Ga0307408_100129554 3300031548 Bacteria 1966
199 Ga0307405_10008255 3300031731 Bacteria 5267
200 Ga0307410_10047139 3300031852 Bacteria 2878
201 Ga0307407_10024707 3300031903 Bacteria 3155
202 Ga0307412_10050819 3300031911 Bacteria 2737
203 Ga0307412_10155506 3300031911 Bacteria 1692
204 Ga0307412_10171313 3300031911 Bacteria 1623
205 Ga0307412_10217571 3300031911 Bacteria 1462
206 Ga0307412_10223991 3300031911 Bacteria 1443
207 Ga0307409_100190657 3300031995 Bacteria 1824
208 Ga0307409_100276038 3300031995 Bacteria 1551
209 Ga0307416_100007949 3300032002 Bacteria 6792
210 Ga0307416_100301217 3300032002 Bacteria 1593
211 Ga0307414_10034022 3300032004 Bacteria 3374
212 Ga0307414_10059268 3300032004 Bacteria 2702
213 Ga0307414_10120068 3300032004 Bacteria 2019
214 Ga0307411_10010201 3300032005 Bacteria 4994
215 Ga0307415_100001785 3300032126 Bacteria 10533
216 Ga0307510_10002229 3300033180 Bacteria 21900
217 Ga0315911_1000003 3300033442 Bacteria 502217
218 Ga0237819_00250 3300038705 Bacteria 19601
219 Ga0439438_000607 3300041405 Bacteria 16142
220 Ga0439438_000671 3300041405 Bacteria 15357
221 Ga0439461_0002843 3300041410 Bacteria 2801
222 Ga0439431_0029847 3300041997 Bacteria 1348
223 Ga0439432_000803 3300042006 Bacteria 11725
224 Ga0439452_000704 3300042010 Bacteria 16375
225 Ga0439456_000344 3300042013 Bacteria 10452
226 Ga0439457_006144 3300042014 Bacteria 2963
227 Ga0439463_025255 3300042016 Bacteria 1490
228 Ga0450911_000334 3300042115 Bacteria 16854
229 Ga0450890_005181 3300042127 Bacteria 1680
230 Ga0450900_000805 3300042136 Bacteria 2738
231 Ga0450903_002952 3300042138 Bacteria 2970
232 Ga0450904_001444 3300042139 Bacteria 3346
233 Ga0450906_000267 3300042145 Bacteria 10195
234 Ga0439446_0029909 3300042156 Bacteria 1573
235 Ga0439434_0006465 3300042435 Bacteria 3424
236 Ga0466972_0013292 3300044658 Bacteria 4133
237 Ga0466965_0009568 3300044683 Bacteria 4505
238 Ga0466966_0019939 3300044684 Bacteria 4410
239 Ga0466966_0063375 3300044684 Bacteria 2329
240 Ga0466968_0042153 3300044735 Bacteria 1929
241 Ga0466970_0166567 3300044765 Bacteria 1220
242 Ga0466959_0049628 3300045049 Bacteria 3083
243 Ga0495617_007281 3300046452 Bacteria 3844
244 Ga0495617_008002 3300046452 Bacteria 3652
245 Ga0495617_068358 3300046452 Bacteria 1169
246 Ga0495627_000415 3300046453 Bacteria 37684
247 Ga0495627_001298 3300046453 Bacteria 15265
248 Ga0495627_004382 3300046453 Bacteria 5923
249 Ga0495627_030538 3300046453 Bacteria 1707
250 Ga0495603_0020632 3300046455 Bacteria 3992
251 Ga0495590_0001415 3300046457 Bacteria 10391
252 Ga0495591_001632 3300046458 Bacteria 13529
253 Ga0495591_002824 3300046458 Bacteria 9356
254 Ga0495591_006678 3300046458 Bacteria 5041
255 Ga0495591_022618 3300046458 Bacteria 2028
256 Ga0495591_050695 3300046458 Bacteria 1135
257 Ga0495629_0035886 3300046459 Bacteria 3502
258 Ga0495629_0070388 3300046459 Bacteria 2441
259 Ga0495629_0116122 3300046459 Bacteria 1865
260 Ga0495638_0000024 3300046460 Bacteria 362116
261 Ga0495638_0000528 3300046460 Bacteria 44566
262 Ga0495638_0000667 3300046460 Bacteria 37379
263 Ga0495638_0002019 3300046460 Bacteria 17306
264 Ga0495638_0032020 3300046460 Bacteria 3374
265 Ga0495638_0037607 3300046460 Bacteria 3079
266 Ga0495638_0157421 3300046460 Bacteria 1313
267 Ga0495651_0081247 3300046462 Bacteria 2447
268 Ga0495651_0296624 3300046462 Bacteria 1086
269 Ga0495653_0002124 3300046463 Bacteria 15626
270 Ga0495653_0031525 3300046463 Bacteria 4213
271 Ga0495650_0000042 3300046471 Bacteria 357244
272 Ga0495650_0001297 3300046471 Bacteria 25392
273 Ga0495650_0002183 3300046471 Bacteria 16549
274 Ga0495650_0017013 3300046471 Bacteria 3657
275 Ga0495650_0018859 3300046471 Bacteria 3416
276 Ga0495650_0073996 3300046471 Bacteria 1329
277 Ga0495580_0009790 3300046472 Bacteria 7517
278 Ga0495582_0057168 3300046473 Bacteria 2150
279 Ga0495605_0013274 3300046474 Bacteria 4548
280 Ga0495605_0017184 3300046474 Bacteria 3900
281 Ga0495605_0027957 3300046474 Bacteria 2916
282 Ga0495639_0006701 3300046475 Bacteria 4957
283 Ga0495664_0008429 3300046477 Bacteria 5753
284 Ga0495664_0023769 3300046477 Bacteria 3557
285 Ga0495584_0003935 3300046491 Bacteria 8028
286 Ga0495584_0048491 3300046491 Bacteria 2141
287 Ga0495584_0078419 3300046491 Bacteria 1662
288 Ga0495584_0109622 3300046491 Bacteria 1396
289 Ga0495584_0123053 3300046491 Bacteria 1314
290 Ga0495585_0000662 3300046492 Bacteria 31696
291 Ga0495585_0001580 3300046492 Bacteria 17704
292 Ga0495585_0001674 3300046492 Bacteria 16946
293 Ga0495585_0033133 3300046492 Bacteria 2926
294 Ga0495585_0214366 3300046492 Bacteria 974
295 Ga0495594_0081438 3300046499 Bacteria 1808
296 Ga0495596_0000239 3300046500 Bacteria 37245
297 Ga0495596_0005161 3300046500 Bacteria 6219
298 Ga0495596_0014157 3300046500 Bacteria 3364
299 Ga0495596_0023431 3300046500 Bacteria 2504
300 Ga0495596_0049873 3300046500 Bacteria 1641
301 Ga0495596_0057177 3300046500 Bacteria 1522
302 Ga0495607_0001249 3300046501 Bacteria 22783
303 Ga0495607_0011555 3300046501 Bacteria 5871
304 Ga0495607_0036654 3300046501 Bacteria 2953
305 Ga0495583_0005026 3300046506 Bacteria 9151
306 Ga0495583_0009734 3300046506 Bacteria 5706
307 Ga0495583_0044051 3300046506 Bacteria 2074
308 Ga0495583_0067590 3300046506 Bacteria 1578
309 Ga0495583_0070648 3300046506 Bacteria 1535
310 Ga0495606_0002139 3300046507 Bacteria 23838
311 Ga0495606_0006849 3300046507 Bacteria 10401
312 Ga0495606_0007259 3300046507 Bacteria 9986
313 Ga0495610_0000300 3300046512 Bacteria 52078
314 Ga0495610_0002036 3300046512 Bacteria 17262
315 Ga0495610_0003361 3300046512 Bacteria 12544
316 Ga0495610_0005068 3300046512 Bacteria 9495
317 Ga0495616_0000853 3300046513 Bacteria 22214
318 Ga0495616_0001384 3300046513 Bacteria 16893
319 Ga0495616_0001474 3300046513 Bacteria 16340
320 Ga0495616_0004044 3300046513 Bacteria 9316
321 Ga0495616_0075802 3300046513 Bacteria 1618
322 Ga0495618_0112054 3300046514 Bacteria 1747
323 Ga0495620_0032809 3300046515 Bacteria 2362
324 Ga0495628_0010034 3300046516 Bacteria 8058
325 Ga0495628_0047526 3300046516 Bacteria 3404
326 Ga0495630_0003416 3300046517 Bacteria 11047
327 Ga0495631_0000763 3300046518 Bacteria 20676
328 Ga0495631_0043116 3300046518 Bacteria 1991
329 Ga0495631_0045295 3300046518 Bacteria 1937
330 Ga0495631_0083442 3300046518 Bacteria 1377
331 Ga0495631_0106991 3300046518 Bacteria 1202
332 Ga0495632_0002599 3300046519 Bacteria 13615
333 Ga0495632_0005077 3300046519 Bacteria 8804
334 Ga0495632_0007114 3300046519 Bacteria 7081
335 Ga0495632_0031056 3300046519 Bacteria 2766
336 Ga0495632_0058529 3300046519 Bacteria 1877
337 Ga0495637_0000889 3300046520 Bacteria 19276
338 Ga0495637_0002729 3300046520 Bacteria 9620
339 Ga0495637_0003072 3300046520 Bacteria 8914
340 Ga0495637_0005709 3300046520 Bacteria 6310
341 Ga0495643_0000023 3300046522 Bacteria 288590
342 Ga0495643_0000504 3300046522 Bacteria 48931
343 Ga0495643_0000854 3300046522 Bacteria 32834
344 Ga0495643_0008470 3300046522 Bacteria 6506
345 Ga0495643_0010229 3300046522 Bacteria 5779
346 Ga0495643_0027558 3300046522 Bacteria 3191
347 Ga0495643_0137535 3300046522 Bacteria 1221
348 Ga0495644_0002641 3300046523 Bacteria 7124
349 Ga0495648_0000005 3300046524 Bacteria 362116
350 Ga0495648_0000132 3300046524 Bacteria 88064
351 Ga0495648_0001417 3300046524 Bacteria 23437
352 Ga0495648_0006475 3300046524 Bacteria 9553
353 Ga0495648_0015463 3300046524 Bacteria 5540
354 Ga0495642_0000124 3300046528 Bacteria 44239
355 Ga0495642_0008925 3300046528 Bacteria 3835
356 Ga0495642_0030372 3300046528 Bacteria 2161
357 Ga0495652_0040507 3300046529 Bacteria 4027
358 Ga0495652_0094318 3300046529 Bacteria 2441
359 Ga0495654_0000002 3300046530 Bacteria 1021205
360 Ga0495654_0001496 3300046530 Bacteria 15980
361 Ga0495654_0004577 3300046530 Bacteria 8169
362 Ga0495654_0019265 3300046530 Bacteria 3571
363 Ga0495654_0174537 3300046530 Bacteria 934
364 Ga0495665_0024120 3300046531 Bacteria 3267
365 Ga0495665_0045911 3300046531 Bacteria 2320
366 Ga0495640_0082731 3300046533 Bacteria 2131
367 Ga0495586_0021869 3300046535 Bacteria 3413
368 Ga0495609_0014133 3300046538 Bacteria 3758
369 Ga0495609_0023946 3300046538 Bacteria 2802
370 Ga0495609_0055912 3300046538 Bacteria 1749
371 Ga0495597_0092539 3300046542 Bacteria 1282
372 Ga0495645_0025923 3300046543 Bacteria 4255
373 Ga0495645_0225698 3300046543 Bacteria 1257
374 Ga0495633_0000843 3300046558 Bacteria 26958
375 Ga0495633_0032145 3300046558 Bacteria 2537
376 Ga0495656_0085258 3300046615 Bacteria 1434
377 Ga0495668_0000013 3300046616 Bacteria 452938
378 Ga0495668_0002023 3300046616 Bacteria 17704
379 Ga0495668_0003911 3300046616 Bacteria 10880
380 Ga0495668_0018768 3300046616 Bacteria 3997
381 Ga0495668_0022554 3300046616 Bacteria 3598
382 Ga0495611_0000461 3300046648 Bacteria 24342
383 Ga0495611_0013144 3300046648 Bacteria 3521
384 Ga0495625_0000321 3300046660 Bacteria 72983
385 Ga0495625_0002402 3300046660 Bacteria 20301
386 Ga0495625_0003785 3300046660 Bacteria 14685
387 Ga0495625_0004272 3300046660 Bacteria 13597
388 Ga0495625_0007729 3300046660 Bacteria 9299
389 Ga0495625_0012111 3300046660 Bacteria 6997
390 Ga0495625_0033261 3300046660 Bacteria 3815
391 Ga0495625_0073339 3300046660 Bacteria 2400
392 Ga0495625_0120658 3300046660 Bacteria 1784
393 Ga0495635_0269439 3300046663 Bacteria 1145
394 Ga0495661_0024159 3300046665 Bacteria 3935
395 Ga0495661_0159553 3300046665 Bacteria 1212
396 Ga0495588_0000052 3300046674 Bacteria 304493
397 Ga0495657_0080587 3300046675 Bacteria 2107
398 Ga0495599_0003450 3300046678 Bacteria 9256
399 Ga0495623_0035720 3300046679 Bacteria 3185
400 Ga0495646_0038449 3300046680 Bacteria 2955
401 Ga0495646_0052155 3300046680 Bacteria 2472
402 Ga0495669_0000023 3300046684 Bacteria 117158
403 Ga0495624_0002214 3300046690 Bacteria 14828
404 Ga0495670_0000423 3300046691 Bacteria 20296
405 Ga0495671_0013006 3300046692 Bacteria 4525
406 Ga0495671_0132465 3300046692 Bacteria 1215
407 Ga0495649_0001618 3300046694 Bacteria 16767
408 Ga0495649_0008739 3300046694 Bacteria 6078
409 Ga0495649_0013693 3300046694 Bacteria 4673
410 Ga0495649_0020614 3300046694 Bacteria 3696
411 Ga0495649_0057574 3300046694 Bacteria 2095
412 Ga0495649_0084329 3300046694 Bacteria 1697
413 Ga0495589_0011859 3300046794 Bacteria 4520
414 Ga0495600_0055261 3300046809 Bacteria 2593
415 Ga0495660_0001780 3300046810 Bacteria 14238
416 Ga0495660_0015469 3300046810 Bacteria 4407
417 Ga0495660_0018256 3300046810 Bacteria 4030
418 Ga0495581_0015925 3300047315 Bacteria 4368
419 Ga0495604_0001624 3300047317 Bacteria 18543
420 Ga0495604_0017630 3300047317 Bacteria 5714
421 Ga0495674_0014788 3300047319 Bacteria 7300
422 Ga0495674_0063285 3300047319 Bacteria 3218
423 Ga0495674_0258442 3300047319 Bacteria 1431
424 Ga0495676_0009886 3300047321 Bacteria 8668
425 Ga0495676_0013460 3300047321 Bacteria 7351
426 Ga0495680_0003071 3300047322 Bacteria 16636
427 Ga0495680_0037415 3300047322 Bacteria 3887
428 Ga0495683_0008563 3300047323 Bacteria 5468
429 Ga0495683_0032485 3300047323 Bacteria 2658
430 Ga0495683_0042074 3300047323 Bacteria 2304
431 Ga0495687_000076 3300047443 Bacteria 149259
432 Ga0495687_000080 3300047443 Bacteria 147467
433 Ga0495675_0080626 3300047444 Bacteria 2050
434 Ga0495677_0000727 3300047445 Bacteria 13285
435 Ga0495677_0009066 3300047445 Bacteria 3679
436 Ga0495679_001065 3300047446 Bacteria 16654
437 Ga0495679_001402 3300047446 Bacteria 13775
438 Ga0495679_002670 3300047446 Bacteria 8934
439 Ga0495679_032553 3300047446 Bacteria 1671
440 Ga0495673_0002456 3300047469 Bacteria 13029
441 Ga0495673_0005602 3300047469 Bacteria 7557
442 Ga0495673_0058369 3300047469 Bacteria 1663
443 Ga0495681_0000193 3300047470 Bacteria 51594
444 Ga0495681_0000399 3300047470 Bacteria 33808
445 Ga0495681_0002038 3300047470 Bacteria 14727
446 Ga0495681_0068972 3300047470 Bacteria 1607
447 Ga0495681_0071737 3300047470 Bacteria 1567
448 Ga0495681_0108147 3300047470 Bacteria 1207
449 Ga0495686_0002385 3300047472 Bacteria 17845
450 Ga0495686_0004991 3300047472 Bacteria 10668
451 Ga0495686_0010477 3300047472 Bacteria 6589
452 Ga0495686_0080179 3300047472 Bacteria 1996
453 Ga0495593_0001284 3300047673 Bacteria 14693
454 Ga0495593_0001825 3300047673 Bacteria 12666
455 Ga0495602_0002338 3300048088 Bacteria 19182
456 Ga0495602_0050876 3300048088 Bacteria 3697
457 Ga0495614_0006627 3300048089 Bacteria 5185
458 Ga0495614_0015130 3300048089 Bacteria 3367
459 Ga0495615_0000331 3300048090 Bacteria 7858
460 Ga0495626_0001319 3300048091 Bacteria 20205
461 Ga0495626_0001856 3300048091 Bacteria 15851
462 Ga0495626_0003340 3300048091 Bacteria 10353
463 Ga0496100_0066192 3300048903 Bacteria 2396
464 Ga0496102_0139130 3300048905 Bacteria 2276
465 Ga0496104_0130283 3300048907 Bacteria 2416
466 Ga0496106_0161094 3300048909 Bacteria 1774
467 Ga0496108_0091990 3300048911 Bacteria 2579
468 Ga0496116_0001963 3300048919 Bacteria 22172
469 Ga0496116_0002731 3300048919 Bacteria 18138
470 Ga0496116_0003365 3300048919 Bacteria 15876
471 Ga0496117_0003450 3300048920 Bacteria 18385
472 Ga0496117_0043760 3300048920 Bacteria 3251
473 Ga0496117_0059367 3300048920 Bacteria 2642
474 Ga0496117_0066010 3300048920 Bacteria 2456
475 Ga0496117_0066012 3300048920 Bacteria 2456
476 Ga0496118_0002940 3300048921 Bacteria 22132
477 Ga0496118_0003912 3300048921 Bacteria 18237
478 Ga0496118_0005723 3300048921 Bacteria 13985
479 Ga0496118_0014720 3300048921 Bacteria 7305
480 Ga0496118_0039760 3300048921 Bacteria 3749
481 Ga0496119_0129374 3300048922 Bacteria 1377
482 Ga0496119_0147422 3300048922 Bacteria 1264
483 Ga0496120_0044973 3300048923 Bacteria 2561
484 Ga0496120_0150847 3300048923 Bacteria 1168
485 Ga0496121_0000245 3300048924 Bacteria 116316
486 Ga0496121_0004887 3300048924 Bacteria 17596
487 Ga0496121_0010584 3300048924 Bacteria 10369
488 Ga0496122_0034514 3300048925 Bacteria 4138
489 Ga0496123_0001983 3300048926 Bacteria 26520
490 Ga0496123_0004425 3300048926 Bacteria 14782
491 Ga0496123_0023910 3300048926 Bacteria 4663
492 Ga0496123_0149660 3300048926 Bacteria 1261
493 Ga0496124_0000428 3300048927 Bacteria 75094
494 Ga0496124_0010991 3300048927 Bacteria 9097
495 Ga0496124_0021151 3300048927 Bacteria 5997
496 Ga0496124_0033977 3300048927 Bacteria 4482
497 Ga0496124_0049940 3300048927 Bacteria 3565
498 Ga0496124_0061134 3300048927 Bacteria 3158
499 Ga0496124_0141966 3300048927 Bacteria 1894
500 Ga0496125_0006812 3300048928 Bacteria 12265
501 Ga0496125_0104242 3300048928 Bacteria 2078
502 Ga0496125_0105544 3300048928 Bacteria 2059
503 Ga0496125_0156193 3300048928 Bacteria 1558
504 Ga0496125_0177568 3300048928 Bacteria 1423
505 Ga0496126_0005254 3300048929 Bacteria 14879
506 Ga0496126_0008958 3300048929 Bacteria 10711
507 Ga0495678_001646 3300049459 Bacteria 16994
508 Ga0495678_003232 3300049459 Bacteria 10216
509 Ga0495678_022694 3300049459 Bacteria 2740
510 Ga0495678_025498 3300049459 Bacteria 2537
511 Ga0495678_037400 3300049459 Bacteria 1972
512 Ga0495678_038043 3300049459 Bacteria 1950
513 Ga0495682_0003730 3300049460 Bacteria 6708
514 Ga0501073_0188068 3300049589 Bacteria 1429
515 Ga0501249_000131 3300049679 Bacteria 23441
516 Ga0501241_000548 3300049758 Bacteria 8073
517 Ga0501268_001146 3300049765 Bacteria 3207
518 Ga0501269_000018 3300049766 Bacteria 56999
519 Ga0501269_000801 3300049766 Bacteria 4896
520 Ga0501273_001729 3300049770 Bacteria 2130
521 Ga0501035_0339190 3300049822 Bacteria 1260
522 nmdc:mga03n38_6223_c1 3300050490 Bacteria 4129
523 nmdc:mga0k408_14143_c1 3300050493 Bacteria 4391
524 nmdc:mga0k408_53396_c1 3300050493 Bacteria 2342
525 nmdc:mga06z11_43598_c1 3300050494 Bacteria 2258
526 nmdc:mga06z11_52688_c1 3300050494 Bacteria 2089
527 nmdc:mga07m45_11144_c2 3300050496 Bacteria 4517
528 nmdc:mga09592_85184_c1 3300050508 Bacteria 2696
529 nmdc:mga0qj67_213502_c1 3300050509 Bacteria 1567
530 nmdc:mga0qj67_29207_c1 3300050509 Bacteria 4282
531 nmdc:mga06r32_96787_c1 3300050510 Bacteria 2891
532 nmdc:mga0n895_266507_c1 3300050512 Bacteria 1738
533 nmdc:mga0sz30_17937_c1 3300050516 Bacteria 2828
534 Ga0500610_0000051 3300053079 Bacteria 36873
535 Ga0500643_000001 3300053087 Bacteria 1440111
536 Ga0500643_004858 3300053087 Bacteria 5934
537 Ga0500583_0118294 3300053092 Bacteria 1310
538 Ga0500566_0024157 3300053094 Bacteria 3570
539 Ga0500654_084534 3300053099 Bacteria 1455
540 Ga0500562_004954 3300053108 Bacteria 3357
541 Ga0500642_0043986 3300053130 Bacteria 1942
542 Ga0500652_000539 3300053131 Bacteria 13320
543 Ga0500559_0000801 3300053136 Bacteria 20557
544 Ga0500559_0027281 3300053136 Bacteria 2437
545 Ga0500568_0003285 3300053139 Bacteria 9121
546 Ga0500568_0003740 3300053139 Bacteria 8334
547 Ga0500568_0098191 3300053139 Bacteria 1100
548 Ga0500586_050715 3300053145 Bacteria 1430
549 Ga0500588_0000167 3300053146 Bacteria 8877
550 Ga0500622_0000260 3300053156 Bacteria 53872
551 Ga0500624_000190 3300053157 Bacteria 24336
552 Ga0500645_000003 3300053730 Bacteria 305887
553 Ga0500596_001962 3300053735 Bacteria 4124

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0296624 Ga0495651_0296624_32_871 247
2 3300046531 Ga0495665_0024120 Ga0495665_0024120_2370_3209 247
3 3300046680 Ga0495646_0038449 Ga0495646_0038449_2038_2877 247
4 3300048924 Ga0496121_0010584 Ga0496121_0010584_18_824 267
5 3300046471 Ga0495650_0073996 Ga0495650_0073996_15_830 270
6 3300046472 Ga0495580_0009790 Ga0495580_0009790_3876_4823 272
7 3300046678 Ga0495599_0003450 Ga0495599_0003450_745_1692 272
8 3300046679 Ga0495623_0035720 Ga0495623_0035720_1372_2319 272
9 3300006051 Ga0075364_10026973 Ga0075364_100269732 278
10 3300047470 Ga0495681_0068972 Ga0495681_0068972_330_1283 278
11 3300049770 Ga0501273_001729 Ga0501273_001729_1281_2120 278
12 3300046492 Ga0495585_0214366 Ga0495585_0214366_12_854 279
13 3300046471 Ga0495650_0001297 Ga0495650_0001297_20_865 280
14 3300046530 Ga0495654_0174537 Ga0495654_0174537_74_919 280
15 3300046459 Ga0495629_0116122 Ga0495629_0116122_829_1776 283
16 3300046463 Ga0495653_0002124 Ga0495653_0002124_5157_6104 283
17 3300046514 Ga0495618_0112054 Ga0495618_0112054_509_1456 283
18 3300046516 Ga0495628_0010034 Ga0495628_0010034_4869_5816 283
19 3300046517 Ga0495630_0003416 Ga0495630_0003416_9128_10075 283
20 3300046533 Ga0495640_0082731 Ga0495640_0082731_480_1427 283
21 3300046663 Ga0495635_0269439 Ga0495635_0269439_24_971 283
22 3300046690 Ga0495624_0002214 Ga0495624_0002214_4869_5816 283
23 3300047317 Ga0495604_0001624 Ga0495604_0001624_9558_10505 283
24 3300047319 Ga0495674_0014788 Ga0495674_0014788_4869_5816 283
25 3300047321 Ga0495676_0009886 Ga0495676_0009886_4978_5925 283
26 3300047322 Ga0495680_0003071 Ga0495680_0003071_10821_11768 283
27 3300047673 Ga0495593_0001284 Ga0495593_0001284_4669_5616 283
28 3300048088 Ga0495602_0002338 Ga0495602_0002338_9172_10119 283
29 3300048089 Ga0495614_0006627 Ga0495614_0006627_98_1045 283
30 3300046694 Ga0495649_0008739 Ga0495649_0008739_348_1301 288
31 3300046471 Ga0495650_0000042 Ga0495650_0000042_115749_116702 290
32 3300046616 Ga0495668_0003911 Ga0495668_0003911_6906_7859 290
33 3300046660 Ga0495625_0000321 Ga0495625_0000321_60717_61670 291
34 3300047443 Ga0495687_000080 Ga0495687_000080_67091_68044 294
35 3300025226 Ga0209674_105302 Ga0209674_1053022 298
36 3300005985 Ga0081539_10002387 Ga0081539_1000238710 299
37 3300046471 Ga0495650_0002183 Ga0495650_0002183_14453_15406 302
38 3300046520 Ga0495637_0000889 Ga0495637_0000889_12404_13357 302
39 3300046530 Ga0495654_0000002 Ga0495654_0000002_139614_140567 302
40 3300048926 Ga0496123_0023910 Ga0496123_0023910_2715_3665 303
41 3300006946 Ga0079104_1014871 Ga0079104_10148712 304
42 3300033442 Ga0315911_1000003 Ga0315911_1000003305 306
43 3300046458 Ga0495591_002824 Ga0495591_002824_6332_7294 306
44 3300005355 Ga0070671_100293753 Ga0070671_1002937531 307
45 3300005843 Ga0068860_100055883 Ga0068860_1000558832 307
46 3300009551 Ga0105238_10204923 Ga0105238_102049232 307
47 3300025931 Ga0207644_10248888 Ga0207644_102488881 307
48 3300026088 Ga0207641_10007038 Ga0207641_100070382 307
49 3300026116 Ga0207674_10283139 Ga0207674_102831392 307
50 3300028381 Ga0268264_10011531 Ga0268264_100115312 307
51 3300049589 Ga0501073_0188068 Ga0501073_0188068_393_1343 307
52 3300053087 Ga0500643_004858 Ga0500643_004858_2652_3608 307
53 3300053157 Ga0500624_000190 Ga0500624_000190_4402_5358 307
54 3300003316 rootH1_10004060 rootH1_100040607 309
55 3300003322 rootL2_10005700 rootL2_1000570031 309
56 3300005985 Ga0081539_10098484 Ga0081539_100984841 309
57 3300048927 Ga0496124_0061134 Ga0496124_0061134_2055_3008 309
58 iso_pu_bacteria 2738541293 2738805513 309
59 iso_pu_bacteria 2841734538 2841735098 310
60 iso_pu_bacteria 2878788777 2878789769 310
61 iso_pu_bacteria 2958071322 2958074467 310
62 iso_pu_bacteria 8004633249 8004639601 310
63 3300046463 Ga0495653_0031525 Ga0495653_0031525_237_1193 311
64 3300046516 Ga0495628_0047526 Ga0495628_0047526_695_1651 311
65 3300046529 Ga0495652_0040507 Ga0495652_0040507_1341_2297 311
66 3300047317 Ga0495604_0017630 Ga0495604_0017630_1347_2303 311
67 3300047319 Ga0495674_0258442 Ga0495674_0258442_282_1238 311
68 3300047321 Ga0495676_0013460 Ga0495676_0013460_3020_3976 311
69 3300047444 Ga0495675_0080626 Ga0495675_0080626_841_1797 311
70 3300048088 Ga0495602_0050876 Ga0495602_0050876_2239_3195 311
71 iso_pu_bacteria 2510917021 2511126805 311
72 iso_pu_bacteria 2513237096 2513657284 311
73 iso_pu_bacteria 2513237137 2513857755 311
74 iso_pu_bacteria 2513237145 2513919292 311
75 iso_pu_bacteria 2517572143 2517891016 311
76 iso_pu_bacteria 2599185359 2600228681 311
77 iso_pu_bacteria 2643221552 2643782322 311
78 iso_pu_bacteria 2643221584 2643929255 311
79 iso_pu_bacteria 2643221622 2644127065 311
80 iso_pu_bacteria 2667528175 2671120067 311
81 iso_pu_bacteria 2721755523 2722883646 311
82 iso_pu_bacteria 2728368998 2728752663 311
83 iso_pu_bacteria 2818991466 2819714521 311
84 iso_pu_bacteria 2839138175 2839138746 311
85 iso_pu_bacteria 2842747753 2842751938 311
86 iso_pu_bacteria 2904541872 2904545217 311
87 iso_pu_bacteria 2906610324 2906616215 311
88 iso_pu_bacteria 2906635258 2906636959 311
89 iso_pu_bacteria 2906660503 2906664447 311
90 iso_pu_bacteria 2928027323 2928027855 311
91 iso_pu_bacteria 2928037797 2928040097 311
92 iso_pu_bacteria 2928044640 2928047154 311
93 iso_pu_bacteria 2928526807 2928529023 311
94 iso_pu_bacteria 2928968154 2928968541 311
95 iso_pu_bacteria 2929160207 2929165394 311
96 iso_pu_bacteria 2935630451 2935635350 311
97 iso_pu_bacteria 2941507105 2941512154 311
98 iso_pu_bacteria 2941515067 2941519856 311
99 iso_pu_bacteria 2941523033 2941527857 311
100 iso_pu_bacteria 2945984333 2945987769 311
101 iso_pu_bacteria 2978969890 2978970174 311
102 iso_pu_bacteria 2984555340 2984558768 311
103 iso_pu_bacteria 2984587000 2984587201 311
104 iso_pu_bacteria 2993356040 2993357914 311
105 iso_pu_bacteria 8054302542 8054306215 311
106 3300025920 Ga0207649_10403143 Ga0207649_104031431 312
107 iso_pu_bacteria 2511231023 2511371762 312
108 iso_pu_bacteria 2643221658 2644329080 312
109 iso_pu_bacteria 2643221664 2644355638 312
110 iso_pu_bacteria 2643221672 2644401828 312
111 iso_pu_bacteria 2842775625 2842776605 312
112 iso_pu_bacteria 2946787523 2946791529 312
113 iso_pu_bacteria 3007614139 3007618417 312
114 iso_pu_bacteria 3007855910 3007857381 312
115 3300038705 Ga0237819_00250 Ga0237819_00250_6979_7923 313
116 iso_pu_bacteria 2511231011 2511294450 313
117 iso_pu_bacteria 2585428057 2587728905 313
118 iso_pu_bacteria 2588253510 2588293089 313
119 iso_pu_bacteria 2599185354 2600201951 313
120 iso_pu_bacteria 2713897148 2715752766 313
121 iso_pu_bacteria 2718217725 2718634622 313
122 iso_pu_bacteria 2773857673 2774134361 313
123 iso_pu_bacteria 2784132063 2784263843 313
124 iso_pu_bacteria 2818991456 2819656647 313
125 iso_pu_bacteria 2842832357 2842836158 313
126 iso_pu_bacteria 2842843487 2842847100 313
127 iso_pu_bacteria 2852657418 2852658066 313
128 iso_pu_bacteria 2880230671 2880234097 313
129 iso_pu_bacteria 2904518522 2904522744 313
130 iso_pu_bacteria 2919385768 2919387467 313
131 iso_pu_bacteria 2919487758 2919492442 313
132 iso_pu_bacteria 2974289157 2974290465 313
133 iso_pu_bacteria 2998139840 2998143386 313
134 iso_pu_bacteria 3007861166 3007862600 313
135 iso_pu_bacteria 8029995093 8029997431 313
136 iso_pu_bacteria 8056166840 8056167828 313
137 iso_pu_bacteria 8056569372 8056570958 313
138 iso_pu_bacteria 8057304971 8057306380 313
139 3300031241 Ga0265325_10140856 Ga0265325_101408562 314
140 3300031456 Ga0307513_10001443 Ga0307513_100014435 314
141 3300046460 Ga0495638_0000528 Ga0495638_0000528_24526_25473 314
142 3300046520 Ga0495637_0003072 Ga0495637_0003072_87_1034 314
143 3300046542 Ga0495597_0092539 Ga0495597_0092539_16_1011 314
144 iso_pu_bacteria 2885429604 2885431002 314
145 3300001989 JGI24739J22299_10005304 JGI24739J22299_100053041 315
146 3300002774 JGI25150J39212_1000766 JGI25150J39212_10007668 315
147 3300003187 JGI25151J46595_10007034 JGI25151J46595_100070342 315
148 3300003203 JGI25406J46586_10000117 JGI25406J46586_1000011714 315
149 3300003354 JGI25160J50197_1007309 JGI25160J50197_10073092 315
150 3300003761 Ga0055535_1003706 Ga0055535_10037063 315
151 3300003762 Ga0055542_1000003 Ga0055542_100000336 315
152 3300003781 Ga0055536_1006686 Ga0055536_10066862 315
153 3300003784 Ga0055534_1004678 Ga0055534_10046782 315
154 3300003791 Ga0055530_10000292 Ga0055530_1000029217 315
155 3300003794 Ga0055531_10028400 Ga0055531_100284002 315
156 3300005262 Ga0065165_1007820 Ga0065165_10078203 315
157 3300005289 Ga0065704_10092405 Ga0065704_100924052 315
158 3300005327 Ga0070658_10121547 Ga0070658_101215472 315
159 3300005340 Ga0070689_100020373 Ga0070689_1000203733 315
160 3300005343 Ga0070687_100002160 Ga0070687_1000021605 315
161 3300005344 Ga0070661_100290586 Ga0070661_1002905862 315
162 3300005353 Ga0070669_100001026 Ga0070669_10000102610 315
163 3300005354 Ga0070675_100003940 Ga0070675_1000039407 315
164 3300005364 Ga0070673_100003883 Ga0070673_1000038834 315
165 3300005365 Ga0070688_100012635 Ga0070688_1000126352 315
166 3300005539 Ga0068853_100003381 Ga0068853_1000033817 315
167 3300005539 Ga0068853_100461093 Ga0068853_1004610931 315
168 3300005543 Ga0070672_100004418 Ga0070672_1000044183 315
169 3300005617 Ga0068859_100001917 Ga0068859_1000019172 315
170 3300005617 Ga0068859_100006701 Ga0068859_1000067018 315
171 3300005719 Ga0068861_100000111 Ga0068861_10000011120 315
172 3300005842 Ga0068858_100328227 Ga0068858_1003282272 315
173 3300005843 Ga0068860_100025171 Ga0068860_1000251713 315
174 3300005844 Ga0068862_100538832 Ga0068862_1005388321 315
175 3300005983 Ga0081540_1000102 Ga0081540_100010281 315
176 3300005985 Ga0081539_10000922 Ga0081539_1000092233 315
177 3300006048 Ga0075363_100002380 Ga0075363_1000023809 315
178 3300006178 Ga0075367_10038008 Ga0075367_100380082 315
179 3300006186 Ga0075369_10011613 Ga0075369_100116132 315
180 3300006195 Ga0075366_10003003 Ga0075366_100030038 315
181 3300006195 Ga0075366_10013861 Ga0075366_100138612 315
182 3300006846 Ga0075430_100023323 Ga0075430_1000233234 315
183 3300006846 Ga0075430_100252785 Ga0075430_1002527851 315
184 3300006871 Ga0075434_100092381 Ga0075434_1000923812 315
185 3300006880 Ga0075429_100043432 Ga0075429_1000434323 315
186 3300006931 Ga0097620_100001917 Ga0097620_1000019172 315
187 3300006931 Ga0097620_100006701 Ga0097620_1000067018 315
188 3300006946 Ga0079104_1000199 Ga0079104_10001995 315
189 3300009036 Ga0105244_10019023 Ga0105244_100190232 315
190 3300009093 Ga0105240_10000215 Ga0105240_1000021522 315
191 3300009093 Ga0105240_10019181 Ga0105240_100191813 315
192 3300009148 Ga0105243_10012113 Ga0105243_100121133 315
193 3300009176 Ga0105242_10001114 Ga0105242_100011145 315
194 3300009177 Ga0105248_10002303 Ga0105248_100023036 315
195 3300009177 Ga0105248_10206643 Ga0105248_102066432 315
196 3300009545 Ga0105237_10021184 Ga0105237_100211845 315
197 3300010375 Ga0105239_10000025 Ga0105239_10000025121 315
198 3300013102 Ga0157371_10057805 Ga0157371_100578052 315
199 3300013104 Ga0157370_10173759 Ga0157370_101737592 315
200 3300013308 Ga0157375_10022255 Ga0157375_100222552 315
201 3300014497 Ga0182008_10012765 Ga0182008_100127653 315
202 3300015262 Ga0182007_10001830 Ga0182007_100018305 315
203 3300017792 Ga0163161_10003979 Ga0163161_100039796 315
204 3300025208 Ga0209436_105330 Ga0209436_1053302 315
205 3300025231 Ga0207427_102500 Ga0207427_1025004 315
206 3300025245 Ga0207425_1000234 Ga0207425_100023411 315
207 3300025253 Ga0209677_101893 Ga0209677_1018933 315
208 3300025258 Ga0209129_1000049 Ga0209129_1000049159 315
209 3300025263 Ga0209565_1002581 Ga0209565_10025816 315
210 3300025263 Ga0209565_1002865 Ga0209565_10028657 315
211 3300025263 Ga0209565_1003209 Ga0209565_10032096 315
212 3300025273 Ga0209673_1000477 Ga0209673_100047745 315
213 3300025273 Ga0209673_1002582 Ga0209673_10025827 315
214 3300025284 Ga0209130_1000267 Ga0209130_100026718 315
215 3300025284 Ga0209130_1001174 Ga0209130_10011747 315
216 3300025284 Ga0209130_1005825 Ga0209130_10058253 315
217 3300025291 Ga0209675_1004739 Ga0209675_10047397 315
218 3300025291 Ga0209675_1004897 Ga0209675_10048972 315
219 3300025291 Ga0209675_1008661 Ga0209675_10086612 315
220 3300025292 Ga0209676_1000065 Ga0209676_100006574 315
221 3300025292 Ga0209676_1000137 Ga0209676_100013724 315
222 3300025294 Ga0209025_1000348 Ga0209025_100034840 315
223 3300025294 Ga0209025_1000481 Ga0209025_100048157 315
224 3300025294 Ga0209025_1011406 Ga0209025_10114062 315
225 3300025295 Ga0209564_1001368 Ga0209564_100136820 315
226 3300025295 Ga0209564_1001413 Ga0209564_10014138 315
227 3300025297 Ga0209758_1000135 Ga0209758_100013518 315
228 3300025298 Ga0209050_1000015 Ga0209050_1000015156 315
229 3300025299 Ga0209256_1000129 Ga0209256_100012918 315
230 3300025299 Ga0209256_1000604 Ga0209256_100060430 315
231 3300025302 Ga0207426_1000171 Ga0207426_100017118 315
232 3300025302 Ga0207426_1000185 Ga0207426_100018518 315
233 3300025303 Ga0209051_1000010 Ga0209051_1000010156 315
234 3300025304 Ga0209257_1000026 Ga0209257_1000026522 315
235 3300025321 Ga0207656_10004778 Ga0207656_100047784 315
236 3300025908 Ga0207643_10003052 Ga0207643_100030524 315
237 3300025913 Ga0207695_10000347 Ga0207695_1000034722 315
238 3300025913 Ga0207695_10232021 Ga0207695_102320212 315
239 3300025918 Ga0207662_10004642 Ga0207662_100046425 315
240 3300025923 Ga0207681_10005041 Ga0207681_100050417 315
241 3300025924 Ga0207694_10122716 Ga0207694_101227162 315
242 3300025925 Ga0207650_10121242 Ga0207650_101212422 315
243 3300025926 Ga0207659_10009901 Ga0207659_100099014 315
244 3300025935 Ga0207709_10000131 Ga0207709_1000013150 315
245 3300025936 Ga0207670_10028975 Ga0207670_100289753 315
246 3300025940 Ga0207691_10003193 Ga0207691_100031939 315
247 3300025941 Ga0207711_10000635 Ga0207711_1000063516 315
248 3300025941 Ga0207711_10070319 Ga0207711_100703192 315
249 3300025960 Ga0207651_10006501 Ga0207651_100065014 315
250 3300025981 Ga0207640_10014688 Ga0207640_100146882 315
251 3300026035 Ga0207703_10275619 Ga0207703_102756192 315
252 3300026041 Ga0207639_10015366 Ga0207639_100153663 315
253 3300026095 Ga0207676_10177470 Ga0207676_101774702 315
254 3300026116 Ga0207674_10088330 Ga0207674_100883303 315
255 3300026118 Ga0207675_100551477 Ga0207675_1005514772 315
256 3300027111 Ga0209281_1000293 Ga0209281_100029313 315
257 3300031731 Ga0307405_10008255 Ga0307405_100082552 315
258 3300031852 Ga0307410_10047139 Ga0307410_100471392 315
259 3300031903 Ga0307407_10024707 Ga0307407_100247072 315
260 3300031911 Ga0307412_10050819 Ga0307412_100508192 315
261 3300031911 Ga0307412_10155506 Ga0307412_101555062 315
262 3300031911 Ga0307412_10217571 Ga0307412_102175711 315
263 3300031995 Ga0307409_100190657 Ga0307409_1001906572 315
264 3300032002 Ga0307416_100007949 Ga0307416_1000079494 315
265 3300032002 Ga0307416_100301217 Ga0307416_1003012172 315
266 3300032004 Ga0307414_10120068 Ga0307414_101200682 315
267 3300032126 Ga0307415_100001785 Ga0307415_1000017852 315
268 3300041410 Ga0439461_0002843 Ga0439461_0002843_134_1084 315
269 3300041997 Ga0439431_0029847 Ga0439431_0029847_348_1298 315
270 3300042014 Ga0439457_006144 Ga0439457_006144_155_1105 315
271 3300042156 Ga0439446_0029909 Ga0439446_0029909_384_1334 315
272 3300042435 Ga0439434_0006465 Ga0439434_0006465_2239_3189 315
273 3300044735 Ga0466968_0042153 Ga0466968_0042153_474_1424 315
274 3300046506 Ga0495583_0044051 Ga0495583_0044051_352_1302 315
275 3300046512 Ga0495610_0000300 Ga0495610_0000300_2458_3408 315
276 3300046522 Ga0495643_0000023 Ga0495643_0000023_211241_212191 315
277 3300046616 Ga0495668_0018768 Ga0495668_0018768_93_1043 315
278 3300046660 Ga0495625_0003785 Ga0495625_0003785_5740_6690 315
279 3300047472 Ga0495686_0010477 Ga0495686_0010477_2189_3139 315
280 3300048090 Ga0495615_0000331 Ga0495615_0000331_1923_2873 315
281 3300048920 Ga0496117_0043760 Ga0496117_0043760_1866_2816 315
282 3300048921 Ga0496118_0005723 Ga0496118_0005723_7360_8310 315
283 3300048924 Ga0496121_0000245 Ga0496121_0000245_38195_39145 315
284 3300048925 Ga0496122_0034514 Ga0496122_0034514_878_1828 315
285 3300048926 Ga0496123_0001983 Ga0496123_0001983_25280_26230 315
286 3300048927 Ga0496124_0000428 Ga0496124_0000428_25603_26553 315
287 3300048927 Ga0496124_0010991 Ga0496124_0010991_6342_7292 315
288 3300048927 Ga0496124_0033977 Ga0496124_0033977_3360_4310 315
289 3300048928 Ga0496125_0006812 Ga0496125_0006812_7690_8640 315
290 3300048928 Ga0496125_0104242 Ga0496125_0104242_608_1558 315
291 3300048928 Ga0496125_0177568 Ga0496125_0177568_188_1138 315
292 3300048929 Ga0496126_0005254 Ga0496126_0005254_1834_2784 315
293 3300048929 Ga0496126_0008958 Ga0496126_0008958_3069_4019 315
294 3300049765 Ga0501268_001146 Ga0501268_001146_1436_2386 315
295 3300049822 Ga0501035_0339190 Ga0501035_0339190_171_1121 315
296 3300050490 nmdc:mga03n38_6223_c1 nmdc:mga03n38_6223_c1_3019_3969 315
297 3300050493 nmdc:mga0k408_14143_c1 nmdc:mga0k408_14143_c1_2410_3360 315
298 3300050493 nmdc:mga0k408_53396_c1 nmdc:mga0k408_53396_c1_134_1084 315
299 3300050494 nmdc:mga06z11_43598_c1 nmdc:mga06z11_43598_c1_54_1004 315
300 3300050494 nmdc:mga06z11_52688_c1 nmdc:mga06z11_52688_c1_742_1692 315
301 3300050508 nmdc:mga09592_85184_c1 nmdc:mga09592_85184_c1_274_1224 315
302 3300050509 nmdc:mga0qj67_213502_c1 nmdc:mga0qj67_213502_c1_503_1453 315
303 3300050509 nmdc:mga0qj67_29207_c1 nmdc:mga0qj67_29207_c1_2294_3244 315
304 3300050510 nmdc:mga06r32_96787_c1 nmdc:mga06r32_96787_c1_884_1834 315
305 3300050512 nmdc:mga0n895_266507_c1 nmdc:mga0n895_266507_c1_105_1055 315
306 3300050516 nmdc:mga0sz30_17937_c1 nmdc:mga0sz30_17937_c1_368_1318 315
307 3300053087 Ga0500643_000001 Ga0500643_000001_1171444_1172394 315
308 3300053094 Ga0500566_0024157 Ga0500566_0024157_2479_3429 315
309 3300053099 Ga0500654_084534 Ga0500654_084534_164_1114 315
310 3300053108 Ga0500562_004954 Ga0500562_004954_1568_2518 315
311 3300053136 Ga0500559_0027281 Ga0500559_0027281_51_1001 315
312 3300053139 Ga0500568_0003285 Ga0500568_0003285_2166_3116 315
313 3300053139 Ga0500568_0098191 Ga0500568_0098191_97_1047 315
314 3300053146 Ga0500588_0000167 Ga0500588_0000167_2525_3475 315
315 3300003215 JGI25153J46596_10000007 JGI25153J46596_10000007187 316
316 3300003322 rootL2_10194570 rootL2_101945701 316
317 3300003791 Ga0055530_10002045 Ga0055530_100020458 316
318 3300003794 Ga0055531_10000792 Ga0055531_1000079224 316
319 3300005328 Ga0070676_10081866 Ga0070676_100818661 316
320 3300005347 Ga0070668_100008374 Ga0070668_1000083742 316
321 3300005353 Ga0070669_100117011 Ga0070669_1001170112 316
322 3300005356 Ga0070674_100000123 Ga0070674_10000012331 316
323 3300005367 Ga0070667_100113364 Ga0070667_1001133642 316
324 3300005564 Ga0070664_100042088 Ga0070664_1000420882 316
325 3300005616 Ga0068852_100025737 Ga0068852_1000257372 316
326 3300005844 Ga0068862_100016259 Ga0068862_1000162595 316
327 3300006058 Ga0075432_10000669 Ga0075432_100006695 316
328 3300006353 Ga0075370_10001294 Ga0075370_100012946 316
329 3300009036 Ga0105244_10000473 Ga0105244_100004737 316
330 3300009148 Ga0105243_10003779 Ga0105243_100037796 316
331 3300011119 Ga0105246_10017860 Ga0105246_100178605 316
332 3300015262 Ga0182007_10003210 Ga0182007_100032109 316
333 3300025254 Ga0209148_1002232 Ga0209148_10022322 316
334 3300025261 Ga0209233_1029575 Ga0209233_10295752 316
335 3300025297 Ga0209758_1000017 Ga0209758_1000017184 316
336 3300025298 Ga0209050_1000071 Ga0209050_10000713 316
337 3300025304 Ga0209257_1000027 Ga0209257_1000027300 316
338 3300025728 Ga0207655_1003447 Ga0207655_100344711 316
339 3300025923 Ga0207681_10107908 Ga0207681_101079082 316
340 3300025933 Ga0207706_10012799 Ga0207706_1001279910 316
341 3300025935 Ga0207709_10007925 Ga0207709_100079254 316
342 3300025937 Ga0207669_10000155 Ga0207669_100001553 316
343 3300025960 Ga0207651_10087041 Ga0207651_100870412 316
344 3300025972 Ga0207668_10000851 Ga0207668_100008516 316
345 3300026116 Ga0207674_10207077 Ga0207674_102070772 316
346 3300026142 Ga0207698_10332766 Ga0207698_103327662 316
347 3300027907 Ga0207428_10043019 Ga0207428_100430192 316
348 3300044658 Ga0466972_0013292 Ga0466972_0013292_1602_2555 316
349 3300044683 Ga0466965_0009568 Ga0466965_0009568_1796_2749 316
350 3300044684 Ga0466966_0019939 Ga0466966_0019939_401_1354 316
351 3300044684 Ga0466966_0063375 Ga0466966_0063375_244_1197 316
352 3300044765 Ga0466970_0166567 Ga0466970_0166567_146_1099 316
353 3300045049 Ga0466959_0049628 Ga0466959_0049628_1904_2857 316
354 3300046452 Ga0495617_008002 Ga0495617_008002_1464_2417 316
355 3300046453 Ga0495627_001298 Ga0495627_001298_1226_2179 316
356 3300046453 Ga0495627_004382 Ga0495627_004382_1891_2844 316
357 3300046458 Ga0495591_006678 Ga0495591_006678_2334_3287 316
358 3300046458 Ga0495591_022618 Ga0495591_022618_860_1813 316
359 3300046460 Ga0495638_0000024 Ga0495638_0000024_10625_11578 316
360 3300046460 Ga0495638_0000667 Ga0495638_0000667_30246_31199 316
361 3300046460 Ga0495638_0002019 Ga0495638_0002019_11020_11973 316
362 3300046460 Ga0495638_0037607 Ga0495638_0037607_1710_2663 316
363 3300046460 Ga0495638_0157421 Ga0495638_0157421_269_1222 316
364 3300046474 Ga0495605_0013274 Ga0495605_0013274_1200_2153 316
365 3300046474 Ga0495605_0017184 Ga0495605_0017184_1085_2038 316
366 3300046491 Ga0495584_0048491 Ga0495584_0048491_635_1588 316
367 3300046491 Ga0495584_0078419 Ga0495584_0078419_227_1180 316
368 3300046491 Ga0495584_0123053 Ga0495584_0123053_197_1150 316
369 3300046492 Ga0495585_0000662 Ga0495585_0000662_6217_7170 316
370 3300046492 Ga0495585_0001580 Ga0495585_0001580_6967_7920 316
371 3300046492 Ga0495585_0001674 Ga0495585_0001674_5072_6025 316
372 3300046492 Ga0495585_0033133 Ga0495585_0033133_879_1832 316
373 3300046500 Ga0495596_0000239 Ga0495596_0000239_27130_28083 316
374 3300046500 Ga0495596_0005161 Ga0495596_0005161_1488_2441 316
375 3300046500 Ga0495596_0014157 Ga0495596_0014157_1386_2339 316
376 3300046501 Ga0495607_0011555 Ga0495607_0011555_3492_4445 316
377 3300046501 Ga0495607_0036654 Ga0495607_0036654_1518_2471 316
378 3300046506 Ga0495583_0009734 Ga0495583_0009734_2671_3624 316
379 3300046506 Ga0495583_0070648 Ga0495583_0070648_228_1181 316
380 3300046507 Ga0495606_0002139 Ga0495606_0002139_17693_18646 316
381 3300046507 Ga0495606_0007259 Ga0495606_0007259_7297_8250 316
382 3300046512 Ga0495610_0002036 Ga0495610_0002036_10043_10996 316
383 3300046512 Ga0495610_0005068 Ga0495610_0005068_63_1016 316
384 3300046513 Ga0495616_0001474 Ga0495616_0001474_13707_14660 316
385 3300046513 Ga0495616_0075802 Ga0495616_0075802_282_1235 316
386 3300046515 Ga0495620_0032809 Ga0495620_0032809_324_1277 316
387 3300046518 Ga0495631_0043116 Ga0495631_0043116_759_1712 316
388 3300046518 Ga0495631_0045295 Ga0495631_0045295_453_1406 316
389 3300046518 Ga0495631_0083442 Ga0495631_0083442_220_1173 316
390 3300046518 Ga0495631_0106991 Ga0495631_0106991_61_1014 316
391 3300046519 Ga0495632_0002599 Ga0495632_0002599_5519_6472 316
392 3300046519 Ga0495632_0005077 Ga0495632_0005077_1324_2277 316
393 3300046519 Ga0495632_0007114 Ga0495632_0007114_5903_6856 316
394 3300046519 Ga0495632_0031056 Ga0495632_0031056_727_1680 316
395 3300046520 Ga0495637_0005709 Ga0495637_0005709_2260_3213 316
396 3300046522 Ga0495643_0000504 Ga0495643_0000504_42417_43370 316
397 3300046522 Ga0495643_0000854 Ga0495643_0000854_15377_16330 316
398 3300046522 Ga0495643_0008470 Ga0495643_0008470_3843_4796 316
399 3300046522 Ga0495643_0027558 Ga0495643_0027558_1062_2015 316
400 3300046522 Ga0495643_0137535 Ga0495643_0137535_61_1014 316
401 3300046524 Ga0495648_0000005 Ga0495648_0000005_10625_11578 316
402 3300046524 Ga0495648_0000132 Ga0495648_0000132_44818_45771 316
403 3300046524 Ga0495648_0006475 Ga0495648_0006475_8147_9100 316
404 3300046528 Ga0495642_0000124 Ga0495642_0000124_32481_33434 316
405 3300046530 Ga0495654_0001496 Ga0495654_0001496_1886_2839 316
406 3300046538 Ga0495609_0023946 Ga0495609_0023946_569_1522 316
407 3300046538 Ga0495609_0055912 Ga0495609_0055912_276_1229 316
408 3300046543 Ga0495645_0225698 Ga0495645_0225698_28_981 316
409 3300046558 Ga0495633_0000843 Ga0495633_0000843_11779_12732 316
410 3300046558 Ga0495633_0032145 Ga0495633_0032145_1225_2178 316
411 3300046616 Ga0495668_0000013 Ga0495668_0000013_307036_307989 316
412 3300046616 Ga0495668_0002023 Ga0495668_0002023_6902_7855 316
413 3300046648 Ga0495611_0013144 Ga0495611_0013144_1821_2774 316
414 3300046660 Ga0495625_0002402 Ga0495625_0002402_18024_18977 316
415 3300046660 Ga0495625_0012111 Ga0495625_0012111_3919_4872 316
416 3300046660 Ga0495625_0033261 Ga0495625_0033261_1071_2024 316
417 3300046660 Ga0495625_0073339 Ga0495625_0073339_996_1949 316
418 3300046660 Ga0495625_0120658 Ga0495625_0120658_138_1091 316
419 3300046665 Ga0495661_0024159 Ga0495661_0024159_1408_2361 316
420 3300046665 Ga0495661_0159553 Ga0495661_0159553_57_1010 316
421 3300046674 Ga0495588_0000052 Ga0495588_0000052_109903_110856 316
422 3300046684 Ga0495669_0000023 Ga0495669_0000023_63750_64703 316
423 3300046692 Ga0495671_0013006 Ga0495671_0013006_3382_4335 316
424 3300046692 Ga0495671_0132465 Ga0495671_0132465_191_1144 316
425 3300046694 Ga0495649_0001618 Ga0495649_0001618_5286_6239 316
426 3300046694 Ga0495649_0020614 Ga0495649_0020614_2471_3424 316
427 3300046694 Ga0495649_0057574 Ga0495649_0057574_500_1453 316
428 3300046694 Ga0495649_0084329 Ga0495649_0084329_205_1158 316
429 3300046810 Ga0495660_0001780 Ga0495660_0001780_6208_7161 316
430 3300046810 Ga0495660_0015469 Ga0495660_0015469_1878_2831 316
431 3300046810 Ga0495660_0018256 Ga0495660_0018256_1057_2010 316
432 3300047323 Ga0495683_0008563 Ga0495683_0008563_1388_2341 316
433 3300047323 Ga0495683_0042074 Ga0495683_0042074_499_1452 316
434 3300047443 Ga0495687_000076 Ga0495687_000076_58700_59653 316
435 3300047445 Ga0495677_0000727 Ga0495677_0000727_12084_13037 316
436 3300047445 Ga0495677_0009066 Ga0495677_0009066_2079_3032 316
437 3300047446 Ga0495679_001065 Ga0495679_001065_1494_2447 316
438 3300047446 Ga0495679_002670 Ga0495679_002670_1313_2266 316
439 3300047469 Ga0495673_0002456 Ga0495673_0002456_10989_11942 316
440 3300047469 Ga0495673_0058369 Ga0495673_0058369_170_1123 316
441 3300047470 Ga0495681_0000193 Ga0495681_0000193_42565_43518 316
442 3300047470 Ga0495681_0108147 Ga0495681_0108147_156_1109 316
443 3300047472 Ga0495686_0002385 Ga0495686_0002385_3172_4125 316
444 3300047472 Ga0495686_0004991 Ga0495686_0004991_8044_8997 316
445 3300048091 Ga0495626_0001319 Ga0495626_0001319_16888_17841 316
446 3300048091 Ga0495626_0001856 Ga0495626_0001856_1757_2710 316
447 3300048091 Ga0495626_0003340 Ga0495626_0003340_3698_4651 316
448 3300048920 Ga0496117_0059367 Ga0496117_0059367_672_1655 316
449 3300048921 Ga0496118_0002940 Ga0496118_0002940_10800_11753 316
450 3300048921 Ga0496118_0039760 Ga0496118_0039760_2332_3315 316
451 3300048926 Ga0496123_0149660 Ga0496123_0149660_286_1239 316
452 3300048927 Ga0496124_0021151 Ga0496124_0021151_3758_4741 316
453 3300048928 Ga0496125_0156193 Ga0496125_0156193_19_1002 316
454 3300049459 Ga0495678_003232 Ga0495678_003232_454_1407 316
455 3300049459 Ga0495678_022694 Ga0495678_022694_1093_2046 316
456 3300049459 Ga0495678_025498 Ga0495678_025498_496_1449 316
457 3300049459 Ga0495678_037400 Ga0495678_037400_722_1675 316
458 3300049766 Ga0501269_000018 Ga0501269_000018_20999_21952 316
459 3300050496 nmdc:mga07m45_11144_c2 nmdc:mga07m45_11144_c2_679_1662 316
460 3300053079 Ga0500610_0000051 Ga0500610_0000051_33572_34525 316
461 3300053092 Ga0500583_0118294 Ga0500583_0118294_190_1143 316
462 3300053130 Ga0500642_0043986 Ga0500642_0043986_351_1304 316
463 3300053131 Ga0500652_000539 Ga0500652_000539_3528_4481 316
464 3300053139 Ga0500568_0003740 Ga0500568_0003740_2009_2962 316
465 3300053145 Ga0500586_050715 Ga0500586_050715_46_999 316
466 3300053156 Ga0500622_0000260 Ga0500622_0000260_11639_12592 316
467 3300053730 Ga0500645_000003 Ga0500645_000003_160628_161581 316
468 3300053735 Ga0500596_001962 Ga0500596_001962_461_1444 316
469 3300002773 JGI25152J39213_1000041 JGI25152J39213_100004111 317
470 3300002774 JGI25150J39212_1000399 JGI25150J39212_100039910 317
471 3300003187 JGI25151J46595_10000141 JGI25151J46595_1000014172 317
472 3300003215 JGI25153J46596_10000106 JGI25153J46596_1000010672 317
473 3300003781 Ga0055536_1000152 Ga0055536_100015210 317
474 3300006946 Ga0079104_1000357 Ga0079104_100035739 317
475 3300009036 Ga0105244_10015018 Ga0105244_100150184 317
476 3300009092 Ga0105250_10001210 Ga0105250_100012107 317
477 3300013100 Ga0157373_10019013 Ga0157373_100190133 317
478 3300013100 Ga0157373_10020187 Ga0157373_100201875 317
479 3300013102 Ga0157371_10109534 Ga0157371_101095342 317
480 3300013105 Ga0157369_10001616 Ga0157369_1000161633 317
481 3300013105 Ga0157369_10002918 Ga0157369_1000291811 317
482 3300013105 Ga0157369_10418692 Ga0157369_104186922 317
483 3300013307 Ga0157372_10007682 Ga0157372_1000768211 317
484 3300014497 Ga0182008_10003319 Ga0182008_100033197 317
485 3300015265 Ga0182005_1014080 Ga0182005_10140802 317
486 3300017792 Ga0163161_10001061 Ga0163161_1000106112 317
487 3300025230 Ga0209563_100523 Ga0209563_1005236 317
488 3300025292 Ga0209676_1000154 Ga0209676_1000154154 317
489 3300025711 Ga0207696_1000002 Ga0207696_1000002170 317
490 3300025728 Ga0207655_1004793 Ga0207655_10047932 317
491 3300025735 Ga0207713_1015091 Ga0207713_10150912 317
492 3300025735 Ga0207713_1015140 Ga0207713_10151402 317
493 3300027111 Ga0209281_1000630 Ga0209281_100063019 317
494 3300027111 Ga0209281_1002110 Ga0209281_10021109 317
495 3300030735 Ga0316178_1089777 Ga0316178_10897775 317
496 3300031548 Ga0307408_100022917 Ga0307408_1000229173 317
497 3300031548 Ga0307408_100129554 Ga0307408_1001295543 317
498 3300031911 Ga0307412_10171313 Ga0307412_101713132 317
499 3300031911 Ga0307412_10223991 Ga0307412_102239912 317
500 3300031995 Ga0307409_100276038 Ga0307409_1002760382 317
501 3300032004 Ga0307414_10034022 Ga0307414_100340222 317
502 3300032004 Ga0307414_10059268 Ga0307414_100592682 317
503 3300032005 Ga0307411_10010201 Ga0307411_100102012 317
504 3300033180 Ga0307510_10002229 Ga0307510_1000222912 317
505 3300041405 Ga0439438_000607 Ga0439438_000607_6061_7017 317
506 3300041405 Ga0439438_000671 Ga0439438_000671_6269_7225 317
507 3300042006 Ga0439432_000803 Ga0439432_000803_10192_11148 317
508 3300042010 Ga0439452_000704 Ga0439452_000704_6474_7430 317
509 3300042013 Ga0439456_000344 Ga0439456_000344_538_1494 317
510 3300042016 Ga0439463_025255 Ga0439463_025255_24_980 317
511 3300042115 Ga0450911_000334 Ga0450911_000334_6284_7240 317
512 3300042136 Ga0450900_000805 Ga0450900_000805_523_1479 317
513 3300042138 Ga0450903_002952 Ga0450903_002952_91_1047 317
514 3300042139 Ga0450904_001444 Ga0450904_001444_2323_3279 317
515 3300042145 Ga0450906_000267 Ga0450906_000267_8904_9860 317
516 3300046452 Ga0495617_007281 Ga0495617_007281_2851_3807 317
517 3300046452 Ga0495617_068358 Ga0495617_068358_119_1075 317
518 3300046453 Ga0495627_000415 Ga0495627_000415_27964_28920 317
519 3300046453 Ga0495627_030538 Ga0495627_030538_366_1322 317
520 3300046457 Ga0495590_0001415 Ga0495590_0001415_2305_3261 317
521 3300046458 Ga0495591_001632 Ga0495591_001632_2742_3698 317
522 3300046458 Ga0495591_050695 Ga0495591_050695_60_1016 317
523 3300046460 Ga0495638_0032020 Ga0495638_0032020_863_1819 317
524 3300046474 Ga0495605_0027957 Ga0495605_0027957_1160_2116 317
525 3300046491 Ga0495584_0003935 Ga0495584_0003935_19_975 317
526 3300046491 Ga0495584_0109622 Ga0495584_0109622_407_1363 317
527 3300046500 Ga0495596_0023431 Ga0495596_0023431_446_1402 317
528 3300046500 Ga0495596_0057177 Ga0495596_0057177_329_1285 317
529 3300046501 Ga0495607_0001249 Ga0495607_0001249_8585_9541 317
530 3300046506 Ga0495583_0005026 Ga0495583_0005026_2153_3109 317
531 3300046507 Ga0495606_0006849 Ga0495606_0006849_7113_8069 317
532 3300046512 Ga0495610_0003361 Ga0495610_0003361_6986_7942 317
533 3300046513 Ga0495616_0000853 Ga0495616_0000853_12586_13542 317
534 3300046513 Ga0495616_0001384 Ga0495616_0001384_6753_7709 317
535 3300046513 Ga0495616_0004044 Ga0495616_0004044_5241_6197 317
536 3300046518 Ga0495631_0000763 Ga0495631_0000763_6837_7793 317
537 3300046519 Ga0495632_0058529 Ga0495632_0058529_822_1778 317
538 3300046520 Ga0495637_0002729 Ga0495637_0002729_32_988 317
539 3300046522 Ga0495643_0010229 Ga0495643_0010229_4008_4964 317
540 3300046523 Ga0495644_0002641 Ga0495644_0002641_6030_6986 317
541 3300046524 Ga0495648_0001417 Ga0495648_0001417_14610_15566 317
542 3300046524 Ga0495648_0015463 Ga0495648_0015463_587_1543 317
543 3300046530 Ga0495654_0004577 Ga0495654_0004577_7128_8084 317
544 3300046538 Ga0495609_0014133 Ga0495609_0014133_2783_3739 317
545 3300046616 Ga0495668_0022554 Ga0495668_0022554_2429_3385 317
546 3300046648 Ga0495611_0000461 Ga0495611_0000461_16235_17191 317
547 3300046660 Ga0495625_0004272 Ga0495625_0004272_7072_8028 317
548 3300046691 Ga0495670_0000423 Ga0495670_0000423_12240_13196 317
549 3300046694 Ga0495649_0013693 Ga0495649_0013693_3643_4599 317
550 3300046794 Ga0495589_0011859 Ga0495589_0011859_2776_3732 317
551 3300047446 Ga0495679_001402 Ga0495679_001402_6792_7748 317
552 3300047469 Ga0495673_0005602 Ga0495673_0005602_118_1074 317
553 3300047470 Ga0495681_0000399 Ga0495681_0000399_8380_9336 317
554 3300047470 Ga0495681_0002038 Ga0495681_0002038_6761_7717 317
555 3300047472 Ga0495686_0080179 Ga0495686_0080179_45_1001 317
556 3300048909 Ga0496106_0161094 Ga0496106_0161094_112_1068 317
557 3300048919 Ga0496116_0001963 Ga0496116_0001963_8534_9490 317
558 3300048919 Ga0496116_0002731 Ga0496116_0002731_7758_8714 317
559 3300048919 Ga0496116_0003365 Ga0496116_0003365_8224_9180 317
560 3300048920 Ga0496117_0003450 Ga0496117_0003450_9567_10523 317
561 3300048920 Ga0496117_0066010 Ga0496117_0066010_99_1055 317
562 3300048920 Ga0496117_0066012 Ga0496117_0066012_99_1055 317
563 3300048921 Ga0496118_0003912 Ga0496118_0003912_9395_10351 317
564 3300048921 Ga0496118_0014720 Ga0496118_0014720_5610_6566 317
565 3300048922 Ga0496119_0129374 Ga0496119_0129374_223_1179 317
566 3300048922 Ga0496119_0147422 Ga0496119_0147422_223_1179 317
567 3300048923 Ga0496120_0044973 Ga0496120_0044973_1033_1989 317
568 3300048923 Ga0496120_0150847 Ga0496120_0150847_49_1005 317
569 3300048924 Ga0496121_0004887 Ga0496121_0004887_8445_9401 317
570 3300048926 Ga0496123_0004425 Ga0496123_0004425_5160_6116 317
571 3300048927 Ga0496124_0049940 Ga0496124_0049940_2526_3482 317
572 3300048928 Ga0496125_0105544 Ga0496125_0105544_352_1308 317
573 3300049459 Ga0495678_001646 Ga0495678_001646_6775_7731 317
574 3300049459 Ga0495678_038043 Ga0495678_038043_51_1007 317
575 3300049460 Ga0495682_0003730 Ga0495682_0003730_37_993 317
576 3300049758 Ga0501241_000548 Ga0501241_000548_6268_7224 317
577 3300053136 Ga0500559_0000801 Ga0500559_0000801_11390_12346 317
578 2162886007 SwRhRL2b_contig_351495 SwRhRL2b_0752.00006830 318
579 3300003794 Ga0055531_10001376 Ga0055531_1000137612 318
580 3300005614 Ga0068856_100006764 Ga0068856_1000067642 318
581 3300012497 Ga0157319_1000024 Ga0157319_100002457 318
582 3300015690 Ga0183363_1001 Ga0183363_1001183 318
583 3300025299 Ga0209256_1000075 Ga0209256_100007580 318
584 3300025304 Ga0209257_1000244 Ga0209257_100024471 318
585 3300042127 Ga0450890_005181 Ga0450890_005181_628_1596 318
586 3300046455 Ga0495603_0020632 Ga0495603_0020632_1778_2737 318
587 3300046459 Ga0495629_0035886 Ga0495629_0035886_1769_2728 318
588 3300046459 Ga0495629_0070388 Ga0495629_0070388_911_1870 318
589 3300046462 Ga0495651_0081247 Ga0495651_0081247_985_1944 318
590 3300046471 Ga0495650_0017013 Ga0495650_0017013_911_1870 318
591 3300046471 Ga0495650_0018859 Ga0495650_0018859_1492_2451 318
592 3300046473 Ga0495582_0057168 Ga0495582_0057168_387_1346 318
593 3300046475 Ga0495639_0006701 Ga0495639_0006701_3488_4447 318
594 3300046477 Ga0495664_0008429 Ga0495664_0008429_3339_4298 318
595 3300046477 Ga0495664_0023769 Ga0495664_0023769_821_1780 318
596 3300046499 Ga0495594_0081438 Ga0495594_0081438_174_1133 318
597 3300046500 Ga0495596_0049873 Ga0495596_0049873_190_1149 318
598 3300046506 Ga0495583_0067590 Ga0495583_0067590_290_1249 318
599 3300046528 Ga0495642_0008925 Ga0495642_0008925_1901_2860 318
600 3300046528 Ga0495642_0030372 Ga0495642_0030372_533_1492 318
601 3300046529 Ga0495652_0094318 Ga0495652_0094318_1302_2261 318
602 3300046530 Ga0495654_0019265 Ga0495654_0019265_541_1509 318
603 3300046531 Ga0495665_0045911 Ga0495665_0045911_387_1346 318
604 3300046535 Ga0495586_0021869 Ga0495586_0021869_1436_2395 318
605 3300046543 Ga0495645_0025923 Ga0495645_0025923_1355_2314 318
606 3300046615 Ga0495656_0085258 Ga0495656_0085258_367_1326 318
607 3300046660 Ga0495625_0007729 Ga0495625_0007729_8194_9153 318
608 3300046675 Ga0495657_0080587 Ga0495657_0080587_108_1067 318
609 3300046680 Ga0495646_0052155 Ga0495646_0052155_1466_2425 318
610 3300046809 Ga0495600_0055261 Ga0495600_0055261_888_1847 318
611 3300047315 Ga0495581_0015925 Ga0495581_0015925_1934_2893 318
612 3300047319 Ga0495674_0063285 Ga0495674_0063285_1264_2223 318
613 3300047322 Ga0495680_0037415 Ga0495680_0037415_606_1565 318
614 3300047323 Ga0495683_0032485 Ga0495683_0032485_1052_2011 318
615 3300047446 Ga0495679_032553 Ga0495679_032553_299_1258 318
616 3300047470 Ga0495681_0071737 Ga0495681_0071737_219_1178 318
617 3300047673 Ga0495593_0001825 Ga0495593_0001825_8111_9070 318
618 3300048089 Ga0495614_0015130 Ga0495614_0015130_198_1157 318
619 3300048903 Ga0496100_0066192 Ga0496100_0066192_1334_2293 318
620 3300048905 Ga0496102_0139130 Ga0496102_0139130_795_1754 318
621 3300048907 Ga0496104_0130283 Ga0496104_0130283_640_1599 318
622 3300048911 Ga0496108_0091990 Ga0496108_0091990_1187_2146 318
623 3300048927 Ga0496124_0141966 Ga0496124_0141966_131_1090 318
624 3300049679 Ga0501249_000131 Ga0501249_000131_1812_2771 318
625 3300049766 Ga0501269_000801 Ga0501269_000801_123_1082 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

2

221

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

226

320

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5h-assembly1.cif.gz_B escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9057 1 314
5g5h-assembly1.cif.gz_B escherichia coli periplasmic aldehyde oxidase r440h mutant 0.8975 1 314
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.8277 1 318
5y6q-assembly1.cif.gz_B crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.8253 1 318
4zoh-assembly1.cif.gz_B-2 crystal structure of glyceraldehyde oxidoreductase 0.7995 2 313
ID Description Score Start End Superfamily
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9681 1 53 3.30.43.10
af_P77324_1_53_3.30.43.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9505 1 53 3.30.43.10
1ffuF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9175 2 51 3.30.43.10
1t3qF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.915 2 51 3.30.43.10
5g5hB02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.91 223 314 3.30.390.50
ID Description Score Start End GO Terms
AF-F0BL63-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein 0.9485 165 314 GO:0016491
GO:0050660
AF-J1SLT6-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein 0.9334 141 314 GO:0016491
GO:0050660
AF-F0BL63-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein 0.9302 165 314 GO:0016491
GO:0050660
AF-J1SLT6-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein 0.9179 141 314 GO:0016491
GO:0050660
AF-F0BL62-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein 0.9148 1 102 GO:0016491
GO:0071949

Feature Viewer

pLDDT pTM Quality
85.35 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map