F470391
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 625 | 371 | 553 | 314 |
Family's Representative Sequence
| Representative Sequence | 3300046542|Ga0495597_0092539|Ga0495597_0092539_16_1011 |
| Length | 331 |
| Sequence | MKAFTYERAKDPVGAARAVAGQPGAKFLAGGTNLLDLMKLQIETPVHLVDVQDIGLARIEPTADGGLRIGALVTNTDLASDRRVRRDYGVLSRAIVAGASGQLRNKATTAGNLLQRTRCPYFYDPNMPCNKRKPGSGCSAIGGFSRQLAVVGSSDHCIATNPSDMAVALRVLDATVETVKPDGSSRAIPIAEFHRLPGDTPHVETVLTPGELITGVTLPKPIGGFHHYEKVRDRASYAFALVSVAAVIQKDGSGRVALGGVAHKPWRIEEAEELLTGQPASEAAFEQAAERILRGARGHGQNDFKIPLAKNAIIQALTNAARKNELRGDKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 4 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 5 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 9 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 10 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 11 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 12 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 13 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 14 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 15 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 16 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 17 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 18 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 19 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 20 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 21 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 22 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 23 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 24 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 25 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 26 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 27 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 28 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 29 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 30 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 31 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 32 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 33 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 34 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 35 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 36 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 37 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 38 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 39 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 40 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 41 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 42 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 43 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 44 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 45 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 46 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 47 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 48 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 49 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 50 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 51 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 52 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 53 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 54 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 55 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 56 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 57 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 58 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 59 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 60 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 61 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 62 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 63 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 64 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 65 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 66 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 67 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 68 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 69 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 70 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 71 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 73 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 74 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 75 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 76 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 79 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 83 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 87 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 102 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 121 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 212 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 213 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 214 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 217 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 218 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 219 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 220 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 221 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 222 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 223 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 224 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 225 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 226 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 227 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 228 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 229 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 230 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 231 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 232 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 337 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 338 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 352 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 353 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 356 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 357 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 358 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 359 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 361 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 362 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 363 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 364 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 365 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 366 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 367 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 368 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 369 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 370 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 371 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.62 |
| Metatranscriptomes | 0 |
| Isolates | 11.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.48 |
| Bulb | 0 |
| Endosphere | 15.04 |
| Nodule | 3.52 |
| Rhizoplane | 1.28 |
| Rhizosphere | 67.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_351495 | 2162886007 | Bacteria | 17555 |
| 2 | JGI24739J22299_10005304 | 3300001989 | Bacteria | 4909 |
| 3 | JGI25152J39213_1000041 | 3300002773 | Bacteria | 88071 |
| 4 | JGI25150J39212_1000399 | 3300002774 | Bacteria | 20346 |
| 5 | JGI25150J39212_1000766 | 3300002774 | Bacteria | 11091 |
| 6 | JGI25151J46595_10000141 | 3300003187 | Bacteria | 95351 |
| 7 | JGI25151J46595_10007034 | 3300003187 | Bacteria | 5566 |
| 8 | JGI25406J46586_10000117 | 3300003203 | Bacteria | 34556 |
| 9 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 10 | JGI25153J46596_10000106 | 3300003215 | Bacteria | 95351 |
| 11 | rootH1_10004060 | 3300003316 | Bacteria | 9447 |
| 12 | rootL2_10005700 | 3300003322 | Bacteria | 43298 |
| 13 | rootL2_10194570 | 3300003322 | Bacteria | 2953 |
| 14 | JGI25160J50197_1007309 | 3300003354 | Bacteria | 4342 |
| 15 | Ga0055535_1003706 | 3300003761 | Bacteria | 4124 |
| 16 | Ga0055542_1000003 | 3300003762 | Bacteria | 582721 |
| 17 | Ga0055536_1000152 | 3300003781 | Bacteria | 59461 |
| 18 | Ga0055536_1006686 | 3300003781 | Bacteria | 5303 |
| 19 | Ga0055534_1004678 | 3300003784 | Bacteria | 3878 |
| 20 | Ga0055530_10000292 | 3300003791 | Bacteria | 45623 |
| 21 | Ga0055530_10002045 | 3300003791 | Bacteria | 13586 |
| 22 | Ga0055531_10000792 | 3300003794 | Bacteria | 26275 |
| 23 | Ga0055531_10001376 | 3300003794 | Bacteria | 18057 |
| 24 | Ga0055531_10028400 | 3300003794 | Bacteria | 1930 |
| 25 | Ga0065165_1007820 | 3300005262 | Bacteria | 5146 |
| 26 | Ga0065704_10092405 | 3300005289 | Bacteria | 2656 |
| 27 | Ga0070658_10121547 | 3300005327 | Bacteria | 2170 |
| 28 | Ga0070676_10081866 | 3300005328 | Bacteria | 1960 |
| 29 | Ga0070689_100020373 | 3300005340 | Bacteria | 4919 |
| 30 | Ga0070687_100002160 | 3300005343 | Bacteria | 7276 |
| 31 | Ga0070661_100290586 | 3300005344 | Bacteria | 1270 |
| 32 | Ga0070668_100008374 | 3300005347 | Bacteria | 7680 |
| 33 | Ga0070669_100001026 | 3300005353 | Bacteria | 20337 |
| 34 | Ga0070669_100117011 | 3300005353 | Bacteria | 2029 |
| 35 | Ga0070675_100003940 | 3300005354 | Bacteria | 11251 |
| 36 | Ga0070671_100293753 | 3300005355 | Bacteria | 1383 |
| 37 | Ga0070674_100000123 | 3300005356 | Bacteria | 35400 |
| 38 | Ga0070673_100003883 | 3300005364 | Bacteria | 9391 |
| 39 | Ga0070688_100012635 | 3300005365 | Bacteria | 4736 |
| 40 | Ga0070667_100113364 | 3300005367 | Bacteria | 2353 |
| 41 | Ga0068853_100003381 | 3300005539 | Bacteria | 12217 |
| 42 | Ga0068853_100461093 | 3300005539 | Bacteria | 1196 |
| 43 | Ga0070672_100004418 | 3300005543 | Bacteria | 9199 |
| 44 | Ga0070664_100042088 | 3300005564 | Bacteria | 3857 |
| 45 | Ga0068856_100006764 | 3300005614 | Bacteria | 11225 |
| 46 | Ga0068852_100025737 | 3300005616 | Bacteria | 4772 |
| 47 | Ga0068859_100001917 | 3300005617 | Bacteria | 21221 |
| 48 | Ga0068859_100006701 | 3300005617 | Bacteria | 11698 |
| 49 | Ga0068861_100000111 | 3300005719 | Bacteria | 41057 |
| 50 | Ga0068858_100328227 | 3300005842 | Bacteria | 1463 |
| 51 | Ga0068860_100025171 | 3300005843 | Bacteria | 5743 |
| 52 | Ga0068860_100055883 | 3300005843 | Bacteria | 3753 |
| 53 | Ga0068862_100016259 | 3300005844 | Bacteria | 6192 |
| 54 | Ga0068862_100538832 | 3300005844 | Bacteria | 1113 |
| 55 | Ga0081540_1000102 | 3300005983 | Bacteria | 91311 |
| 56 | Ga0081539_10000922 | 3300005985 | Bacteria | 55364 |
| 57 | Ga0081539_10002387 | 3300005985 | Bacteria | 26756 |
| 58 | Ga0081539_10098484 | 3300005985 | Bacteria | 1495 |
| 59 | Ga0075363_100002380 | 3300006048 | Bacteria | 7662 |
| 60 | Ga0075364_10026973 | 3300006051 | Bacteria | 3667 |
| 61 | Ga0075432_10000669 | 3300006058 | Bacteria | 10529 |
| 62 | Ga0075367_10038008 | 3300006178 | Bacteria | 2800 |
| 63 | Ga0075369_10011613 | 3300006186 | Bacteria | 3467 |
| 64 | Ga0075366_10003003 | 3300006195 | Bacteria | 8797 |
| 65 | Ga0075366_10013861 | 3300006195 | Bacteria | 4595 |
| 66 | Ga0075370_10001294 | 3300006353 | Bacteria | 10693 |
| 67 | Ga0075430_100023323 | 3300006846 | Bacteria | 5266 |
| 68 | Ga0075430_100252785 | 3300006846 | Bacteria | 1460 |
| 69 | Ga0075434_100092381 | 3300006871 | Bacteria | 3029 |
| 70 | Ga0075429_100043432 | 3300006880 | Bacteria | 3912 |
| 71 | Ga0097620_100001917 | 3300006931 | Bacteria | 21221 |
| 72 | Ga0097620_100006701 | 3300006931 | Bacteria | 11698 |
| 73 | Ga0079104_1000199 | 3300006946 | Bacteria | 84282 |
| 74 | Ga0079104_1000357 | 3300006946 | Bacteria | 55345 |
| 75 | Ga0079104_1014871 | 3300006946 | Bacteria | 2331 |
| 76 | Ga0105244_10000473 | 3300009036 | Bacteria | 36586 |
| 77 | Ga0105244_10015018 | 3300009036 | Bacteria | 4454 |
| 78 | Ga0105244_10019023 | 3300009036 | Bacteria | 3843 |
| 79 | Ga0105250_10001210 | 3300009092 | Bacteria | 14355 |
| 80 | Ga0105240_10000215 | 3300009093 | Bacteria | 115967 |
| 81 | Ga0105240_10019181 | 3300009093 | Bacteria | 9143 |
| 82 | Ga0105243_10003779 | 3300009148 | Bacteria | 12132 |
| 83 | Ga0105243_10012113 | 3300009148 | Bacteria | 6520 |
| 84 | Ga0105242_10001114 | 3300009176 | Bacteria | 21176 |
| 85 | Ga0105248_10002303 | 3300009177 | Bacteria | 21145 |
| 86 | Ga0105248_10206643 | 3300009177 | Bacteria | 2212 |
| 87 | Ga0105237_10021184 | 3300009545 | Bacteria | 6686 |
| 88 | Ga0105238_10204923 | 3300009551 | Bacteria | 1948 |
| 89 | Ga0105239_10000025 | 3300010375 | Bacteria | 254049 |
| 90 | Ga0105246_10017860 | 3300011119 | Bacteria | 4513 |
| 91 | Ga0157319_1000024 | 3300012497 | Bacteria | 65569 |
| 92 | Ga0157373_10019013 | 3300013100 | Bacteria | 5000 |
| 93 | Ga0157373_10020187 | 3300013100 | Bacteria | 4846 |
| 94 | Ga0157371_10057805 | 3300013102 | Bacteria | 2751 |
| 95 | Ga0157371_10109534 | 3300013102 | Bacteria | 1960 |
| 96 | Ga0157370_10173759 | 3300013104 | Bacteria | 2002 |
| 97 | Ga0157369_10001616 | 3300013105 | Bacteria | 27583 |
| 98 | Ga0157369_10002918 | 3300013105 | Bacteria | 20446 |
| 99 | Ga0157369_10418692 | 3300013105 | Bacteria | 1389 |
| 100 | Ga0157372_10007682 | 3300013307 | Bacteria | 11470 |
| 101 | Ga0157375_10022255 | 3300013308 | Bacteria | 5832 |
| 102 | Ga0182008_10003319 | 3300014497 | Bacteria | 9781 |
| 103 | Ga0182008_10012765 | 3300014497 | Bacteria | 4428 |
| 104 | Ga0182007_10001830 | 3300015262 | Bacteria | 11091 |
| 105 | Ga0182007_10003210 | 3300015262 | Bacteria | 7792 |
| 106 | Ga0182005_1014080 | 3300015265 | Bacteria | 2243 |
| 107 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 108 | Ga0163161_10001061 | 3300017792 | Bacteria | 20821 |
| 109 | Ga0163161_10003979 | 3300017792 | Bacteria | 10350 |
| 110 | Ga0209436_105330 | 3300025208 | Bacteria | 2980 |
| 111 | Ga0209674_105302 | 3300025226 | Bacteria | 1931 |
| 112 | Ga0209563_100523 | 3300025230 | Bacteria | 13015 |
| 113 | Ga0207427_102500 | 3300025231 | Bacteria | 4885 |
| 114 | Ga0207425_1000234 | 3300025245 | Bacteria | 42951 |
| 115 | Ga0209677_101893 | 3300025253 | Bacteria | 8450 |
| 116 | Ga0209148_1002232 | 3300025254 | Bacteria | 7083 |
| 117 | Ga0209129_1000049 | 3300025258 | Bacteria | 268086 |
| 118 | Ga0209233_1029575 | 3300025261 | Bacteria | 1301 |
| 119 | Ga0209565_1002581 | 3300025263 | Bacteria | 6428 |
| 120 | Ga0209565_1002865 | 3300025263 | Bacteria | 5925 |
| 121 | Ga0209565_1003209 | 3300025263 | Bacteria | 5413 |
| 122 | Ga0209673_1000477 | 3300025273 | Bacteria | 66849 |
| 123 | Ga0209673_1002582 | 3300025273 | Bacteria | 12261 |
| 124 | Ga0209130_1000267 | 3300025284 | Bacteria | 65435 |
| 125 | Ga0209130_1001174 | 3300025284 | Bacteria | 18812 |
| 126 | Ga0209130_1005825 | 3300025284 | Bacteria | 4161 |
| 127 | Ga0209675_1004739 | 3300025291 | Bacteria | 5925 |
| 128 | Ga0209675_1004897 | 3300025291 | Bacteria | 5781 |
| 129 | Ga0209675_1008661 | 3300025291 | Bacteria | 3701 |
| 130 | Ga0209676_1000065 | 3300025292 | Bacteria | 318605 |
| 131 | Ga0209676_1000137 | 3300025292 | Bacteria | 179437 |
| 132 | Ga0209676_1000154 | 3300025292 | Bacteria | 166013 |
| 133 | Ga0209025_1000348 | 3300025294 | Bacteria | 100228 |
| 134 | Ga0209025_1000481 | 3300025294 | Bacteria | 77405 |
| 135 | Ga0209025_1011406 | 3300025294 | Bacteria | 5860 |
| 136 | Ga0209564_1001368 | 3300025295 | Bacteria | 25567 |
| 137 | Ga0209564_1001413 | 3300025295 | Bacteria | 24762 |
| 138 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 139 | Ga0209758_1000135 | 3300025297 | Bacteria | 177753 |
| 140 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 141 | Ga0209050_1000071 | 3300025298 | Bacteria | 295478 |
| 142 | Ga0209256_1000075 | 3300025299 | Bacteria | 236149 |
| 143 | Ga0209256_1000129 | 3300025299 | Bacteria | 163766 |
| 144 | Ga0209256_1000604 | 3300025299 | Bacteria | 49837 |
| 145 | Ga0207426_1000171 | 3300025302 | Bacteria | 163766 |
| 146 | Ga0207426_1000185 | 3300025302 | Bacteria | 154146 |
| 147 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 148 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 149 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 150 | Ga0209257_1000244 | 3300025304 | Bacteria | 126098 |
| 151 | Ga0207656_10004778 | 3300025321 | Bacteria | 4755 |
| 152 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 153 | Ga0207655_1003447 | 3300025728 | Bacteria | 11763 |
| 154 | Ga0207655_1004793 | 3300025728 | Bacteria | 9428 |
| 155 | Ga0207713_1015091 | 3300025735 | Bacteria | 3982 |
| 156 | Ga0207713_1015140 | 3300025735 | Bacteria | 3972 |
| 157 | Ga0207643_10003052 | 3300025908 | Bacteria | 9000 |
| 158 | Ga0207695_10000347 | 3300025913 | Bacteria | 107013 |
| 159 | Ga0207695_10232021 | 3300025913 | Bacteria | 1749 |
| 160 | Ga0207662_10004642 | 3300025918 | Bacteria | 7248 |
| 161 | Ga0207649_10403143 | 3300025920 | Bacteria | 1024 |
| 162 | Ga0207681_10005041 | 3300025923 | Bacteria | 8120 |
| 163 | Ga0207681_10107908 | 3300025923 | Bacteria | 2020 |
| 164 | Ga0207694_10122716 | 3300025924 | Bacteria | 2075 |
| 165 | Ga0207650_10121242 | 3300025925 | Bacteria | 2036 |
| 166 | Ga0207659_10009901 | 3300025926 | Bacteria | 5965 |
| 167 | Ga0207644_10248888 | 3300025931 | Bacteria | 1417 |
| 168 | Ga0207706_10012799 | 3300025933 | Bacteria | 7634 |
| 169 | Ga0207709_10000131 | 3300025935 | Bacteria | 109649 |
| 170 | Ga0207709_10007925 | 3300025935 | Bacteria | 5886 |
| 171 | Ga0207670_10028975 | 3300025936 | Bacteria | 3521 |
| 172 | Ga0207669_10000155 | 3300025937 | Bacteria | 32382 |
| 173 | Ga0207691_10003193 | 3300025940 | Bacteria | 16012 |
| 174 | Ga0207711_10000635 | 3300025941 | Bacteria | 35316 |
| 175 | Ga0207711_10070319 | 3300025941 | Bacteria | 3035 |
| 176 | Ga0207651_10006501 | 3300025960 | Bacteria | 6129 |
| 177 | Ga0207651_10087041 | 3300025960 | Bacteria | 2273 |
| 178 | Ga0207668_10000851 | 3300025972 | Bacteria | 18409 |
| 179 | Ga0207640_10014688 | 3300025981 | Bacteria | 4513 |
| 180 | Ga0207703_10275619 | 3300026035 | Bacteria | 1526 |
| 181 | Ga0207639_10015366 | 3300026041 | Bacteria | 5401 |
| 182 | Ga0207641_10007038 | 3300026088 | Bacteria | 9399 |
| 183 | Ga0207676_10177470 | 3300026095 | Bacteria | 1862 |
| 184 | Ga0207674_10088330 | 3300026116 | Bacteria | 3093 |
| 185 | Ga0207674_10207077 | 3300026116 | Bacteria | 1911 |
| 186 | Ga0207674_10283139 | 3300026116 | Bacteria | 1606 |
| 187 | Ga0207675_100551477 | 3300026118 | Bacteria | 1152 |
| 188 | Ga0207698_10332766 | 3300026142 | Bacteria | 1427 |
| 189 | Ga0209281_1000293 | 3300027111 | Bacteria | 91386 |
| 190 | Ga0209281_1000630 | 3300027111 | Bacteria | 39048 |
| 191 | Ga0209281_1002110 | 3300027111 | Bacteria | 8835 |
| 192 | Ga0207428_10043019 | 3300027907 | Bacteria | 3650 |
| 193 | Ga0268264_10011531 | 3300028381 | Bacteria | 7302 |
| 194 | Ga0316178_1089777 | 3300030735 | Bacteria | 12509 |
| 195 | Ga0265325_10140856 | 3300031241 | Bacteria | 1147 |
| 196 | Ga0307513_10001443 | 3300031456 | Bacteria | 34174 |
| 197 | Ga0307408_100022917 | 3300031548 | Bacteria | 4249 |
| 198 | Ga0307408_100129554 | 3300031548 | Bacteria | 1966 |
| 199 | Ga0307405_10008255 | 3300031731 | Bacteria | 5267 |
| 200 | Ga0307410_10047139 | 3300031852 | Bacteria | 2878 |
| 201 | Ga0307407_10024707 | 3300031903 | Bacteria | 3155 |
| 202 | Ga0307412_10050819 | 3300031911 | Bacteria | 2737 |
| 203 | Ga0307412_10155506 | 3300031911 | Bacteria | 1692 |
| 204 | Ga0307412_10171313 | 3300031911 | Bacteria | 1623 |
| 205 | Ga0307412_10217571 | 3300031911 | Bacteria | 1462 |
| 206 | Ga0307412_10223991 | 3300031911 | Bacteria | 1443 |
| 207 | Ga0307409_100190657 | 3300031995 | Bacteria | 1824 |
| 208 | Ga0307409_100276038 | 3300031995 | Bacteria | 1551 |
| 209 | Ga0307416_100007949 | 3300032002 | Bacteria | 6792 |
| 210 | Ga0307416_100301217 | 3300032002 | Bacteria | 1593 |
| 211 | Ga0307414_10034022 | 3300032004 | Bacteria | 3374 |
| 212 | Ga0307414_10059268 | 3300032004 | Bacteria | 2702 |
| 213 | Ga0307414_10120068 | 3300032004 | Bacteria | 2019 |
| 214 | Ga0307411_10010201 | 3300032005 | Bacteria | 4994 |
| 215 | Ga0307415_100001785 | 3300032126 | Bacteria | 10533 |
| 216 | Ga0307510_10002229 | 3300033180 | Bacteria | 21900 |
| 217 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 218 | Ga0237819_00250 | 3300038705 | Bacteria | 19601 |
| 219 | Ga0439438_000607 | 3300041405 | Bacteria | 16142 |
| 220 | Ga0439438_000671 | 3300041405 | Bacteria | 15357 |
| 221 | Ga0439461_0002843 | 3300041410 | Bacteria | 2801 |
| 222 | Ga0439431_0029847 | 3300041997 | Bacteria | 1348 |
| 223 | Ga0439432_000803 | 3300042006 | Bacteria | 11725 |
| 224 | Ga0439452_000704 | 3300042010 | Bacteria | 16375 |
| 225 | Ga0439456_000344 | 3300042013 | Bacteria | 10452 |
| 226 | Ga0439457_006144 | 3300042014 | Bacteria | 2963 |
| 227 | Ga0439463_025255 | 3300042016 | Bacteria | 1490 |
| 228 | Ga0450911_000334 | 3300042115 | Bacteria | 16854 |
| 229 | Ga0450890_005181 | 3300042127 | Bacteria | 1680 |
| 230 | Ga0450900_000805 | 3300042136 | Bacteria | 2738 |
| 231 | Ga0450903_002952 | 3300042138 | Bacteria | 2970 |
| 232 | Ga0450904_001444 | 3300042139 | Bacteria | 3346 |
| 233 | Ga0450906_000267 | 3300042145 | Bacteria | 10195 |
| 234 | Ga0439446_0029909 | 3300042156 | Bacteria | 1573 |
| 235 | Ga0439434_0006465 | 3300042435 | Bacteria | 3424 |
| 236 | Ga0466972_0013292 | 3300044658 | Bacteria | 4133 |
| 237 | Ga0466965_0009568 | 3300044683 | Bacteria | 4505 |
| 238 | Ga0466966_0019939 | 3300044684 | Bacteria | 4410 |
| 239 | Ga0466966_0063375 | 3300044684 | Bacteria | 2329 |
| 240 | Ga0466968_0042153 | 3300044735 | Bacteria | 1929 |
| 241 | Ga0466970_0166567 | 3300044765 | Bacteria | 1220 |
| 242 | Ga0466959_0049628 | 3300045049 | Bacteria | 3083 |
| 243 | Ga0495617_007281 | 3300046452 | Bacteria | 3844 |
| 244 | Ga0495617_008002 | 3300046452 | Bacteria | 3652 |
| 245 | Ga0495617_068358 | 3300046452 | Bacteria | 1169 |
| 246 | Ga0495627_000415 | 3300046453 | Bacteria | 37684 |
| 247 | Ga0495627_001298 | 3300046453 | Bacteria | 15265 |
| 248 | Ga0495627_004382 | 3300046453 | Bacteria | 5923 |
| 249 | Ga0495627_030538 | 3300046453 | Bacteria | 1707 |
| 250 | Ga0495603_0020632 | 3300046455 | Bacteria | 3992 |
| 251 | Ga0495590_0001415 | 3300046457 | Bacteria | 10391 |
| 252 | Ga0495591_001632 | 3300046458 | Bacteria | 13529 |
| 253 | Ga0495591_002824 | 3300046458 | Bacteria | 9356 |
| 254 | Ga0495591_006678 | 3300046458 | Bacteria | 5041 |
| 255 | Ga0495591_022618 | 3300046458 | Bacteria | 2028 |
| 256 | Ga0495591_050695 | 3300046458 | Bacteria | 1135 |
| 257 | Ga0495629_0035886 | 3300046459 | Bacteria | 3502 |
| 258 | Ga0495629_0070388 | 3300046459 | Bacteria | 2441 |
| 259 | Ga0495629_0116122 | 3300046459 | Bacteria | 1865 |
| 260 | Ga0495638_0000024 | 3300046460 | Bacteria | 362116 |
| 261 | Ga0495638_0000528 | 3300046460 | Bacteria | 44566 |
| 262 | Ga0495638_0000667 | 3300046460 | Bacteria | 37379 |
| 263 | Ga0495638_0002019 | 3300046460 | Bacteria | 17306 |
| 264 | Ga0495638_0032020 | 3300046460 | Bacteria | 3374 |
| 265 | Ga0495638_0037607 | 3300046460 | Bacteria | 3079 |
| 266 | Ga0495638_0157421 | 3300046460 | Bacteria | 1313 |
| 267 | Ga0495651_0081247 | 3300046462 | Bacteria | 2447 |
| 268 | Ga0495651_0296624 | 3300046462 | Bacteria | 1086 |
| 269 | Ga0495653_0002124 | 3300046463 | Bacteria | 15626 |
| 270 | Ga0495653_0031525 | 3300046463 | Bacteria | 4213 |
| 271 | Ga0495650_0000042 | 3300046471 | Bacteria | 357244 |
| 272 | Ga0495650_0001297 | 3300046471 | Bacteria | 25392 |
| 273 | Ga0495650_0002183 | 3300046471 | Bacteria | 16549 |
| 274 | Ga0495650_0017013 | 3300046471 | Bacteria | 3657 |
| 275 | Ga0495650_0018859 | 3300046471 | Bacteria | 3416 |
| 276 | Ga0495650_0073996 | 3300046471 | Bacteria | 1329 |
| 277 | Ga0495580_0009790 | 3300046472 | Bacteria | 7517 |
| 278 | Ga0495582_0057168 | 3300046473 | Bacteria | 2150 |
| 279 | Ga0495605_0013274 | 3300046474 | Bacteria | 4548 |
| 280 | Ga0495605_0017184 | 3300046474 | Bacteria | 3900 |
| 281 | Ga0495605_0027957 | 3300046474 | Bacteria | 2916 |
| 282 | Ga0495639_0006701 | 3300046475 | Bacteria | 4957 |
| 283 | Ga0495664_0008429 | 3300046477 | Bacteria | 5753 |
| 284 | Ga0495664_0023769 | 3300046477 | Bacteria | 3557 |
| 285 | Ga0495584_0003935 | 3300046491 | Bacteria | 8028 |
| 286 | Ga0495584_0048491 | 3300046491 | Bacteria | 2141 |
| 287 | Ga0495584_0078419 | 3300046491 | Bacteria | 1662 |
| 288 | Ga0495584_0109622 | 3300046491 | Bacteria | 1396 |
| 289 | Ga0495584_0123053 | 3300046491 | Bacteria | 1314 |
| 290 | Ga0495585_0000662 | 3300046492 | Bacteria | 31696 |
| 291 | Ga0495585_0001580 | 3300046492 | Bacteria | 17704 |
| 292 | Ga0495585_0001674 | 3300046492 | Bacteria | 16946 |
| 293 | Ga0495585_0033133 | 3300046492 | Bacteria | 2926 |
| 294 | Ga0495585_0214366 | 3300046492 | Bacteria | 974 |
| 295 | Ga0495594_0081438 | 3300046499 | Bacteria | 1808 |
| 296 | Ga0495596_0000239 | 3300046500 | Bacteria | 37245 |
| 297 | Ga0495596_0005161 | 3300046500 | Bacteria | 6219 |
| 298 | Ga0495596_0014157 | 3300046500 | Bacteria | 3364 |
| 299 | Ga0495596_0023431 | 3300046500 | Bacteria | 2504 |
| 300 | Ga0495596_0049873 | 3300046500 | Bacteria | 1641 |
| 301 | Ga0495596_0057177 | 3300046500 | Bacteria | 1522 |
| 302 | Ga0495607_0001249 | 3300046501 | Bacteria | 22783 |
| 303 | Ga0495607_0011555 | 3300046501 | Bacteria | 5871 |
| 304 | Ga0495607_0036654 | 3300046501 | Bacteria | 2953 |
| 305 | Ga0495583_0005026 | 3300046506 | Bacteria | 9151 |
| 306 | Ga0495583_0009734 | 3300046506 | Bacteria | 5706 |
| 307 | Ga0495583_0044051 | 3300046506 | Bacteria | 2074 |
| 308 | Ga0495583_0067590 | 3300046506 | Bacteria | 1578 |
| 309 | Ga0495583_0070648 | 3300046506 | Bacteria | 1535 |
| 310 | Ga0495606_0002139 | 3300046507 | Bacteria | 23838 |
| 311 | Ga0495606_0006849 | 3300046507 | Bacteria | 10401 |
| 312 | Ga0495606_0007259 | 3300046507 | Bacteria | 9986 |
| 313 | Ga0495610_0000300 | 3300046512 | Bacteria | 52078 |
| 314 | Ga0495610_0002036 | 3300046512 | Bacteria | 17262 |
| 315 | Ga0495610_0003361 | 3300046512 | Bacteria | 12544 |
| 316 | Ga0495610_0005068 | 3300046512 | Bacteria | 9495 |
| 317 | Ga0495616_0000853 | 3300046513 | Bacteria | 22214 |
| 318 | Ga0495616_0001384 | 3300046513 | Bacteria | 16893 |
| 319 | Ga0495616_0001474 | 3300046513 | Bacteria | 16340 |
| 320 | Ga0495616_0004044 | 3300046513 | Bacteria | 9316 |
| 321 | Ga0495616_0075802 | 3300046513 | Bacteria | 1618 |
| 322 | Ga0495618_0112054 | 3300046514 | Bacteria | 1747 |
| 323 | Ga0495620_0032809 | 3300046515 | Bacteria | 2362 |
| 324 | Ga0495628_0010034 | 3300046516 | Bacteria | 8058 |
| 325 | Ga0495628_0047526 | 3300046516 | Bacteria | 3404 |
| 326 | Ga0495630_0003416 | 3300046517 | Bacteria | 11047 |
| 327 | Ga0495631_0000763 | 3300046518 | Bacteria | 20676 |
| 328 | Ga0495631_0043116 | 3300046518 | Bacteria | 1991 |
| 329 | Ga0495631_0045295 | 3300046518 | Bacteria | 1937 |
| 330 | Ga0495631_0083442 | 3300046518 | Bacteria | 1377 |
| 331 | Ga0495631_0106991 | 3300046518 | Bacteria | 1202 |
| 332 | Ga0495632_0002599 | 3300046519 | Bacteria | 13615 |
| 333 | Ga0495632_0005077 | 3300046519 | Bacteria | 8804 |
| 334 | Ga0495632_0007114 | 3300046519 | Bacteria | 7081 |
| 335 | Ga0495632_0031056 | 3300046519 | Bacteria | 2766 |
| 336 | Ga0495632_0058529 | 3300046519 | Bacteria | 1877 |
| 337 | Ga0495637_0000889 | 3300046520 | Bacteria | 19276 |
| 338 | Ga0495637_0002729 | 3300046520 | Bacteria | 9620 |
| 339 | Ga0495637_0003072 | 3300046520 | Bacteria | 8914 |
| 340 | Ga0495637_0005709 | 3300046520 | Bacteria | 6310 |
| 341 | Ga0495643_0000023 | 3300046522 | Bacteria | 288590 |
| 342 | Ga0495643_0000504 | 3300046522 | Bacteria | 48931 |
| 343 | Ga0495643_0000854 | 3300046522 | Bacteria | 32834 |
| 344 | Ga0495643_0008470 | 3300046522 | Bacteria | 6506 |
| 345 | Ga0495643_0010229 | 3300046522 | Bacteria | 5779 |
| 346 | Ga0495643_0027558 | 3300046522 | Bacteria | 3191 |
| 347 | Ga0495643_0137535 | 3300046522 | Bacteria | 1221 |
| 348 | Ga0495644_0002641 | 3300046523 | Bacteria | 7124 |
| 349 | Ga0495648_0000005 | 3300046524 | Bacteria | 362116 |
| 350 | Ga0495648_0000132 | 3300046524 | Bacteria | 88064 |
| 351 | Ga0495648_0001417 | 3300046524 | Bacteria | 23437 |
| 352 | Ga0495648_0006475 | 3300046524 | Bacteria | 9553 |
| 353 | Ga0495648_0015463 | 3300046524 | Bacteria | 5540 |
| 354 | Ga0495642_0000124 | 3300046528 | Bacteria | 44239 |
| 355 | Ga0495642_0008925 | 3300046528 | Bacteria | 3835 |
| 356 | Ga0495642_0030372 | 3300046528 | Bacteria | 2161 |
| 357 | Ga0495652_0040507 | 3300046529 | Bacteria | 4027 |
| 358 | Ga0495652_0094318 | 3300046529 | Bacteria | 2441 |
| 359 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 360 | Ga0495654_0001496 | 3300046530 | Bacteria | 15980 |
| 361 | Ga0495654_0004577 | 3300046530 | Bacteria | 8169 |
| 362 | Ga0495654_0019265 | 3300046530 | Bacteria | 3571 |
| 363 | Ga0495654_0174537 | 3300046530 | Bacteria | 934 |
| 364 | Ga0495665_0024120 | 3300046531 | Bacteria | 3267 |
| 365 | Ga0495665_0045911 | 3300046531 | Bacteria | 2320 |
| 366 | Ga0495640_0082731 | 3300046533 | Bacteria | 2131 |
| 367 | Ga0495586_0021869 | 3300046535 | Bacteria | 3413 |
| 368 | Ga0495609_0014133 | 3300046538 | Bacteria | 3758 |
| 369 | Ga0495609_0023946 | 3300046538 | Bacteria | 2802 |
| 370 | Ga0495609_0055912 | 3300046538 | Bacteria | 1749 |
| 371 | Ga0495597_0092539 | 3300046542 | Bacteria | 1282 |
| 372 | Ga0495645_0025923 | 3300046543 | Bacteria | 4255 |
| 373 | Ga0495645_0225698 | 3300046543 | Bacteria | 1257 |
| 374 | Ga0495633_0000843 | 3300046558 | Bacteria | 26958 |
| 375 | Ga0495633_0032145 | 3300046558 | Bacteria | 2537 |
| 376 | Ga0495656_0085258 | 3300046615 | Bacteria | 1434 |
| 377 | Ga0495668_0000013 | 3300046616 | Bacteria | 452938 |
| 378 | Ga0495668_0002023 | 3300046616 | Bacteria | 17704 |
| 379 | Ga0495668_0003911 | 3300046616 | Bacteria | 10880 |
| 380 | Ga0495668_0018768 | 3300046616 | Bacteria | 3997 |
| 381 | Ga0495668_0022554 | 3300046616 | Bacteria | 3598 |
| 382 | Ga0495611_0000461 | 3300046648 | Bacteria | 24342 |
| 383 | Ga0495611_0013144 | 3300046648 | Bacteria | 3521 |
| 384 | Ga0495625_0000321 | 3300046660 | Bacteria | 72983 |
| 385 | Ga0495625_0002402 | 3300046660 | Bacteria | 20301 |
| 386 | Ga0495625_0003785 | 3300046660 | Bacteria | 14685 |
| 387 | Ga0495625_0004272 | 3300046660 | Bacteria | 13597 |
| 388 | Ga0495625_0007729 | 3300046660 | Bacteria | 9299 |
| 389 | Ga0495625_0012111 | 3300046660 | Bacteria | 6997 |
| 390 | Ga0495625_0033261 | 3300046660 | Bacteria | 3815 |
| 391 | Ga0495625_0073339 | 3300046660 | Bacteria | 2400 |
| 392 | Ga0495625_0120658 | 3300046660 | Bacteria | 1784 |
| 393 | Ga0495635_0269439 | 3300046663 | Bacteria | 1145 |
| 394 | Ga0495661_0024159 | 3300046665 | Bacteria | 3935 |
| 395 | Ga0495661_0159553 | 3300046665 | Bacteria | 1212 |
| 396 | Ga0495588_0000052 | 3300046674 | Bacteria | 304493 |
| 397 | Ga0495657_0080587 | 3300046675 | Bacteria | 2107 |
| 398 | Ga0495599_0003450 | 3300046678 | Bacteria | 9256 |
| 399 | Ga0495623_0035720 | 3300046679 | Bacteria | 3185 |
| 400 | Ga0495646_0038449 | 3300046680 | Bacteria | 2955 |
| 401 | Ga0495646_0052155 | 3300046680 | Bacteria | 2472 |
| 402 | Ga0495669_0000023 | 3300046684 | Bacteria | 117158 |
| 403 | Ga0495624_0002214 | 3300046690 | Bacteria | 14828 |
| 404 | Ga0495670_0000423 | 3300046691 | Bacteria | 20296 |
| 405 | Ga0495671_0013006 | 3300046692 | Bacteria | 4525 |
| 406 | Ga0495671_0132465 | 3300046692 | Bacteria | 1215 |
| 407 | Ga0495649_0001618 | 3300046694 | Bacteria | 16767 |
| 408 | Ga0495649_0008739 | 3300046694 | Bacteria | 6078 |
| 409 | Ga0495649_0013693 | 3300046694 | Bacteria | 4673 |
| 410 | Ga0495649_0020614 | 3300046694 | Bacteria | 3696 |
| 411 | Ga0495649_0057574 | 3300046694 | Bacteria | 2095 |
| 412 | Ga0495649_0084329 | 3300046694 | Bacteria | 1697 |
| 413 | Ga0495589_0011859 | 3300046794 | Bacteria | 4520 |
| 414 | Ga0495600_0055261 | 3300046809 | Bacteria | 2593 |
| 415 | Ga0495660_0001780 | 3300046810 | Bacteria | 14238 |
| 416 | Ga0495660_0015469 | 3300046810 | Bacteria | 4407 |
| 417 | Ga0495660_0018256 | 3300046810 | Bacteria | 4030 |
| 418 | Ga0495581_0015925 | 3300047315 | Bacteria | 4368 |
| 419 | Ga0495604_0001624 | 3300047317 | Bacteria | 18543 |
| 420 | Ga0495604_0017630 | 3300047317 | Bacteria | 5714 |
| 421 | Ga0495674_0014788 | 3300047319 | Bacteria | 7300 |
| 422 | Ga0495674_0063285 | 3300047319 | Bacteria | 3218 |
| 423 | Ga0495674_0258442 | 3300047319 | Bacteria | 1431 |
| 424 | Ga0495676_0009886 | 3300047321 | Bacteria | 8668 |
| 425 | Ga0495676_0013460 | 3300047321 | Bacteria | 7351 |
| 426 | Ga0495680_0003071 | 3300047322 | Bacteria | 16636 |
| 427 | Ga0495680_0037415 | 3300047322 | Bacteria | 3887 |
| 428 | Ga0495683_0008563 | 3300047323 | Bacteria | 5468 |
| 429 | Ga0495683_0032485 | 3300047323 | Bacteria | 2658 |
| 430 | Ga0495683_0042074 | 3300047323 | Bacteria | 2304 |
| 431 | Ga0495687_000076 | 3300047443 | Bacteria | 149259 |
| 432 | Ga0495687_000080 | 3300047443 | Bacteria | 147467 |
| 433 | Ga0495675_0080626 | 3300047444 | Bacteria | 2050 |
| 434 | Ga0495677_0000727 | 3300047445 | Bacteria | 13285 |
| 435 | Ga0495677_0009066 | 3300047445 | Bacteria | 3679 |
| 436 | Ga0495679_001065 | 3300047446 | Bacteria | 16654 |
| 437 | Ga0495679_001402 | 3300047446 | Bacteria | 13775 |
| 438 | Ga0495679_002670 | 3300047446 | Bacteria | 8934 |
| 439 | Ga0495679_032553 | 3300047446 | Bacteria | 1671 |
| 440 | Ga0495673_0002456 | 3300047469 | Bacteria | 13029 |
| 441 | Ga0495673_0005602 | 3300047469 | Bacteria | 7557 |
| 442 | Ga0495673_0058369 | 3300047469 | Bacteria | 1663 |
| 443 | Ga0495681_0000193 | 3300047470 | Bacteria | 51594 |
| 444 | Ga0495681_0000399 | 3300047470 | Bacteria | 33808 |
| 445 | Ga0495681_0002038 | 3300047470 | Bacteria | 14727 |
| 446 | Ga0495681_0068972 | 3300047470 | Bacteria | 1607 |
| 447 | Ga0495681_0071737 | 3300047470 | Bacteria | 1567 |
| 448 | Ga0495681_0108147 | 3300047470 | Bacteria | 1207 |
| 449 | Ga0495686_0002385 | 3300047472 | Bacteria | 17845 |
| 450 | Ga0495686_0004991 | 3300047472 | Bacteria | 10668 |
| 451 | Ga0495686_0010477 | 3300047472 | Bacteria | 6589 |
| 452 | Ga0495686_0080179 | 3300047472 | Bacteria | 1996 |
| 453 | Ga0495593_0001284 | 3300047673 | Bacteria | 14693 |
| 454 | Ga0495593_0001825 | 3300047673 | Bacteria | 12666 |
| 455 | Ga0495602_0002338 | 3300048088 | Bacteria | 19182 |
| 456 | Ga0495602_0050876 | 3300048088 | Bacteria | 3697 |
| 457 | Ga0495614_0006627 | 3300048089 | Bacteria | 5185 |
| 458 | Ga0495614_0015130 | 3300048089 | Bacteria | 3367 |
| 459 | Ga0495615_0000331 | 3300048090 | Bacteria | 7858 |
| 460 | Ga0495626_0001319 | 3300048091 | Bacteria | 20205 |
| 461 | Ga0495626_0001856 | 3300048091 | Bacteria | 15851 |
| 462 | Ga0495626_0003340 | 3300048091 | Bacteria | 10353 |
| 463 | Ga0496100_0066192 | 3300048903 | Bacteria | 2396 |
| 464 | Ga0496102_0139130 | 3300048905 | Bacteria | 2276 |
| 465 | Ga0496104_0130283 | 3300048907 | Bacteria | 2416 |
| 466 | Ga0496106_0161094 | 3300048909 | Bacteria | 1774 |
| 467 | Ga0496108_0091990 | 3300048911 | Bacteria | 2579 |
| 468 | Ga0496116_0001963 | 3300048919 | Bacteria | 22172 |
| 469 | Ga0496116_0002731 | 3300048919 | Bacteria | 18138 |
| 470 | Ga0496116_0003365 | 3300048919 | Bacteria | 15876 |
| 471 | Ga0496117_0003450 | 3300048920 | Bacteria | 18385 |
| 472 | Ga0496117_0043760 | 3300048920 | Bacteria | 3251 |
| 473 | Ga0496117_0059367 | 3300048920 | Bacteria | 2642 |
| 474 | Ga0496117_0066010 | 3300048920 | Bacteria | 2456 |
| 475 | Ga0496117_0066012 | 3300048920 | Bacteria | 2456 |
| 476 | Ga0496118_0002940 | 3300048921 | Bacteria | 22132 |
| 477 | Ga0496118_0003912 | 3300048921 | Bacteria | 18237 |
| 478 | Ga0496118_0005723 | 3300048921 | Bacteria | 13985 |
| 479 | Ga0496118_0014720 | 3300048921 | Bacteria | 7305 |
| 480 | Ga0496118_0039760 | 3300048921 | Bacteria | 3749 |
| 481 | Ga0496119_0129374 | 3300048922 | Bacteria | 1377 |
| 482 | Ga0496119_0147422 | 3300048922 | Bacteria | 1264 |
| 483 | Ga0496120_0044973 | 3300048923 | Bacteria | 2561 |
| 484 | Ga0496120_0150847 | 3300048923 | Bacteria | 1168 |
| 485 | Ga0496121_0000245 | 3300048924 | Bacteria | 116316 |
| 486 | Ga0496121_0004887 | 3300048924 | Bacteria | 17596 |
| 487 | Ga0496121_0010584 | 3300048924 | Bacteria | 10369 |
| 488 | Ga0496122_0034514 | 3300048925 | Bacteria | 4138 |
| 489 | Ga0496123_0001983 | 3300048926 | Bacteria | 26520 |
| 490 | Ga0496123_0004425 | 3300048926 | Bacteria | 14782 |
| 491 | Ga0496123_0023910 | 3300048926 | Bacteria | 4663 |
| 492 | Ga0496123_0149660 | 3300048926 | Bacteria | 1261 |
| 493 | Ga0496124_0000428 | 3300048927 | Bacteria | 75094 |
| 494 | Ga0496124_0010991 | 3300048927 | Bacteria | 9097 |
| 495 | Ga0496124_0021151 | 3300048927 | Bacteria | 5997 |
| 496 | Ga0496124_0033977 | 3300048927 | Bacteria | 4482 |
| 497 | Ga0496124_0049940 | 3300048927 | Bacteria | 3565 |
| 498 | Ga0496124_0061134 | 3300048927 | Bacteria | 3158 |
| 499 | Ga0496124_0141966 | 3300048927 | Bacteria | 1894 |
| 500 | Ga0496125_0006812 | 3300048928 | Bacteria | 12265 |
| 501 | Ga0496125_0104242 | 3300048928 | Bacteria | 2078 |
| 502 | Ga0496125_0105544 | 3300048928 | Bacteria | 2059 |
| 503 | Ga0496125_0156193 | 3300048928 | Bacteria | 1558 |
| 504 | Ga0496125_0177568 | 3300048928 | Bacteria | 1423 |
| 505 | Ga0496126_0005254 | 3300048929 | Bacteria | 14879 |
| 506 | Ga0496126_0008958 | 3300048929 | Bacteria | 10711 |
| 507 | Ga0495678_001646 | 3300049459 | Bacteria | 16994 |
| 508 | Ga0495678_003232 | 3300049459 | Bacteria | 10216 |
| 509 | Ga0495678_022694 | 3300049459 | Bacteria | 2740 |
| 510 | Ga0495678_025498 | 3300049459 | Bacteria | 2537 |
| 511 | Ga0495678_037400 | 3300049459 | Bacteria | 1972 |
| 512 | Ga0495678_038043 | 3300049459 | Bacteria | 1950 |
| 513 | Ga0495682_0003730 | 3300049460 | Bacteria | 6708 |
| 514 | Ga0501073_0188068 | 3300049589 | Bacteria | 1429 |
| 515 | Ga0501249_000131 | 3300049679 | Bacteria | 23441 |
| 516 | Ga0501241_000548 | 3300049758 | Bacteria | 8073 |
| 517 | Ga0501268_001146 | 3300049765 | Bacteria | 3207 |
| 518 | Ga0501269_000018 | 3300049766 | Bacteria | 56999 |
| 519 | Ga0501269_000801 | 3300049766 | Bacteria | 4896 |
| 520 | Ga0501273_001729 | 3300049770 | Bacteria | 2130 |
| 521 | Ga0501035_0339190 | 3300049822 | Bacteria | 1260 |
| 522 | nmdc:mga03n38_6223_c1 | 3300050490 | Bacteria | 4129 |
| 523 | nmdc:mga0k408_14143_c1 | 3300050493 | Bacteria | 4391 |
| 524 | nmdc:mga0k408_53396_c1 | 3300050493 | Bacteria | 2342 |
| 525 | nmdc:mga06z11_43598_c1 | 3300050494 | Bacteria | 2258 |
| 526 | nmdc:mga06z11_52688_c1 | 3300050494 | Bacteria | 2089 |
| 527 | nmdc:mga07m45_11144_c2 | 3300050496 | Bacteria | 4517 |
| 528 | nmdc:mga09592_85184_c1 | 3300050508 | Bacteria | 2696 |
| 529 | nmdc:mga0qj67_213502_c1 | 3300050509 | Bacteria | 1567 |
| 530 | nmdc:mga0qj67_29207_c1 | 3300050509 | Bacteria | 4282 |
| 531 | nmdc:mga06r32_96787_c1 | 3300050510 | Bacteria | 2891 |
| 532 | nmdc:mga0n895_266507_c1 | 3300050512 | Bacteria | 1738 |
| 533 | nmdc:mga0sz30_17937_c1 | 3300050516 | Bacteria | 2828 |
| 534 | Ga0500610_0000051 | 3300053079 | Bacteria | 36873 |
| 535 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 536 | Ga0500643_004858 | 3300053087 | Bacteria | 5934 |
| 537 | Ga0500583_0118294 | 3300053092 | Bacteria | 1310 |
| 538 | Ga0500566_0024157 | 3300053094 | Bacteria | 3570 |
| 539 | Ga0500654_084534 | 3300053099 | Bacteria | 1455 |
| 540 | Ga0500562_004954 | 3300053108 | Bacteria | 3357 |
| 541 | Ga0500642_0043986 | 3300053130 | Bacteria | 1942 |
| 542 | Ga0500652_000539 | 3300053131 | Bacteria | 13320 |
| 543 | Ga0500559_0000801 | 3300053136 | Bacteria | 20557 |
| 544 | Ga0500559_0027281 | 3300053136 | Bacteria | 2437 |
| 545 | Ga0500568_0003285 | 3300053139 | Bacteria | 9121 |
| 546 | Ga0500568_0003740 | 3300053139 | Bacteria | 8334 |
| 547 | Ga0500568_0098191 | 3300053139 | Bacteria | 1100 |
| 548 | Ga0500586_050715 | 3300053145 | Bacteria | 1430 |
| 549 | Ga0500588_0000167 | 3300053146 | Bacteria | 8877 |
| 550 | Ga0500622_0000260 | 3300053156 | Bacteria | 53872 |
| 551 | Ga0500624_000190 | 3300053157 | Bacteria | 24336 |
| 552 | Ga0500645_000003 | 3300053730 | Bacteria | 305887 |
| 553 | Ga0500596_001962 | 3300053735 | Bacteria | 4124 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046462 | Ga0495651_0296624 | Ga0495651_0296624_32_871 | 247 |
| 2 | 3300046531 | Ga0495665_0024120 | Ga0495665_0024120_2370_3209 | 247 |
| 3 | 3300046680 | Ga0495646_0038449 | Ga0495646_0038449_2038_2877 | 247 |
| 4 | 3300048924 | Ga0496121_0010584 | Ga0496121_0010584_18_824 | 267 |
| 5 | 3300046471 | Ga0495650_0073996 | Ga0495650_0073996_15_830 | 270 |
| 6 | 3300046472 | Ga0495580_0009790 | Ga0495580_0009790_3876_4823 | 272 |
| 7 | 3300046678 | Ga0495599_0003450 | Ga0495599_0003450_745_1692 | 272 |
| 8 | 3300046679 | Ga0495623_0035720 | Ga0495623_0035720_1372_2319 | 272 |
| 9 | 3300006051 | Ga0075364_10026973 | Ga0075364_100269732 | 278 |
| 10 | 3300047470 | Ga0495681_0068972 | Ga0495681_0068972_330_1283 | 278 |
| 11 | 3300049770 | Ga0501273_001729 | Ga0501273_001729_1281_2120 | 278 |
| 12 | 3300046492 | Ga0495585_0214366 | Ga0495585_0214366_12_854 | 279 |
| 13 | 3300046471 | Ga0495650_0001297 | Ga0495650_0001297_20_865 | 280 |
| 14 | 3300046530 | Ga0495654_0174537 | Ga0495654_0174537_74_919 | 280 |
| 15 | 3300046459 | Ga0495629_0116122 | Ga0495629_0116122_829_1776 | 283 |
| 16 | 3300046463 | Ga0495653_0002124 | Ga0495653_0002124_5157_6104 | 283 |
| 17 | 3300046514 | Ga0495618_0112054 | Ga0495618_0112054_509_1456 | 283 |
| 18 | 3300046516 | Ga0495628_0010034 | Ga0495628_0010034_4869_5816 | 283 |
| 19 | 3300046517 | Ga0495630_0003416 | Ga0495630_0003416_9128_10075 | 283 |
| 20 | 3300046533 | Ga0495640_0082731 | Ga0495640_0082731_480_1427 | 283 |
| 21 | 3300046663 | Ga0495635_0269439 | Ga0495635_0269439_24_971 | 283 |
| 22 | 3300046690 | Ga0495624_0002214 | Ga0495624_0002214_4869_5816 | 283 |
| 23 | 3300047317 | Ga0495604_0001624 | Ga0495604_0001624_9558_10505 | 283 |
| 24 | 3300047319 | Ga0495674_0014788 | Ga0495674_0014788_4869_5816 | 283 |
| 25 | 3300047321 | Ga0495676_0009886 | Ga0495676_0009886_4978_5925 | 283 |
| 26 | 3300047322 | Ga0495680_0003071 | Ga0495680_0003071_10821_11768 | 283 |
| 27 | 3300047673 | Ga0495593_0001284 | Ga0495593_0001284_4669_5616 | 283 |
| 28 | 3300048088 | Ga0495602_0002338 | Ga0495602_0002338_9172_10119 | 283 |
| 29 | 3300048089 | Ga0495614_0006627 | Ga0495614_0006627_98_1045 | 283 |
| 30 | 3300046694 | Ga0495649_0008739 | Ga0495649_0008739_348_1301 | 288 |
| 31 | 3300046471 | Ga0495650_0000042 | Ga0495650_0000042_115749_116702 | 290 |
| 32 | 3300046616 | Ga0495668_0003911 | Ga0495668_0003911_6906_7859 | 290 |
| 33 | 3300046660 | Ga0495625_0000321 | Ga0495625_0000321_60717_61670 | 291 |
| 34 | 3300047443 | Ga0495687_000080 | Ga0495687_000080_67091_68044 | 294 |
| 35 | 3300025226 | Ga0209674_105302 | Ga0209674_1053022 | 298 |
| 36 | 3300005985 | Ga0081539_10002387 | Ga0081539_1000238710 | 299 |
| 37 | 3300046471 | Ga0495650_0002183 | Ga0495650_0002183_14453_15406 | 302 |
| 38 | 3300046520 | Ga0495637_0000889 | Ga0495637_0000889_12404_13357 | 302 |
| 39 | 3300046530 | Ga0495654_0000002 | Ga0495654_0000002_139614_140567 | 302 |
| 40 | 3300048926 | Ga0496123_0023910 | Ga0496123_0023910_2715_3665 | 303 |
| 41 | 3300006946 | Ga0079104_1014871 | Ga0079104_10148712 | 304 |
| 42 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003305 | 306 |
| 43 | 3300046458 | Ga0495591_002824 | Ga0495591_002824_6332_7294 | 306 |
| 44 | 3300005355 | Ga0070671_100293753 | Ga0070671_1002937531 | 307 |
| 45 | 3300005843 | Ga0068860_100055883 | Ga0068860_1000558832 | 307 |
| 46 | 3300009551 | Ga0105238_10204923 | Ga0105238_102049232 | 307 |
| 47 | 3300025931 | Ga0207644_10248888 | Ga0207644_102488881 | 307 |
| 48 | 3300026088 | Ga0207641_10007038 | Ga0207641_100070382 | 307 |
| 49 | 3300026116 | Ga0207674_10283139 | Ga0207674_102831392 | 307 |
| 50 | 3300028381 | Ga0268264_10011531 | Ga0268264_100115312 | 307 |
| 51 | 3300049589 | Ga0501073_0188068 | Ga0501073_0188068_393_1343 | 307 |
| 52 | 3300053087 | Ga0500643_004858 | Ga0500643_004858_2652_3608 | 307 |
| 53 | 3300053157 | Ga0500624_000190 | Ga0500624_000190_4402_5358 | 307 |
| 54 | 3300003316 | rootH1_10004060 | rootH1_100040607 | 309 |
| 55 | 3300003322 | rootL2_10005700 | rootL2_1000570031 | 309 |
| 56 | 3300005985 | Ga0081539_10098484 | Ga0081539_100984841 | 309 |
| 57 | 3300048927 | Ga0496124_0061134 | Ga0496124_0061134_2055_3008 | 309 |
| 58 | iso_pu_bacteria | 2738541293 | 2738805513 | 309 |
| 59 | iso_pu_bacteria | 2841734538 | 2841735098 | 310 |
| 60 | iso_pu_bacteria | 2878788777 | 2878789769 | 310 |
| 61 | iso_pu_bacteria | 2958071322 | 2958074467 | 310 |
| 62 | iso_pu_bacteria | 8004633249 | 8004639601 | 310 |
| 63 | 3300046463 | Ga0495653_0031525 | Ga0495653_0031525_237_1193 | 311 |
| 64 | 3300046516 | Ga0495628_0047526 | Ga0495628_0047526_695_1651 | 311 |
| 65 | 3300046529 | Ga0495652_0040507 | Ga0495652_0040507_1341_2297 | 311 |
| 66 | 3300047317 | Ga0495604_0017630 | Ga0495604_0017630_1347_2303 | 311 |
| 67 | 3300047319 | Ga0495674_0258442 | Ga0495674_0258442_282_1238 | 311 |
| 68 | 3300047321 | Ga0495676_0013460 | Ga0495676_0013460_3020_3976 | 311 |
| 69 | 3300047444 | Ga0495675_0080626 | Ga0495675_0080626_841_1797 | 311 |
| 70 | 3300048088 | Ga0495602_0050876 | Ga0495602_0050876_2239_3195 | 311 |
| 71 | iso_pu_bacteria | 2510917021 | 2511126805 | 311 |
| 72 | iso_pu_bacteria | 2513237096 | 2513657284 | 311 |
| 73 | iso_pu_bacteria | 2513237137 | 2513857755 | 311 |
| 74 | iso_pu_bacteria | 2513237145 | 2513919292 | 311 |
| 75 | iso_pu_bacteria | 2517572143 | 2517891016 | 311 |
| 76 | iso_pu_bacteria | 2599185359 | 2600228681 | 311 |
| 77 | iso_pu_bacteria | 2643221552 | 2643782322 | 311 |
| 78 | iso_pu_bacteria | 2643221584 | 2643929255 | 311 |
| 79 | iso_pu_bacteria | 2643221622 | 2644127065 | 311 |
| 80 | iso_pu_bacteria | 2667528175 | 2671120067 | 311 |
| 81 | iso_pu_bacteria | 2721755523 | 2722883646 | 311 |
| 82 | iso_pu_bacteria | 2728368998 | 2728752663 | 311 |
| 83 | iso_pu_bacteria | 2818991466 | 2819714521 | 311 |
| 84 | iso_pu_bacteria | 2839138175 | 2839138746 | 311 |
| 85 | iso_pu_bacteria | 2842747753 | 2842751938 | 311 |
| 86 | iso_pu_bacteria | 2904541872 | 2904545217 | 311 |
| 87 | iso_pu_bacteria | 2906610324 | 2906616215 | 311 |
| 88 | iso_pu_bacteria | 2906635258 | 2906636959 | 311 |
| 89 | iso_pu_bacteria | 2906660503 | 2906664447 | 311 |
| 90 | iso_pu_bacteria | 2928027323 | 2928027855 | 311 |
| 91 | iso_pu_bacteria | 2928037797 | 2928040097 | 311 |
| 92 | iso_pu_bacteria | 2928044640 | 2928047154 | 311 |
| 93 | iso_pu_bacteria | 2928526807 | 2928529023 | 311 |
| 94 | iso_pu_bacteria | 2928968154 | 2928968541 | 311 |
| 95 | iso_pu_bacteria | 2929160207 | 2929165394 | 311 |
| 96 | iso_pu_bacteria | 2935630451 | 2935635350 | 311 |
| 97 | iso_pu_bacteria | 2941507105 | 2941512154 | 311 |
| 98 | iso_pu_bacteria | 2941515067 | 2941519856 | 311 |
| 99 | iso_pu_bacteria | 2941523033 | 2941527857 | 311 |
| 100 | iso_pu_bacteria | 2945984333 | 2945987769 | 311 |
| 101 | iso_pu_bacteria | 2978969890 | 2978970174 | 311 |
| 102 | iso_pu_bacteria | 2984555340 | 2984558768 | 311 |
| 103 | iso_pu_bacteria | 2984587000 | 2984587201 | 311 |
| 104 | iso_pu_bacteria | 2993356040 | 2993357914 | 311 |
| 105 | iso_pu_bacteria | 8054302542 | 8054306215 | 311 |
| 106 | 3300025920 | Ga0207649_10403143 | Ga0207649_104031431 | 312 |
| 107 | iso_pu_bacteria | 2511231023 | 2511371762 | 312 |
| 108 | iso_pu_bacteria | 2643221658 | 2644329080 | 312 |
| 109 | iso_pu_bacteria | 2643221664 | 2644355638 | 312 |
| 110 | iso_pu_bacteria | 2643221672 | 2644401828 | 312 |
| 111 | iso_pu_bacteria | 2842775625 | 2842776605 | 312 |
| 112 | iso_pu_bacteria | 2946787523 | 2946791529 | 312 |
| 113 | iso_pu_bacteria | 3007614139 | 3007618417 | 312 |
| 114 | iso_pu_bacteria | 3007855910 | 3007857381 | 312 |
| 115 | 3300038705 | Ga0237819_00250 | Ga0237819_00250_6979_7923 | 313 |
| 116 | iso_pu_bacteria | 2511231011 | 2511294450 | 313 |
| 117 | iso_pu_bacteria | 2585428057 | 2587728905 | 313 |
| 118 | iso_pu_bacteria | 2588253510 | 2588293089 | 313 |
| 119 | iso_pu_bacteria | 2599185354 | 2600201951 | 313 |
| 120 | iso_pu_bacteria | 2713897148 | 2715752766 | 313 |
| 121 | iso_pu_bacteria | 2718217725 | 2718634622 | 313 |
| 122 | iso_pu_bacteria | 2773857673 | 2774134361 | 313 |
| 123 | iso_pu_bacteria | 2784132063 | 2784263843 | 313 |
| 124 | iso_pu_bacteria | 2818991456 | 2819656647 | 313 |
| 125 | iso_pu_bacteria | 2842832357 | 2842836158 | 313 |
| 126 | iso_pu_bacteria | 2842843487 | 2842847100 | 313 |
| 127 | iso_pu_bacteria | 2852657418 | 2852658066 | 313 |
| 128 | iso_pu_bacteria | 2880230671 | 2880234097 | 313 |
| 129 | iso_pu_bacteria | 2904518522 | 2904522744 | 313 |
| 130 | iso_pu_bacteria | 2919385768 | 2919387467 | 313 |
| 131 | iso_pu_bacteria | 2919487758 | 2919492442 | 313 |
| 132 | iso_pu_bacteria | 2974289157 | 2974290465 | 313 |
| 133 | iso_pu_bacteria | 2998139840 | 2998143386 | 313 |
| 134 | iso_pu_bacteria | 3007861166 | 3007862600 | 313 |
| 135 | iso_pu_bacteria | 8029995093 | 8029997431 | 313 |
| 136 | iso_pu_bacteria | 8056166840 | 8056167828 | 313 |
| 137 | iso_pu_bacteria | 8056569372 | 8056570958 | 313 |
| 138 | iso_pu_bacteria | 8057304971 | 8057306380 | 313 |
| 139 | 3300031241 | Ga0265325_10140856 | Ga0265325_101408562 | 314 |
| 140 | 3300031456 | Ga0307513_10001443 | Ga0307513_100014435 | 314 |
| 141 | 3300046460 | Ga0495638_0000528 | Ga0495638_0000528_24526_25473 | 314 |
| 142 | 3300046520 | Ga0495637_0003072 | Ga0495637_0003072_87_1034 | 314 |
| 143 | 3300046542 | Ga0495597_0092539 | Ga0495597_0092539_16_1011 | 314 |
| 144 | iso_pu_bacteria | 2885429604 | 2885431002 | 314 |
| 145 | 3300001989 | JGI24739J22299_10005304 | JGI24739J22299_100053041 | 315 |
| 146 | 3300002774 | JGI25150J39212_1000766 | JGI25150J39212_10007668 | 315 |
| 147 | 3300003187 | JGI25151J46595_10007034 | JGI25151J46595_100070342 | 315 |
| 148 | 3300003203 | JGI25406J46586_10000117 | JGI25406J46586_1000011714 | 315 |
| 149 | 3300003354 | JGI25160J50197_1007309 | JGI25160J50197_10073092 | 315 |
| 150 | 3300003761 | Ga0055535_1003706 | Ga0055535_10037063 | 315 |
| 151 | 3300003762 | Ga0055542_1000003 | Ga0055542_100000336 | 315 |
| 152 | 3300003781 | Ga0055536_1006686 | Ga0055536_10066862 | 315 |
| 153 | 3300003784 | Ga0055534_1004678 | Ga0055534_10046782 | 315 |
| 154 | 3300003791 | Ga0055530_10000292 | Ga0055530_1000029217 | 315 |
| 155 | 3300003794 | Ga0055531_10028400 | Ga0055531_100284002 | 315 |
| 156 | 3300005262 | Ga0065165_1007820 | Ga0065165_10078203 | 315 |
| 157 | 3300005289 | Ga0065704_10092405 | Ga0065704_100924052 | 315 |
| 158 | 3300005327 | Ga0070658_10121547 | Ga0070658_101215472 | 315 |
| 159 | 3300005340 | Ga0070689_100020373 | Ga0070689_1000203733 | 315 |
| 160 | 3300005343 | Ga0070687_100002160 | Ga0070687_1000021605 | 315 |
| 161 | 3300005344 | Ga0070661_100290586 | Ga0070661_1002905862 | 315 |
| 162 | 3300005353 | Ga0070669_100001026 | Ga0070669_10000102610 | 315 |
| 163 | 3300005354 | Ga0070675_100003940 | Ga0070675_1000039407 | 315 |
| 164 | 3300005364 | Ga0070673_100003883 | Ga0070673_1000038834 | 315 |
| 165 | 3300005365 | Ga0070688_100012635 | Ga0070688_1000126352 | 315 |
| 166 | 3300005539 | Ga0068853_100003381 | Ga0068853_1000033817 | 315 |
| 167 | 3300005539 | Ga0068853_100461093 | Ga0068853_1004610931 | 315 |
| 168 | 3300005543 | Ga0070672_100004418 | Ga0070672_1000044183 | 315 |
| 169 | 3300005617 | Ga0068859_100001917 | Ga0068859_1000019172 | 315 |
| 170 | 3300005617 | Ga0068859_100006701 | Ga0068859_1000067018 | 315 |
| 171 | 3300005719 | Ga0068861_100000111 | Ga0068861_10000011120 | 315 |
| 172 | 3300005842 | Ga0068858_100328227 | Ga0068858_1003282272 | 315 |
| 173 | 3300005843 | Ga0068860_100025171 | Ga0068860_1000251713 | 315 |
| 174 | 3300005844 | Ga0068862_100538832 | Ga0068862_1005388321 | 315 |
| 175 | 3300005983 | Ga0081540_1000102 | Ga0081540_100010281 | 315 |
| 176 | 3300005985 | Ga0081539_10000922 | Ga0081539_1000092233 | 315 |
| 177 | 3300006048 | Ga0075363_100002380 | Ga0075363_1000023809 | 315 |
| 178 | 3300006178 | Ga0075367_10038008 | Ga0075367_100380082 | 315 |
| 179 | 3300006186 | Ga0075369_10011613 | Ga0075369_100116132 | 315 |
| 180 | 3300006195 | Ga0075366_10003003 | Ga0075366_100030038 | 315 |
| 181 | 3300006195 | Ga0075366_10013861 | Ga0075366_100138612 | 315 |
| 182 | 3300006846 | Ga0075430_100023323 | Ga0075430_1000233234 | 315 |
| 183 | 3300006846 | Ga0075430_100252785 | Ga0075430_1002527851 | 315 |
| 184 | 3300006871 | Ga0075434_100092381 | Ga0075434_1000923812 | 315 |
| 185 | 3300006880 | Ga0075429_100043432 | Ga0075429_1000434323 | 315 |
| 186 | 3300006931 | Ga0097620_100001917 | Ga0097620_1000019172 | 315 |
| 187 | 3300006931 | Ga0097620_100006701 | Ga0097620_1000067018 | 315 |
| 188 | 3300006946 | Ga0079104_1000199 | Ga0079104_10001995 | 315 |
| 189 | 3300009036 | Ga0105244_10019023 | Ga0105244_100190232 | 315 |
| 190 | 3300009093 | Ga0105240_10000215 | Ga0105240_1000021522 | 315 |
| 191 | 3300009093 | Ga0105240_10019181 | Ga0105240_100191813 | 315 |
| 192 | 3300009148 | Ga0105243_10012113 | Ga0105243_100121133 | 315 |
| 193 | 3300009176 | Ga0105242_10001114 | Ga0105242_100011145 | 315 |
| 194 | 3300009177 | Ga0105248_10002303 | Ga0105248_100023036 | 315 |
| 195 | 3300009177 | Ga0105248_10206643 | Ga0105248_102066432 | 315 |
| 196 | 3300009545 | Ga0105237_10021184 | Ga0105237_100211845 | 315 |
| 197 | 3300010375 | Ga0105239_10000025 | Ga0105239_10000025121 | 315 |
| 198 | 3300013102 | Ga0157371_10057805 | Ga0157371_100578052 | 315 |
| 199 | 3300013104 | Ga0157370_10173759 | Ga0157370_101737592 | 315 |
| 200 | 3300013308 | Ga0157375_10022255 | Ga0157375_100222552 | 315 |
| 201 | 3300014497 | Ga0182008_10012765 | Ga0182008_100127653 | 315 |
| 202 | 3300015262 | Ga0182007_10001830 | Ga0182007_100018305 | 315 |
| 203 | 3300017792 | Ga0163161_10003979 | Ga0163161_100039796 | 315 |
| 204 | 3300025208 | Ga0209436_105330 | Ga0209436_1053302 | 315 |
| 205 | 3300025231 | Ga0207427_102500 | Ga0207427_1025004 | 315 |
| 206 | 3300025245 | Ga0207425_1000234 | Ga0207425_100023411 | 315 |
| 207 | 3300025253 | Ga0209677_101893 | Ga0209677_1018933 | 315 |
| 208 | 3300025258 | Ga0209129_1000049 | Ga0209129_1000049159 | 315 |
| 209 | 3300025263 | Ga0209565_1002581 | Ga0209565_10025816 | 315 |
| 210 | 3300025263 | Ga0209565_1002865 | Ga0209565_10028657 | 315 |
| 211 | 3300025263 | Ga0209565_1003209 | Ga0209565_10032096 | 315 |
| 212 | 3300025273 | Ga0209673_1000477 | Ga0209673_100047745 | 315 |
| 213 | 3300025273 | Ga0209673_1002582 | Ga0209673_10025827 | 315 |
| 214 | 3300025284 | Ga0209130_1000267 | Ga0209130_100026718 | 315 |
| 215 | 3300025284 | Ga0209130_1001174 | Ga0209130_10011747 | 315 |
| 216 | 3300025284 | Ga0209130_1005825 | Ga0209130_10058253 | 315 |
| 217 | 3300025291 | Ga0209675_1004739 | Ga0209675_10047397 | 315 |
| 218 | 3300025291 | Ga0209675_1004897 | Ga0209675_10048972 | 315 |
| 219 | 3300025291 | Ga0209675_1008661 | Ga0209675_10086612 | 315 |
| 220 | 3300025292 | Ga0209676_1000065 | Ga0209676_100006574 | 315 |
| 221 | 3300025292 | Ga0209676_1000137 | Ga0209676_100013724 | 315 |
| 222 | 3300025294 | Ga0209025_1000348 | Ga0209025_100034840 | 315 |
| 223 | 3300025294 | Ga0209025_1000481 | Ga0209025_100048157 | 315 |
| 224 | 3300025294 | Ga0209025_1011406 | Ga0209025_10114062 | 315 |
| 225 | 3300025295 | Ga0209564_1001368 | Ga0209564_100136820 | 315 |
| 226 | 3300025295 | Ga0209564_1001413 | Ga0209564_10014138 | 315 |
| 227 | 3300025297 | Ga0209758_1000135 | Ga0209758_100013518 | 315 |
| 228 | 3300025298 | Ga0209050_1000015 | Ga0209050_1000015156 | 315 |
| 229 | 3300025299 | Ga0209256_1000129 | Ga0209256_100012918 | 315 |
| 230 | 3300025299 | Ga0209256_1000604 | Ga0209256_100060430 | 315 |
| 231 | 3300025302 | Ga0207426_1000171 | Ga0207426_100017118 | 315 |
| 232 | 3300025302 | Ga0207426_1000185 | Ga0207426_100018518 | 315 |
| 233 | 3300025303 | Ga0209051_1000010 | Ga0209051_1000010156 | 315 |
| 234 | 3300025304 | Ga0209257_1000026 | Ga0209257_1000026522 | 315 |
| 235 | 3300025321 | Ga0207656_10004778 | Ga0207656_100047784 | 315 |
| 236 | 3300025908 | Ga0207643_10003052 | Ga0207643_100030524 | 315 |
| 237 | 3300025913 | Ga0207695_10000347 | Ga0207695_1000034722 | 315 |
| 238 | 3300025913 | Ga0207695_10232021 | Ga0207695_102320212 | 315 |
| 239 | 3300025918 | Ga0207662_10004642 | Ga0207662_100046425 | 315 |
| 240 | 3300025923 | Ga0207681_10005041 | Ga0207681_100050417 | 315 |
| 241 | 3300025924 | Ga0207694_10122716 | Ga0207694_101227162 | 315 |
| 242 | 3300025925 | Ga0207650_10121242 | Ga0207650_101212422 | 315 |
| 243 | 3300025926 | Ga0207659_10009901 | Ga0207659_100099014 | 315 |
| 244 | 3300025935 | Ga0207709_10000131 | Ga0207709_1000013150 | 315 |
| 245 | 3300025936 | Ga0207670_10028975 | Ga0207670_100289753 | 315 |
| 246 | 3300025940 | Ga0207691_10003193 | Ga0207691_100031939 | 315 |
| 247 | 3300025941 | Ga0207711_10000635 | Ga0207711_1000063516 | 315 |
| 248 | 3300025941 | Ga0207711_10070319 | Ga0207711_100703192 | 315 |
| 249 | 3300025960 | Ga0207651_10006501 | Ga0207651_100065014 | 315 |
| 250 | 3300025981 | Ga0207640_10014688 | Ga0207640_100146882 | 315 |
| 251 | 3300026035 | Ga0207703_10275619 | Ga0207703_102756192 | 315 |
| 252 | 3300026041 | Ga0207639_10015366 | Ga0207639_100153663 | 315 |
| 253 | 3300026095 | Ga0207676_10177470 | Ga0207676_101774702 | 315 |
| 254 | 3300026116 | Ga0207674_10088330 | Ga0207674_100883303 | 315 |
| 255 | 3300026118 | Ga0207675_100551477 | Ga0207675_1005514772 | 315 |
| 256 | 3300027111 | Ga0209281_1000293 | Ga0209281_100029313 | 315 |
| 257 | 3300031731 | Ga0307405_10008255 | Ga0307405_100082552 | 315 |
| 258 | 3300031852 | Ga0307410_10047139 | Ga0307410_100471392 | 315 |
| 259 | 3300031903 | Ga0307407_10024707 | Ga0307407_100247072 | 315 |
| 260 | 3300031911 | Ga0307412_10050819 | Ga0307412_100508192 | 315 |
| 261 | 3300031911 | Ga0307412_10155506 | Ga0307412_101555062 | 315 |
| 262 | 3300031911 | Ga0307412_10217571 | Ga0307412_102175711 | 315 |
| 263 | 3300031995 | Ga0307409_100190657 | Ga0307409_1001906572 | 315 |
| 264 | 3300032002 | Ga0307416_100007949 | Ga0307416_1000079494 | 315 |
| 265 | 3300032002 | Ga0307416_100301217 | Ga0307416_1003012172 | 315 |
| 266 | 3300032004 | Ga0307414_10120068 | Ga0307414_101200682 | 315 |
| 267 | 3300032126 | Ga0307415_100001785 | Ga0307415_1000017852 | 315 |
| 268 | 3300041410 | Ga0439461_0002843 | Ga0439461_0002843_134_1084 | 315 |
| 269 | 3300041997 | Ga0439431_0029847 | Ga0439431_0029847_348_1298 | 315 |
| 270 | 3300042014 | Ga0439457_006144 | Ga0439457_006144_155_1105 | 315 |
| 271 | 3300042156 | Ga0439446_0029909 | Ga0439446_0029909_384_1334 | 315 |
| 272 | 3300042435 | Ga0439434_0006465 | Ga0439434_0006465_2239_3189 | 315 |
| 273 | 3300044735 | Ga0466968_0042153 | Ga0466968_0042153_474_1424 | 315 |
| 274 | 3300046506 | Ga0495583_0044051 | Ga0495583_0044051_352_1302 | 315 |
| 275 | 3300046512 | Ga0495610_0000300 | Ga0495610_0000300_2458_3408 | 315 |
| 276 | 3300046522 | Ga0495643_0000023 | Ga0495643_0000023_211241_212191 | 315 |
| 277 | 3300046616 | Ga0495668_0018768 | Ga0495668_0018768_93_1043 | 315 |
| 278 | 3300046660 | Ga0495625_0003785 | Ga0495625_0003785_5740_6690 | 315 |
| 279 | 3300047472 | Ga0495686_0010477 | Ga0495686_0010477_2189_3139 | 315 |
| 280 | 3300048090 | Ga0495615_0000331 | Ga0495615_0000331_1923_2873 | 315 |
| 281 | 3300048920 | Ga0496117_0043760 | Ga0496117_0043760_1866_2816 | 315 |
| 282 | 3300048921 | Ga0496118_0005723 | Ga0496118_0005723_7360_8310 | 315 |
| 283 | 3300048924 | Ga0496121_0000245 | Ga0496121_0000245_38195_39145 | 315 |
| 284 | 3300048925 | Ga0496122_0034514 | Ga0496122_0034514_878_1828 | 315 |
| 285 | 3300048926 | Ga0496123_0001983 | Ga0496123_0001983_25280_26230 | 315 |
| 286 | 3300048927 | Ga0496124_0000428 | Ga0496124_0000428_25603_26553 | 315 |
| 287 | 3300048927 | Ga0496124_0010991 | Ga0496124_0010991_6342_7292 | 315 |
| 288 | 3300048927 | Ga0496124_0033977 | Ga0496124_0033977_3360_4310 | 315 |
| 289 | 3300048928 | Ga0496125_0006812 | Ga0496125_0006812_7690_8640 | 315 |
| 290 | 3300048928 | Ga0496125_0104242 | Ga0496125_0104242_608_1558 | 315 |
| 291 | 3300048928 | Ga0496125_0177568 | Ga0496125_0177568_188_1138 | 315 |
| 292 | 3300048929 | Ga0496126_0005254 | Ga0496126_0005254_1834_2784 | 315 |
| 293 | 3300048929 | Ga0496126_0008958 | Ga0496126_0008958_3069_4019 | 315 |
| 294 | 3300049765 | Ga0501268_001146 | Ga0501268_001146_1436_2386 | 315 |
| 295 | 3300049822 | Ga0501035_0339190 | Ga0501035_0339190_171_1121 | 315 |
| 296 | 3300050490 | nmdc:mga03n38_6223_c1 | nmdc:mga03n38_6223_c1_3019_3969 | 315 |
| 297 | 3300050493 | nmdc:mga0k408_14143_c1 | nmdc:mga0k408_14143_c1_2410_3360 | 315 |
| 298 | 3300050493 | nmdc:mga0k408_53396_c1 | nmdc:mga0k408_53396_c1_134_1084 | 315 |
| 299 | 3300050494 | nmdc:mga06z11_43598_c1 | nmdc:mga06z11_43598_c1_54_1004 | 315 |
| 300 | 3300050494 | nmdc:mga06z11_52688_c1 | nmdc:mga06z11_52688_c1_742_1692 | 315 |
| 301 | 3300050508 | nmdc:mga09592_85184_c1 | nmdc:mga09592_85184_c1_274_1224 | 315 |
| 302 | 3300050509 | nmdc:mga0qj67_213502_c1 | nmdc:mga0qj67_213502_c1_503_1453 | 315 |
| 303 | 3300050509 | nmdc:mga0qj67_29207_c1 | nmdc:mga0qj67_29207_c1_2294_3244 | 315 |
| 304 | 3300050510 | nmdc:mga06r32_96787_c1 | nmdc:mga06r32_96787_c1_884_1834 | 315 |
| 305 | 3300050512 | nmdc:mga0n895_266507_c1 | nmdc:mga0n895_266507_c1_105_1055 | 315 |
| 306 | 3300050516 | nmdc:mga0sz30_17937_c1 | nmdc:mga0sz30_17937_c1_368_1318 | 315 |
| 307 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_1171444_1172394 | 315 |
| 308 | 3300053094 | Ga0500566_0024157 | Ga0500566_0024157_2479_3429 | 315 |
| 309 | 3300053099 | Ga0500654_084534 | Ga0500654_084534_164_1114 | 315 |
| 310 | 3300053108 | Ga0500562_004954 | Ga0500562_004954_1568_2518 | 315 |
| 311 | 3300053136 | Ga0500559_0027281 | Ga0500559_0027281_51_1001 | 315 |
| 312 | 3300053139 | Ga0500568_0003285 | Ga0500568_0003285_2166_3116 | 315 |
| 313 | 3300053139 | Ga0500568_0098191 | Ga0500568_0098191_97_1047 | 315 |
| 314 | 3300053146 | Ga0500588_0000167 | Ga0500588_0000167_2525_3475 | 315 |
| 315 | 3300003215 | JGI25153J46596_10000007 | JGI25153J46596_10000007187 | 316 |
| 316 | 3300003322 | rootL2_10194570 | rootL2_101945701 | 316 |
| 317 | 3300003791 | Ga0055530_10002045 | Ga0055530_100020458 | 316 |
| 318 | 3300003794 | Ga0055531_10000792 | Ga0055531_1000079224 | 316 |
| 319 | 3300005328 | Ga0070676_10081866 | Ga0070676_100818661 | 316 |
| 320 | 3300005347 | Ga0070668_100008374 | Ga0070668_1000083742 | 316 |
| 321 | 3300005353 | Ga0070669_100117011 | Ga0070669_1001170112 | 316 |
| 322 | 3300005356 | Ga0070674_100000123 | Ga0070674_10000012331 | 316 |
| 323 | 3300005367 | Ga0070667_100113364 | Ga0070667_1001133642 | 316 |
| 324 | 3300005564 | Ga0070664_100042088 | Ga0070664_1000420882 | 316 |
| 325 | 3300005616 | Ga0068852_100025737 | Ga0068852_1000257372 | 316 |
| 326 | 3300005844 | Ga0068862_100016259 | Ga0068862_1000162595 | 316 |
| 327 | 3300006058 | Ga0075432_10000669 | Ga0075432_100006695 | 316 |
| 328 | 3300006353 | Ga0075370_10001294 | Ga0075370_100012946 | 316 |
| 329 | 3300009036 | Ga0105244_10000473 | Ga0105244_100004737 | 316 |
| 330 | 3300009148 | Ga0105243_10003779 | Ga0105243_100037796 | 316 |
| 331 | 3300011119 | Ga0105246_10017860 | Ga0105246_100178605 | 316 |
| 332 | 3300015262 | Ga0182007_10003210 | Ga0182007_100032109 | 316 |
| 333 | 3300025254 | Ga0209148_1002232 | Ga0209148_10022322 | 316 |
| 334 | 3300025261 | Ga0209233_1029575 | Ga0209233_10295752 | 316 |
| 335 | 3300025297 | Ga0209758_1000017 | Ga0209758_1000017184 | 316 |
| 336 | 3300025298 | Ga0209050_1000071 | Ga0209050_10000713 | 316 |
| 337 | 3300025304 | Ga0209257_1000027 | Ga0209257_1000027300 | 316 |
| 338 | 3300025728 | Ga0207655_1003447 | Ga0207655_100344711 | 316 |
| 339 | 3300025923 | Ga0207681_10107908 | Ga0207681_101079082 | 316 |
| 340 | 3300025933 | Ga0207706_10012799 | Ga0207706_1001279910 | 316 |
| 341 | 3300025935 | Ga0207709_10007925 | Ga0207709_100079254 | 316 |
| 342 | 3300025937 | Ga0207669_10000155 | Ga0207669_100001553 | 316 |
| 343 | 3300025960 | Ga0207651_10087041 | Ga0207651_100870412 | 316 |
| 344 | 3300025972 | Ga0207668_10000851 | Ga0207668_100008516 | 316 |
| 345 | 3300026116 | Ga0207674_10207077 | Ga0207674_102070772 | 316 |
| 346 | 3300026142 | Ga0207698_10332766 | Ga0207698_103327662 | 316 |
| 347 | 3300027907 | Ga0207428_10043019 | Ga0207428_100430192 | 316 |
| 348 | 3300044658 | Ga0466972_0013292 | Ga0466972_0013292_1602_2555 | 316 |
| 349 | 3300044683 | Ga0466965_0009568 | Ga0466965_0009568_1796_2749 | 316 |
| 350 | 3300044684 | Ga0466966_0019939 | Ga0466966_0019939_401_1354 | 316 |
| 351 | 3300044684 | Ga0466966_0063375 | Ga0466966_0063375_244_1197 | 316 |
| 352 | 3300044765 | Ga0466970_0166567 | Ga0466970_0166567_146_1099 | 316 |
| 353 | 3300045049 | Ga0466959_0049628 | Ga0466959_0049628_1904_2857 | 316 |
| 354 | 3300046452 | Ga0495617_008002 | Ga0495617_008002_1464_2417 | 316 |
| 355 | 3300046453 | Ga0495627_001298 | Ga0495627_001298_1226_2179 | 316 |
| 356 | 3300046453 | Ga0495627_004382 | Ga0495627_004382_1891_2844 | 316 |
| 357 | 3300046458 | Ga0495591_006678 | Ga0495591_006678_2334_3287 | 316 |
| 358 | 3300046458 | Ga0495591_022618 | Ga0495591_022618_860_1813 | 316 |
| 359 | 3300046460 | Ga0495638_0000024 | Ga0495638_0000024_10625_11578 | 316 |
| 360 | 3300046460 | Ga0495638_0000667 | Ga0495638_0000667_30246_31199 | 316 |
| 361 | 3300046460 | Ga0495638_0002019 | Ga0495638_0002019_11020_11973 | 316 |
| 362 | 3300046460 | Ga0495638_0037607 | Ga0495638_0037607_1710_2663 | 316 |
| 363 | 3300046460 | Ga0495638_0157421 | Ga0495638_0157421_269_1222 | 316 |
| 364 | 3300046474 | Ga0495605_0013274 | Ga0495605_0013274_1200_2153 | 316 |
| 365 | 3300046474 | Ga0495605_0017184 | Ga0495605_0017184_1085_2038 | 316 |
| 366 | 3300046491 | Ga0495584_0048491 | Ga0495584_0048491_635_1588 | 316 |
| 367 | 3300046491 | Ga0495584_0078419 | Ga0495584_0078419_227_1180 | 316 |
| 368 | 3300046491 | Ga0495584_0123053 | Ga0495584_0123053_197_1150 | 316 |
| 369 | 3300046492 | Ga0495585_0000662 | Ga0495585_0000662_6217_7170 | 316 |
| 370 | 3300046492 | Ga0495585_0001580 | Ga0495585_0001580_6967_7920 | 316 |
| 371 | 3300046492 | Ga0495585_0001674 | Ga0495585_0001674_5072_6025 | 316 |
| 372 | 3300046492 | Ga0495585_0033133 | Ga0495585_0033133_879_1832 | 316 |
| 373 | 3300046500 | Ga0495596_0000239 | Ga0495596_0000239_27130_28083 | 316 |
| 374 | 3300046500 | Ga0495596_0005161 | Ga0495596_0005161_1488_2441 | 316 |
| 375 | 3300046500 | Ga0495596_0014157 | Ga0495596_0014157_1386_2339 | 316 |
| 376 | 3300046501 | Ga0495607_0011555 | Ga0495607_0011555_3492_4445 | 316 |
| 377 | 3300046501 | Ga0495607_0036654 | Ga0495607_0036654_1518_2471 | 316 |
| 378 | 3300046506 | Ga0495583_0009734 | Ga0495583_0009734_2671_3624 | 316 |
| 379 | 3300046506 | Ga0495583_0070648 | Ga0495583_0070648_228_1181 | 316 |
| 380 | 3300046507 | Ga0495606_0002139 | Ga0495606_0002139_17693_18646 | 316 |
| 381 | 3300046507 | Ga0495606_0007259 | Ga0495606_0007259_7297_8250 | 316 |
| 382 | 3300046512 | Ga0495610_0002036 | Ga0495610_0002036_10043_10996 | 316 |
| 383 | 3300046512 | Ga0495610_0005068 | Ga0495610_0005068_63_1016 | 316 |
| 384 | 3300046513 | Ga0495616_0001474 | Ga0495616_0001474_13707_14660 | 316 |
| 385 | 3300046513 | Ga0495616_0075802 | Ga0495616_0075802_282_1235 | 316 |
| 386 | 3300046515 | Ga0495620_0032809 | Ga0495620_0032809_324_1277 | 316 |
| 387 | 3300046518 | Ga0495631_0043116 | Ga0495631_0043116_759_1712 | 316 |
| 388 | 3300046518 | Ga0495631_0045295 | Ga0495631_0045295_453_1406 | 316 |
| 389 | 3300046518 | Ga0495631_0083442 | Ga0495631_0083442_220_1173 | 316 |
| 390 | 3300046518 | Ga0495631_0106991 | Ga0495631_0106991_61_1014 | 316 |
| 391 | 3300046519 | Ga0495632_0002599 | Ga0495632_0002599_5519_6472 | 316 |
| 392 | 3300046519 | Ga0495632_0005077 | Ga0495632_0005077_1324_2277 | 316 |
| 393 | 3300046519 | Ga0495632_0007114 | Ga0495632_0007114_5903_6856 | 316 |
| 394 | 3300046519 | Ga0495632_0031056 | Ga0495632_0031056_727_1680 | 316 |
| 395 | 3300046520 | Ga0495637_0005709 | Ga0495637_0005709_2260_3213 | 316 |
| 396 | 3300046522 | Ga0495643_0000504 | Ga0495643_0000504_42417_43370 | 316 |
| 397 | 3300046522 | Ga0495643_0000854 | Ga0495643_0000854_15377_16330 | 316 |
| 398 | 3300046522 | Ga0495643_0008470 | Ga0495643_0008470_3843_4796 | 316 |
| 399 | 3300046522 | Ga0495643_0027558 | Ga0495643_0027558_1062_2015 | 316 |
| 400 | 3300046522 | Ga0495643_0137535 | Ga0495643_0137535_61_1014 | 316 |
| 401 | 3300046524 | Ga0495648_0000005 | Ga0495648_0000005_10625_11578 | 316 |
| 402 | 3300046524 | Ga0495648_0000132 | Ga0495648_0000132_44818_45771 | 316 |
| 403 | 3300046524 | Ga0495648_0006475 | Ga0495648_0006475_8147_9100 | 316 |
| 404 | 3300046528 | Ga0495642_0000124 | Ga0495642_0000124_32481_33434 | 316 |
| 405 | 3300046530 | Ga0495654_0001496 | Ga0495654_0001496_1886_2839 | 316 |
| 406 | 3300046538 | Ga0495609_0023946 | Ga0495609_0023946_569_1522 | 316 |
| 407 | 3300046538 | Ga0495609_0055912 | Ga0495609_0055912_276_1229 | 316 |
| 408 | 3300046543 | Ga0495645_0225698 | Ga0495645_0225698_28_981 | 316 |
| 409 | 3300046558 | Ga0495633_0000843 | Ga0495633_0000843_11779_12732 | 316 |
| 410 | 3300046558 | Ga0495633_0032145 | Ga0495633_0032145_1225_2178 | 316 |
| 411 | 3300046616 | Ga0495668_0000013 | Ga0495668_0000013_307036_307989 | 316 |
| 412 | 3300046616 | Ga0495668_0002023 | Ga0495668_0002023_6902_7855 | 316 |
| 413 | 3300046648 | Ga0495611_0013144 | Ga0495611_0013144_1821_2774 | 316 |
| 414 | 3300046660 | Ga0495625_0002402 | Ga0495625_0002402_18024_18977 | 316 |
| 415 | 3300046660 | Ga0495625_0012111 | Ga0495625_0012111_3919_4872 | 316 |
| 416 | 3300046660 | Ga0495625_0033261 | Ga0495625_0033261_1071_2024 | 316 |
| 417 | 3300046660 | Ga0495625_0073339 | Ga0495625_0073339_996_1949 | 316 |
| 418 | 3300046660 | Ga0495625_0120658 | Ga0495625_0120658_138_1091 | 316 |
| 419 | 3300046665 | Ga0495661_0024159 | Ga0495661_0024159_1408_2361 | 316 |
| 420 | 3300046665 | Ga0495661_0159553 | Ga0495661_0159553_57_1010 | 316 |
| 421 | 3300046674 | Ga0495588_0000052 | Ga0495588_0000052_109903_110856 | 316 |
| 422 | 3300046684 | Ga0495669_0000023 | Ga0495669_0000023_63750_64703 | 316 |
| 423 | 3300046692 | Ga0495671_0013006 | Ga0495671_0013006_3382_4335 | 316 |
| 424 | 3300046692 | Ga0495671_0132465 | Ga0495671_0132465_191_1144 | 316 |
| 425 | 3300046694 | Ga0495649_0001618 | Ga0495649_0001618_5286_6239 | 316 |
| 426 | 3300046694 | Ga0495649_0020614 | Ga0495649_0020614_2471_3424 | 316 |
| 427 | 3300046694 | Ga0495649_0057574 | Ga0495649_0057574_500_1453 | 316 |
| 428 | 3300046694 | Ga0495649_0084329 | Ga0495649_0084329_205_1158 | 316 |
| 429 | 3300046810 | Ga0495660_0001780 | Ga0495660_0001780_6208_7161 | 316 |
| 430 | 3300046810 | Ga0495660_0015469 | Ga0495660_0015469_1878_2831 | 316 |
| 431 | 3300046810 | Ga0495660_0018256 | Ga0495660_0018256_1057_2010 | 316 |
| 432 | 3300047323 | Ga0495683_0008563 | Ga0495683_0008563_1388_2341 | 316 |
| 433 | 3300047323 | Ga0495683_0042074 | Ga0495683_0042074_499_1452 | 316 |
| 434 | 3300047443 | Ga0495687_000076 | Ga0495687_000076_58700_59653 | 316 |
| 435 | 3300047445 | Ga0495677_0000727 | Ga0495677_0000727_12084_13037 | 316 |
| 436 | 3300047445 | Ga0495677_0009066 | Ga0495677_0009066_2079_3032 | 316 |
| 437 | 3300047446 | Ga0495679_001065 | Ga0495679_001065_1494_2447 | 316 |
| 438 | 3300047446 | Ga0495679_002670 | Ga0495679_002670_1313_2266 | 316 |
| 439 | 3300047469 | Ga0495673_0002456 | Ga0495673_0002456_10989_11942 | 316 |
| 440 | 3300047469 | Ga0495673_0058369 | Ga0495673_0058369_170_1123 | 316 |
| 441 | 3300047470 | Ga0495681_0000193 | Ga0495681_0000193_42565_43518 | 316 |
| 442 | 3300047470 | Ga0495681_0108147 | Ga0495681_0108147_156_1109 | 316 |
| 443 | 3300047472 | Ga0495686_0002385 | Ga0495686_0002385_3172_4125 | 316 |
| 444 | 3300047472 | Ga0495686_0004991 | Ga0495686_0004991_8044_8997 | 316 |
| 445 | 3300048091 | Ga0495626_0001319 | Ga0495626_0001319_16888_17841 | 316 |
| 446 | 3300048091 | Ga0495626_0001856 | Ga0495626_0001856_1757_2710 | 316 |
| 447 | 3300048091 | Ga0495626_0003340 | Ga0495626_0003340_3698_4651 | 316 |
| 448 | 3300048920 | Ga0496117_0059367 | Ga0496117_0059367_672_1655 | 316 |
| 449 | 3300048921 | Ga0496118_0002940 | Ga0496118_0002940_10800_11753 | 316 |
| 450 | 3300048921 | Ga0496118_0039760 | Ga0496118_0039760_2332_3315 | 316 |
| 451 | 3300048926 | Ga0496123_0149660 | Ga0496123_0149660_286_1239 | 316 |
| 452 | 3300048927 | Ga0496124_0021151 | Ga0496124_0021151_3758_4741 | 316 |
| 453 | 3300048928 | Ga0496125_0156193 | Ga0496125_0156193_19_1002 | 316 |
| 454 | 3300049459 | Ga0495678_003232 | Ga0495678_003232_454_1407 | 316 |
| 455 | 3300049459 | Ga0495678_022694 | Ga0495678_022694_1093_2046 | 316 |
| 456 | 3300049459 | Ga0495678_025498 | Ga0495678_025498_496_1449 | 316 |
| 457 | 3300049459 | Ga0495678_037400 | Ga0495678_037400_722_1675 | 316 |
| 458 | 3300049766 | Ga0501269_000018 | Ga0501269_000018_20999_21952 | 316 |
| 459 | 3300050496 | nmdc:mga07m45_11144_c2 | nmdc:mga07m45_11144_c2_679_1662 | 316 |
| 460 | 3300053079 | Ga0500610_0000051 | Ga0500610_0000051_33572_34525 | 316 |
| 461 | 3300053092 | Ga0500583_0118294 | Ga0500583_0118294_190_1143 | 316 |
| 462 | 3300053130 | Ga0500642_0043986 | Ga0500642_0043986_351_1304 | 316 |
| 463 | 3300053131 | Ga0500652_000539 | Ga0500652_000539_3528_4481 | 316 |
| 464 | 3300053139 | Ga0500568_0003740 | Ga0500568_0003740_2009_2962 | 316 |
| 465 | 3300053145 | Ga0500586_050715 | Ga0500586_050715_46_999 | 316 |
| 466 | 3300053156 | Ga0500622_0000260 | Ga0500622_0000260_11639_12592 | 316 |
| 467 | 3300053730 | Ga0500645_000003 | Ga0500645_000003_160628_161581 | 316 |
| 468 | 3300053735 | Ga0500596_001962 | Ga0500596_001962_461_1444 | 316 |
| 469 | 3300002773 | JGI25152J39213_1000041 | JGI25152J39213_100004111 | 317 |
| 470 | 3300002774 | JGI25150J39212_1000399 | JGI25150J39212_100039910 | 317 |
| 471 | 3300003187 | JGI25151J46595_10000141 | JGI25151J46595_1000014172 | 317 |
| 472 | 3300003215 | JGI25153J46596_10000106 | JGI25153J46596_1000010672 | 317 |
| 473 | 3300003781 | Ga0055536_1000152 | Ga0055536_100015210 | 317 |
| 474 | 3300006946 | Ga0079104_1000357 | Ga0079104_100035739 | 317 |
| 475 | 3300009036 | Ga0105244_10015018 | Ga0105244_100150184 | 317 |
| 476 | 3300009092 | Ga0105250_10001210 | Ga0105250_100012107 | 317 |
| 477 | 3300013100 | Ga0157373_10019013 | Ga0157373_100190133 | 317 |
| 478 | 3300013100 | Ga0157373_10020187 | Ga0157373_100201875 | 317 |
| 479 | 3300013102 | Ga0157371_10109534 | Ga0157371_101095342 | 317 |
| 480 | 3300013105 | Ga0157369_10001616 | Ga0157369_1000161633 | 317 |
| 481 | 3300013105 | Ga0157369_10002918 | Ga0157369_1000291811 | 317 |
| 482 | 3300013105 | Ga0157369_10418692 | Ga0157369_104186922 | 317 |
| 483 | 3300013307 | Ga0157372_10007682 | Ga0157372_1000768211 | 317 |
| 484 | 3300014497 | Ga0182008_10003319 | Ga0182008_100033197 | 317 |
| 485 | 3300015265 | Ga0182005_1014080 | Ga0182005_10140802 | 317 |
| 486 | 3300017792 | Ga0163161_10001061 | Ga0163161_1000106112 | 317 |
| 487 | 3300025230 | Ga0209563_100523 | Ga0209563_1005236 | 317 |
| 488 | 3300025292 | Ga0209676_1000154 | Ga0209676_1000154154 | 317 |
| 489 | 3300025711 | Ga0207696_1000002 | Ga0207696_1000002170 | 317 |
| 490 | 3300025728 | Ga0207655_1004793 | Ga0207655_10047932 | 317 |
| 491 | 3300025735 | Ga0207713_1015091 | Ga0207713_10150912 | 317 |
| 492 | 3300025735 | Ga0207713_1015140 | Ga0207713_10151402 | 317 |
| 493 | 3300027111 | Ga0209281_1000630 | Ga0209281_100063019 | 317 |
| 494 | 3300027111 | Ga0209281_1002110 | Ga0209281_10021109 | 317 |
| 495 | 3300030735 | Ga0316178_1089777 | Ga0316178_10897775 | 317 |
| 496 | 3300031548 | Ga0307408_100022917 | Ga0307408_1000229173 | 317 |
| 497 | 3300031548 | Ga0307408_100129554 | Ga0307408_1001295543 | 317 |
| 498 | 3300031911 | Ga0307412_10171313 | Ga0307412_101713132 | 317 |
| 499 | 3300031911 | Ga0307412_10223991 | Ga0307412_102239912 | 317 |
| 500 | 3300031995 | Ga0307409_100276038 | Ga0307409_1002760382 | 317 |
| 501 | 3300032004 | Ga0307414_10034022 | Ga0307414_100340222 | 317 |
| 502 | 3300032004 | Ga0307414_10059268 | Ga0307414_100592682 | 317 |
| 503 | 3300032005 | Ga0307411_10010201 | Ga0307411_100102012 | 317 |
| 504 | 3300033180 | Ga0307510_10002229 | Ga0307510_1000222912 | 317 |
| 505 | 3300041405 | Ga0439438_000607 | Ga0439438_000607_6061_7017 | 317 |
| 506 | 3300041405 | Ga0439438_000671 | Ga0439438_000671_6269_7225 | 317 |
| 507 | 3300042006 | Ga0439432_000803 | Ga0439432_000803_10192_11148 | 317 |
| 508 | 3300042010 | Ga0439452_000704 | Ga0439452_000704_6474_7430 | 317 |
| 509 | 3300042013 | Ga0439456_000344 | Ga0439456_000344_538_1494 | 317 |
| 510 | 3300042016 | Ga0439463_025255 | Ga0439463_025255_24_980 | 317 |
| 511 | 3300042115 | Ga0450911_000334 | Ga0450911_000334_6284_7240 | 317 |
| 512 | 3300042136 | Ga0450900_000805 | Ga0450900_000805_523_1479 | 317 |
| 513 | 3300042138 | Ga0450903_002952 | Ga0450903_002952_91_1047 | 317 |
| 514 | 3300042139 | Ga0450904_001444 | Ga0450904_001444_2323_3279 | 317 |
| 515 | 3300042145 | Ga0450906_000267 | Ga0450906_000267_8904_9860 | 317 |
| 516 | 3300046452 | Ga0495617_007281 | Ga0495617_007281_2851_3807 | 317 |
| 517 | 3300046452 | Ga0495617_068358 | Ga0495617_068358_119_1075 | 317 |
| 518 | 3300046453 | Ga0495627_000415 | Ga0495627_000415_27964_28920 | 317 |
| 519 | 3300046453 | Ga0495627_030538 | Ga0495627_030538_366_1322 | 317 |
| 520 | 3300046457 | Ga0495590_0001415 | Ga0495590_0001415_2305_3261 | 317 |
| 521 | 3300046458 | Ga0495591_001632 | Ga0495591_001632_2742_3698 | 317 |
| 522 | 3300046458 | Ga0495591_050695 | Ga0495591_050695_60_1016 | 317 |
| 523 | 3300046460 | Ga0495638_0032020 | Ga0495638_0032020_863_1819 | 317 |
| 524 | 3300046474 | Ga0495605_0027957 | Ga0495605_0027957_1160_2116 | 317 |
| 525 | 3300046491 | Ga0495584_0003935 | Ga0495584_0003935_19_975 | 317 |
| 526 | 3300046491 | Ga0495584_0109622 | Ga0495584_0109622_407_1363 | 317 |
| 527 | 3300046500 | Ga0495596_0023431 | Ga0495596_0023431_446_1402 | 317 |
| 528 | 3300046500 | Ga0495596_0057177 | Ga0495596_0057177_329_1285 | 317 |
| 529 | 3300046501 | Ga0495607_0001249 | Ga0495607_0001249_8585_9541 | 317 |
| 530 | 3300046506 | Ga0495583_0005026 | Ga0495583_0005026_2153_3109 | 317 |
| 531 | 3300046507 | Ga0495606_0006849 | Ga0495606_0006849_7113_8069 | 317 |
| 532 | 3300046512 | Ga0495610_0003361 | Ga0495610_0003361_6986_7942 | 317 |
| 533 | 3300046513 | Ga0495616_0000853 | Ga0495616_0000853_12586_13542 | 317 |
| 534 | 3300046513 | Ga0495616_0001384 | Ga0495616_0001384_6753_7709 | 317 |
| 535 | 3300046513 | Ga0495616_0004044 | Ga0495616_0004044_5241_6197 | 317 |
| 536 | 3300046518 | Ga0495631_0000763 | Ga0495631_0000763_6837_7793 | 317 |
| 537 | 3300046519 | Ga0495632_0058529 | Ga0495632_0058529_822_1778 | 317 |
| 538 | 3300046520 | Ga0495637_0002729 | Ga0495637_0002729_32_988 | 317 |
| 539 | 3300046522 | Ga0495643_0010229 | Ga0495643_0010229_4008_4964 | 317 |
| 540 | 3300046523 | Ga0495644_0002641 | Ga0495644_0002641_6030_6986 | 317 |
| 541 | 3300046524 | Ga0495648_0001417 | Ga0495648_0001417_14610_15566 | 317 |
| 542 | 3300046524 | Ga0495648_0015463 | Ga0495648_0015463_587_1543 | 317 |
| 543 | 3300046530 | Ga0495654_0004577 | Ga0495654_0004577_7128_8084 | 317 |
| 544 | 3300046538 | Ga0495609_0014133 | Ga0495609_0014133_2783_3739 | 317 |
| 545 | 3300046616 | Ga0495668_0022554 | Ga0495668_0022554_2429_3385 | 317 |
| 546 | 3300046648 | Ga0495611_0000461 | Ga0495611_0000461_16235_17191 | 317 |
| 547 | 3300046660 | Ga0495625_0004272 | Ga0495625_0004272_7072_8028 | 317 |
| 548 | 3300046691 | Ga0495670_0000423 | Ga0495670_0000423_12240_13196 | 317 |
| 549 | 3300046694 | Ga0495649_0013693 | Ga0495649_0013693_3643_4599 | 317 |
| 550 | 3300046794 | Ga0495589_0011859 | Ga0495589_0011859_2776_3732 | 317 |
| 551 | 3300047446 | Ga0495679_001402 | Ga0495679_001402_6792_7748 | 317 |
| 552 | 3300047469 | Ga0495673_0005602 | Ga0495673_0005602_118_1074 | 317 |
| 553 | 3300047470 | Ga0495681_0000399 | Ga0495681_0000399_8380_9336 | 317 |
| 554 | 3300047470 | Ga0495681_0002038 | Ga0495681_0002038_6761_7717 | 317 |
| 555 | 3300047472 | Ga0495686_0080179 | Ga0495686_0080179_45_1001 | 317 |
| 556 | 3300048909 | Ga0496106_0161094 | Ga0496106_0161094_112_1068 | 317 |
| 557 | 3300048919 | Ga0496116_0001963 | Ga0496116_0001963_8534_9490 | 317 |
| 558 | 3300048919 | Ga0496116_0002731 | Ga0496116_0002731_7758_8714 | 317 |
| 559 | 3300048919 | Ga0496116_0003365 | Ga0496116_0003365_8224_9180 | 317 |
| 560 | 3300048920 | Ga0496117_0003450 | Ga0496117_0003450_9567_10523 | 317 |
| 561 | 3300048920 | Ga0496117_0066010 | Ga0496117_0066010_99_1055 | 317 |
| 562 | 3300048920 | Ga0496117_0066012 | Ga0496117_0066012_99_1055 | 317 |
| 563 | 3300048921 | Ga0496118_0003912 | Ga0496118_0003912_9395_10351 | 317 |
| 564 | 3300048921 | Ga0496118_0014720 | Ga0496118_0014720_5610_6566 | 317 |
| 565 | 3300048922 | Ga0496119_0129374 | Ga0496119_0129374_223_1179 | 317 |
| 566 | 3300048922 | Ga0496119_0147422 | Ga0496119_0147422_223_1179 | 317 |
| 567 | 3300048923 | Ga0496120_0044973 | Ga0496120_0044973_1033_1989 | 317 |
| 568 | 3300048923 | Ga0496120_0150847 | Ga0496120_0150847_49_1005 | 317 |
| 569 | 3300048924 | Ga0496121_0004887 | Ga0496121_0004887_8445_9401 | 317 |
| 570 | 3300048926 | Ga0496123_0004425 | Ga0496123_0004425_5160_6116 | 317 |
| 571 | 3300048927 | Ga0496124_0049940 | Ga0496124_0049940_2526_3482 | 317 |
| 572 | 3300048928 | Ga0496125_0105544 | Ga0496125_0105544_352_1308 | 317 |
| 573 | 3300049459 | Ga0495678_001646 | Ga0495678_001646_6775_7731 | 317 |
| 574 | 3300049459 | Ga0495678_038043 | Ga0495678_038043_51_1007 | 317 |
| 575 | 3300049460 | Ga0495682_0003730 | Ga0495682_0003730_37_993 | 317 |
| 576 | 3300049758 | Ga0501241_000548 | Ga0501241_000548_6268_7224 | 317 |
| 577 | 3300053136 | Ga0500559_0000801 | Ga0500559_0000801_11390_12346 | 317 |
| 578 | 2162886007 | SwRhRL2b_contig_351495 | SwRhRL2b_0752.00006830 | 318 |
| 579 | 3300003794 | Ga0055531_10001376 | Ga0055531_1000137612 | 318 |
| 580 | 3300005614 | Ga0068856_100006764 | Ga0068856_1000067642 | 318 |
| 581 | 3300012497 | Ga0157319_1000024 | Ga0157319_100002457 | 318 |
| 582 | 3300015690 | Ga0183363_1001 | Ga0183363_1001183 | 318 |
| 583 | 3300025299 | Ga0209256_1000075 | Ga0209256_100007580 | 318 |
| 584 | 3300025304 | Ga0209257_1000244 | Ga0209257_100024471 | 318 |
| 585 | 3300042127 | Ga0450890_005181 | Ga0450890_005181_628_1596 | 318 |
| 586 | 3300046455 | Ga0495603_0020632 | Ga0495603_0020632_1778_2737 | 318 |
| 587 | 3300046459 | Ga0495629_0035886 | Ga0495629_0035886_1769_2728 | 318 |
| 588 | 3300046459 | Ga0495629_0070388 | Ga0495629_0070388_911_1870 | 318 |
| 589 | 3300046462 | Ga0495651_0081247 | Ga0495651_0081247_985_1944 | 318 |
| 590 | 3300046471 | Ga0495650_0017013 | Ga0495650_0017013_911_1870 | 318 |
| 591 | 3300046471 | Ga0495650_0018859 | Ga0495650_0018859_1492_2451 | 318 |
| 592 | 3300046473 | Ga0495582_0057168 | Ga0495582_0057168_387_1346 | 318 |
| 593 | 3300046475 | Ga0495639_0006701 | Ga0495639_0006701_3488_4447 | 318 |
| 594 | 3300046477 | Ga0495664_0008429 | Ga0495664_0008429_3339_4298 | 318 |
| 595 | 3300046477 | Ga0495664_0023769 | Ga0495664_0023769_821_1780 | 318 |
| 596 | 3300046499 | Ga0495594_0081438 | Ga0495594_0081438_174_1133 | 318 |
| 597 | 3300046500 | Ga0495596_0049873 | Ga0495596_0049873_190_1149 | 318 |
| 598 | 3300046506 | Ga0495583_0067590 | Ga0495583_0067590_290_1249 | 318 |
| 599 | 3300046528 | Ga0495642_0008925 | Ga0495642_0008925_1901_2860 | 318 |
| 600 | 3300046528 | Ga0495642_0030372 | Ga0495642_0030372_533_1492 | 318 |
| 601 | 3300046529 | Ga0495652_0094318 | Ga0495652_0094318_1302_2261 | 318 |
| 602 | 3300046530 | Ga0495654_0019265 | Ga0495654_0019265_541_1509 | 318 |
| 603 | 3300046531 | Ga0495665_0045911 | Ga0495665_0045911_387_1346 | 318 |
| 604 | 3300046535 | Ga0495586_0021869 | Ga0495586_0021869_1436_2395 | 318 |
| 605 | 3300046543 | Ga0495645_0025923 | Ga0495645_0025923_1355_2314 | 318 |
| 606 | 3300046615 | Ga0495656_0085258 | Ga0495656_0085258_367_1326 | 318 |
| 607 | 3300046660 | Ga0495625_0007729 | Ga0495625_0007729_8194_9153 | 318 |
| 608 | 3300046675 | Ga0495657_0080587 | Ga0495657_0080587_108_1067 | 318 |
| 609 | 3300046680 | Ga0495646_0052155 | Ga0495646_0052155_1466_2425 | 318 |
| 610 | 3300046809 | Ga0495600_0055261 | Ga0495600_0055261_888_1847 | 318 |
| 611 | 3300047315 | Ga0495581_0015925 | Ga0495581_0015925_1934_2893 | 318 |
| 612 | 3300047319 | Ga0495674_0063285 | Ga0495674_0063285_1264_2223 | 318 |
| 613 | 3300047322 | Ga0495680_0037415 | Ga0495680_0037415_606_1565 | 318 |
| 614 | 3300047323 | Ga0495683_0032485 | Ga0495683_0032485_1052_2011 | 318 |
| 615 | 3300047446 | Ga0495679_032553 | Ga0495679_032553_299_1258 | 318 |
| 616 | 3300047470 | Ga0495681_0071737 | Ga0495681_0071737_219_1178 | 318 |
| 617 | 3300047673 | Ga0495593_0001825 | Ga0495593_0001825_8111_9070 | 318 |
| 618 | 3300048089 | Ga0495614_0015130 | Ga0495614_0015130_198_1157 | 318 |
| 619 | 3300048903 | Ga0496100_0066192 | Ga0496100_0066192_1334_2293 | 318 |
| 620 | 3300048905 | Ga0496102_0139130 | Ga0496102_0139130_795_1754 | 318 |
| 621 | 3300048907 | Ga0496104_0130283 | Ga0496104_0130283_640_1599 | 318 |
| 622 | 3300048911 | Ga0496108_0091990 | Ga0496108_0091990_1187_2146 | 318 |
| 623 | 3300048927 | Ga0496124_0141966 | Ga0496124_0141966_131_1090 | 318 |
| 624 | 3300049679 | Ga0501249_000131 | Ga0501249_000131_1812_2771 | 318 |
| 625 | 3300049766 | Ga0501269_000801 | Ga0501269_000801_123_1082 | 318 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5g5h-assembly1.cif.gz_B | escherichia coli periplasmic aldehyde oxidase r440h mutant | 0.9057 | 1 | 314 |
| 5g5h-assembly1.cif.gz_B | escherichia coli periplasmic aldehyde oxidase r440h mutant | 0.8975 | 1 | 314 |
| 5y6q-assembly1.cif.gz_B | crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 | 0.8277 | 1 | 318 |
| 5y6q-assembly1.cif.gz_B | crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 | 0.8253 | 1 | 318 |
| 4zoh-assembly1.cif.gz_B-2 | crystal structure of glyceraldehyde oxidoreductase | 0.7995 | 2 | 313 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77324_1_53_3.30.43.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9681 | 1 | 53 | 3.30.43.10 |
| af_P77324_1_53_3.30.43.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9505 | 1 | 53 | 3.30.43.10 |
| 1ffuF01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.9175 | 2 | 51 | 3.30.43.10 |
| 1t3qF01 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 | 0.915 | 2 | 51 | 3.30.43.10 |
| 5g5hB02 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain | 0.91 | 223 | 314 | 3.30.390.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F0BL63-F1-model_v4 | Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein | 0.9485 | 165 | 314 |
GO:0016491
GO:0050660 |
| AF-J1SLT6-F1-model_v4 | Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein | 0.9334 | 141 | 314 |
GO:0016491
GO:0050660 |
| AF-F0BL63-F1-model_v4 | Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein | 0.9302 | 165 | 314 |
GO:0016491
GO:0050660 |
| AF-J1SLT6-F1-model_v4 | Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein | 0.9179 | 141 | 314 |
GO:0016491
GO:0050660 |
| AF-F0BL62-F1-model_v4 | Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM-like protein | 0.9148 | 1 | 102 |
GO:0016491
GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar