F470359

General Info

Members Datasets Scaffolds Average Seq Length
625 273 1250 245

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10517656|Ga0105248_105176562
Length 212
Sequence VSAVYILWLRELKRYSRSRAQIIASLGQPILYLVAFGFGFRSVFQRAGLGNSVQFIAPGVVGMSMLFSSVFSGIGLLWDRQFGFLKETLVAPVPRLYIMAGRTLGGATIAFIQGAMVFVVCLIAGFRPASLAMVPVALLFALGTAIGSSLQSMQAFPIVMNFLVMPIFFLSGALFPLNGLPVGMAVATRLDPLTYGIDGLRGAFIGVSHLGT

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
267 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
268 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.28
Nodule 0
Rhizoplane 3.36
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 9.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10517656 3300009177 Bacteria 1345
2 JGI24751J29686_10026306 3300002459 Bacteria 1207
3 Ga0065704_10132450 3300005289 Bacteria 1612
4 Ga0065712_10008015 3300005290 Bacteria 2966
5 Ga0065712_10070089 3300005290 Bacteria 6340
6 Ga0065715_10007867 3300005293 Bacteria 2745
7 Ga0065715_10016431 3300005293 Bacteria 2699
8 Ga0065715_10091908 3300005293 Bacteria 5469
9 Ga0065715_10107005 3300005293 Bacteria 2784
10 Ga0065715_10126295 3300005293 Bacteria 2111
11 Ga0065715_10162741 3300005293 Bacteria 1614
12 Ga0065715_10300759 3300005293 Bacteria 1041
13 Ga0065707_10001489 3300005295 Bacteria 8230
14 Ga0070676_10109938 3300005328 Unclassified 1715
15 Ga0070683_100010352 3300005329 Bacteria 8021
16 Ga0070683_100092908 3300005329 Bacteria 2834
17 Ga0070690_100004917 3300005330 Bacteria 7474
18 Ga0070670_100003870 3300005331 Bacteria 12483
19 Ga0070670_100039116 3300005331 Bacteria 4078
20 Ga0070670_100481399 3300005331 Bacteria 1102
21 Ga0070670_100575892 3300005331 Bacteria 1006
22 Ga0068869_100028187 3300005334 Bacteria 3922
23 Ga0070666_10007317 3300005335 Bacteria 6801
24 Ga0070666_10008769 3300005335 Bacteria 6286
25 Ga0070666_10020706 3300005335 Bacteria 4255
26 Ga0070682_100201844 3300005337 Bacteria 1403
27 Ga0070682_100258058 3300005337 Unclassified 1260
28 Ga0068868_100005278 3300005338 Bacteria 9074
29 Ga0068868_100048637 3300005338 Bacteria 3326
30 Ga0070689_100014307 3300005340 Bacteria 5761
31 Ga0070689_100042290 3300005340 Bacteria 3499
32 Ga0070689_100139052 3300005340 Bacteria 1952
33 Ga0070689_100666535 3300005340 Unclassified 906
34 Ga0070661_100018189 3300005344 Bacteria 4993
35 Ga0070661_100040306 3300005344 Bacteria 3407
36 Ga0070661_100050404 3300005344 Bacteria 3046
37 Ga0070669_100000753 3300005353 Bacteria 23583
38 Ga0070669_100569238 3300005353 Bacteria 946
39 Ga0070675_100009226 3300005354 Bacteria 7662
40 Ga0070675_100080217 3300005354 Bacteria 2720
41 Ga0070675_100387780 3300005354 Bacteria 1244
42 Ga0070671_100004176 3300005355 Bacteria 11419
43 Ga0070671_100009302 3300005355 Bacteria 7889
44 Ga0070674_100005811 3300005356 Bacteria 7164
45 Ga0070674_100118630 3300005356 Bacteria 1955
46 Ga0070673_100017403 3300005364 Bacteria 5110
47 Ga0070673_100390231 3300005364 Bacteria 1243
48 Ga0070688_100093504 3300005365 Unclassified 1969
49 Ga0070688_100285249 3300005365 Bacteria 1188
50 Ga0070659_100425957 3300005366 Bacteria 1123
51 Ga0070667_100001912 3300005367 Bacteria 18482
52 Ga0070667_100070357 3300005367 Bacteria 2978
53 Ga0070667_100100263 3300005367 Unclassified 2501
54 Ga0070701_10039938 3300005438 Bacteria 2383
55 Ga0070711_100297961 3300005439 Unclassified 1281
56 Ga0070705_100099070 3300005440 Unclassified 1836
57 Ga0070705_100281963 3300005440 Bacteria 1182
58 Ga0070700_100000757 3300005441 Bacteria 15947
59 Ga0070700_100066052 3300005441 Bacteria 2295
60 Ga0070700_100685300 3300005441 Bacteria 813
61 Ga0070694_100125751 3300005444 Bacteria 1845
62 Ga0070663_100017312 3300005455 Bacteria 4702
63 Ga0070663_100060560 3300005455 Bacteria 2723
64 Ga0070678_100555007 3300005456 Bacteria 1020
65 Ga0070678_100706293 3300005456 Bacteria 909
66 Ga0070662_100542226 3300005457 Unclassified 974
67 Ga0070662_100668972 3300005457 Bacteria 877
68 Ga0070681_10087996 3300005458 Bacteria 3058
69 Ga0070681_10649109 3300005458 Bacteria 970
70 Ga0070706_100187384 3300005467 Bacteria 1933
71 Ga0070707_100000707 3300005468 Bacteria 33278
72 Ga0070707_100007749 3300005468 Bacteria 9977
73 Ga0070707_100073818 3300005468 Bacteria 3289
74 Ga0070707_100587337 3300005468 Bacteria 1076
75 Ga0070699_100034738 3300005518 Bacteria 4356
76 Ga0070699_100405952 3300005518 Bacteria 1232
77 Ga0070679_100234831 3300005530 Bacteria 1793
78 Ga0070684_100001218 3300005535 Bacteria 18489
79 Ga0070672_100257793 3300005543 Bacteria 1470
80 Ga0070672_100331280 3300005543 Archaea 1295
81 Ga0070672_100533294 3300005543 Bacteria 1018
82 Ga0070672_100629298 3300005543 Archaea 936
83 Ga0070695_100222034 3300005545 Bacteria 1362
84 Ga0070696_100062371 3300005546 Bacteria 2609
85 Ga0070693_100322599 3300005547 Unclassified 1048
86 Ga0070665_100000496 3300005548 Bacteria 56280
87 Ga0070665_100008596 3300005548 Bacteria 10330
88 Ga0070704_100004317 3300005549 Bacteria 8216
89 Ga0070704_100180787 3300005549 Bacteria 1687
90 Ga0070704_100397391 3300005549 Bacteria 1175
91 Ga0068855_100028309 3300005563 Bacteria 6702
92 Ga0070664_100007454 3300005564 Bacteria 8833
93 Ga0070664_100018865 3300005564 Bacteria 5670
94 Ga0070664_100049035 3300005564 Bacteria 3570
95 Ga0070664_100060068 3300005564 Bacteria 3236
96 Ga0070664_100139367 3300005564 Bacteria 2135
97 Ga0068857_100011755 3300005577 Bacteria 7611
98 Ga0068857_100075379 3300005577 Bacteria 3008
99 Ga0068857_100423247 3300005577 Unclassified 1242
100 Ga0068854_100370167 3300005578 Bacteria 1178
101 Ga0068856_100001805 3300005614 Bacteria 22343
102 Ga0068856_100022778 3300005614 Bacteria 6091
103 Ga0068856_100714015 3300005614 Unclassified 1023
104 Ga0068852_100077649 3300005616 Bacteria 2936
105 Ga0068852_100087023 3300005616 Bacteria 2786
106 Ga0068859_100026361 3300005617 Bacteria 5827
107 Ga0068859_100036629 3300005617 Bacteria 4925
108 Ga0068859_100070053 3300005617 Bacteria 3542
109 Ga0068859_100096135 3300005617 Bacteria 3015
110 Ga0068859_100458891 3300005617 Bacteria 1370
111 Ga0068864_100504450 3300005618 Bacteria 1164
112 Ga0068864_100803528 3300005618 Bacteria 924
113 Ga0068861_100013889 3300005719 Bacteria 5644
114 Ga0068861_100379650 3300005719 Bacteria 1248
115 Ga0068861_100399040 3300005719 Unclassified 1220
116 Ga0068861_100575583 3300005719 Bacteria 1030
117 Ga0068851_10026983 3300005834 Bacteria 2827
118 Ga0068851_10132484 3300005834 Bacteria 1349
119 Ga0068851_10133716 3300005834 Bacteria 1343
120 Ga0068863_100002139 3300005841 Bacteria 19603
121 Ga0068863_100011399 3300005841 Bacteria 8602
122 Ga0068863_100079747 3300005841 Bacteria 3100
123 Ga0068863_100193624 3300005841 Bacteria 1954
124 Ga0068863_100308347 3300005841 Bacteria 1536
125 Ga0068863_100381498 3300005841 Bacteria 1376
126 Ga0068858_100009014 3300005842 Bacteria 9543
127 Ga0068858_100094880 3300005842 Bacteria 2779
128 Ga0068858_100146181 3300005842 Bacteria 2220
129 Ga0068860_100018879 3300005843 Bacteria 6699
130 Ga0068860_100024770 3300005843 Bacteria 5796
131 Ga0068862_100010077 3300005844 Bacteria 7802
132 Ga0068862_100039335 3300005844 Bacteria 4016
133 Ga0068862_100234190 3300005844 Bacteria 1667
134 Ga0068862_100248693 3300005844 Unclassified 1620
135 Ga0081455_10003552 3300005937 Bacteria 17896
136 Ga0081455_10188473 3300005937 Bacteria 1556
137 Ga0081540_1090721 3300005983 Bacteria 1345
138 Ga0081539_10023231 3300005985 Bacteria 4069
139 Ga0070715_10067009 3300006163 Bacteria 1593
140 Ga0070712_100125170 3300006175 Bacteria 1940
141 Ga0075367_10006204 3300006178 Bacteria 6020
142 Ga0097621_100007210 3300006237 Bacteria 7933
143 Ga0097621_100012508 3300006237 Bacteria 6296
144 Ga0097621_100067863 3300006237 Bacteria 2940
145 Ga0097621_100088450 3300006237 Bacteria 2588
146 Ga0097621_100091559 3300006237 Bacteria 2545
147 Ga0097621_100116347 3300006237 Unclassified 2264
148 Ga0068871_100115913 3300006358 Unclassified 2258
149 Ga0068871_100116720 3300006358 Unclassified 2250
150 Ga0075428_100001699 3300006844 Bacteria 23490
151 Ga0075428_100003643 3300006844 Bacteria 16890
152 Ga0075428_100024691 3300006844 Bacteria 6651
153 Ga0075428_100026191 3300006844 Bacteria 6458
154 Ga0075428_100029031 3300006844 Bacteria 6121
155 Ga0075430_100004720 3300006846 Bacteria 11459
156 Ga0075430_100024591 3300006846 Bacteria 5123
157 Ga0075430_100162420 3300006846 Bacteria 1859
158 Ga0075430_100165978 3300006846 Bacteria 1837
159 Ga0075430_100556038 3300006846 Bacteria 946
160 Ga0075431_100000275 3300006847 Bacteria 39941
161 Ga0075431_100001487 3300006847 Bacteria 21652
162 Ga0075431_100003529 3300006847 Bacteria 15162
163 Ga0075431_100031428 3300006847 Bacteria 5468
164 Ga0075431_100197583 3300006847 Bacteria 2059
165 Ga0075433_10094613 3300006852 Unclassified 2644
166 Ga0075433_10337434 3300006852 Bacteria 1332
167 Ga0075433_10463925 3300006852 Bacteria 1116
168 Ga0075433_10575632 3300006852 Unclassified 989
169 Ga0075434_100004994 3300006871 Bacteria 12040
170 Ga0075434_100008866 3300006871 Bacteria 9364
171 Ga0075434_100609008 3300006871 Unclassified 1111
172 Ga0075429_100002658 3300006880 Bacteria 15038
173 Ga0075429_100004667 3300006880 Bacteria 11796
174 Ga0075429_100008631 3300006880 Bacteria 8864
175 Ga0075429_100065774 3300006880 Bacteria 3156
176 Ga0075429_100396041 3300006880 Bacteria 1209
177 Ga0075429_100536987 3300006880 Bacteria 1025
178 Ga0075436_100008792 3300006914 Bacteria 6907
179 Ga0075436_100266794 3300006914 Bacteria 1222
180 Ga0097620_100026360 3300006931 Bacteria 5827
181 Ga0097620_100036627 3300006931 Bacteria 4925
182 Ga0097620_100070049 3300006931 Bacteria 3542
183 Ga0097620_100096127 3300006931 Bacteria 3015
184 Ga0097620_100458907 3300006931 Bacteria 1370
185 Ga0075435_100031891 3300007076 Bacteria 4157
186 Ga0075435_100038212 3300007076 Unclassified 3827
187 Ga0075435_100196374 3300007076 Bacteria 1709
188 Ga0075435_100241387 3300007076 Bacteria 1537
189 Ga0111539_10000056 3300009094 Bacteria 114878
190 Ga0111539_10004761 3300009094 Bacteria 17715
191 Ga0111539_10013833 3300009094 Bacteria 10087
192 Ga0111539_10020590 3300009094 Bacteria 8123
193 Ga0111539_10025777 3300009094 Bacteria 7200
194 Ga0111539_10029639 3300009094 Bacteria 6661
195 Ga0111539_10079222 3300009094 Bacteria 3864
196 Ga0111539_10138344 3300009094 Bacteria 2852
197 Ga0111539_10765522 3300009094 Bacteria 1124
198 Ga0105245_10029059 3300009098 Bacteria 4882
199 Ga0105245_10460125 3300009098 Unclassified 1282
200 Ga0105247_10006013 3300009101 Bacteria 7556
201 Ga0114129_10001009 3300009147 Bacteria 36681
202 Ga0114129_10003006 3300009147 Bacteria 23632
203 Ga0114129_10003920 3300009147 Bacteria 21000
204 Ga0114129_10006539 3300009147 Bacteria 16538
205 Ga0114129_10189984 3300009147 Bacteria 2790
206 Ga0114129_10195322 3300009147 Bacteria 2744
207 Ga0114129_10546264 3300009147 Bacteria 1507
208 Ga0105241_10058092 3300009174 Bacteria 2970
209 Ga0105242_10042724 3300009176 Bacteria 3663
210 Ga0105242_10171792 3300009176 Bacteria 1906
211 Ga0105242_10302032 3300009176 Bacteria 1461
212 Ga0105242_10753525 3300009176 Unclassified 959
213 Ga0105248_10006041 3300009177 Bacteria 13288
214 Ga0105248_10101604 3300009177 Bacteria 3241
215 Ga0105248_10133891 3300009177 Bacteria 2796
216 Ga0105248_10386978 3300009177 Bacteria 1575
217 Ga0105248_10477213 3300009177 Bacteria 1406
218 Ga0105248_11140232 3300009177 Bacteria 881
219 Ga0105237_10075044 3300009545 Bacteria 3373
220 Ga0105237_10732037 3300009545 Bacteria 995
221 Ga0105238_10025693 3300009551 Bacteria 6004
222 Ga0105238_10569901 3300009551 Bacteria 1138
223 Ga0105249_10026046 3300009553 Bacteria 5267
224 Ga0105249_10041833 3300009553 Bacteria 4166
225 Ga0105249_10055929 3300009553 Bacteria 3612
226 Ga0105249_10148917 3300009553 Bacteria 2251
227 Ga0105249_10224648 3300009553 Bacteria 1849
228 Ga0105239_10237465 3300010375 Bacteria 2046
229 Ga0105246_10004120 3300011119 Bacteria 8818
230 Ga0105246_10270185 3300011119 Bacteria 1359
231 Ga0157373_10063355 3300013100 Bacteria 2618
232 Ga0157373_10131849 3300013100 Bacteria 1757
233 Ga0157371_10062981 3300013102 Bacteria 2629
234 Ga0157370_10147906 3300013104 Bacteria 2187
235 Ga0157370_10152633 3300013104 Bacteria 2149
236 Ga0157370_10636999 3300013104 Unclassified 975
237 Ga0157369_10005373 3300013105 Bacteria 14914
238 Ga0157374_10003744 3300013296 Bacteria 12781
239 Ga0157374_10023027 3300013296 Bacteria 5565
240 Ga0157374_10036786 3300013296 Bacteria 4487
241 Ga0157374_10048240 3300013296 Bacteria 3951
242 Ga0157374_10123741 3300013296 Bacteria 2498
243 Ga0157374_10264891 3300013296 Bacteria 1694
244 Ga0157378_10002804 3300013297 Bacteria 15536
245 Ga0157378_10152322 3300013297 Bacteria 2155
246 Ga0157378_10160086 3300013297 Unclassified 2105
247 Ga0157378_10166087 3300013297 Unclassified 2068
248 Ga0157378_10197119 3300013297 Bacteria 1903
249 Ga0157378_10494519 3300013297 Unclassified 1221
250 Ga0157378_10550343 3300013297 Bacteria 1159
251 Ga0163162_10022648 3300013306 Bacteria 6193
252 Ga0163162_10052504 3300013306 Bacteria 4094
253 Ga0163162_10165422 3300013306 Bacteria 2335
254 Ga0163162_10237806 3300013306 Unclassified 1952
255 Ga0163162_10272732 3300013306 Bacteria 1824
256 Ga0163162_10524362 3300013306 Bacteria 1314
257 Ga0163162_10549170 3300013306 Bacteria 1284
258 Ga0157372_10056725 3300013307 Bacteria 4376
259 Ga0157372_10140329 3300013307 Bacteria 2784
260 Ga0157372_10244530 3300013307 Bacteria 2082
261 Ga0157375_10002031 3300013308 Bacteria 17460
262 Ga0157375_10037060 3300013308 Bacteria 4669
263 Ga0157375_10107822 3300013308 Bacteria 2879
264 Ga0163163_10011286 3300014325 Bacteria 8097
265 Ga0163163_10067535 3300014325 Bacteria 3555
266 Ga0163163_10376293 3300014325 Unclassified 1477
267 Ga0163163_10568640 3300014325 Bacteria 1196
268 Ga0157380_10013328 3300014326 Bacteria 5991
269 Ga0157380_10020013 3300014326 Bacteria 4996
270 Ga0157380_10436426 3300014326 Unclassified 1253
271 Ga0157380_10786473 3300014326 Bacteria 967
272 Ga0157379_10044667 3300014968 Bacteria 3955
273 Ga0157379_10095110 3300014968 Bacteria 2673
274 Ga0157379_10335499 3300014968 Unclassified 1382
275 Ga0157379_10571747 3300014968 Unclassified 1053
276 Ga0157376_10000032 3300014969 Bacteria 167294
277 Ga0157376_10000629 3300014969 Bacteria 22878
278 Ga0157376_10013950 3300014969 Bacteria 6011
279 Ga0157376_10098697 3300014969 Bacteria 2546
280 Ga0157376_10121666 3300014969 Bacteria 2314
281 Ga0157376_10135480 3300014969 Unclassified 2203
282 Ga0157376_10270732 3300014969 Archaea 1595
283 Ga0163161_10011698 3300017792 Bacteria 6089
284 Ga0213876_10000945 3300021384 Bacteria 19137
285 Ga0213876_10053021 3300021384 Bacteria 2143
286 Ga0207697_10015188 3300025315 Bacteria 3185
287 Ga0207656_10094799 3300025321 Bacteria 1360
288 Ga0207656_10096449 3300025321 Bacteria 1350
289 Ga0207682_10175859 3300025893 Bacteria 976
290 Ga0207710_10012248 3300025900 Bacteria 3608
291 Ga0207688_10034245 3300025901 Bacteria 2812
292 Ga0207688_10243898 3300025901 Bacteria 1087
293 Ga0207680_10031286 3300025903 Bacteria 3013
294 Ga0207680_10041205 3300025903 Bacteria 2692
295 Ga0207680_10069024 3300025903 Bacteria 2183
296 Ga0207647_10211936 3300025904 Bacteria 1118
297 Ga0207707_10011081 3300025912 Bacteria 7841
298 Ga0207663_10319668 3300025916 Unclassified 1166
299 Ga0207663_10633217 3300025916 Unclassified 843
300 Ga0207662_10045824 3300025918 Bacteria 2585
301 Ga0207657_10022053 3300025919 Bacteria 5977
302 Ga0207649_10016523 3300025920 Bacteria 4165
303 Ga0207649_10127136 3300025920 Bacteria 1726
304 Ga0207646_10000236 3300025922 Bacteria 76096
305 Ga0207646_10001982 3300025922 Bacteria 24583
306 Ga0207646_10348612 3300025922 Bacteria 1338
307 Ga0207681_10018736 3300025923 Bacteria 4365
308 Ga0207681_10239708 3300025923 Bacteria 1411
309 Ga0207694_10015625 3300025924 Bacteria 5726
310 Ga0207650_10008841 3300025925 Bacteria 6882
311 Ga0207650_10010891 3300025925 Bacteria 6250
312 Ga0207650_10016067 3300025925 Bacteria 5225
313 Ga0207650_10087508 3300025925 Bacteria 2374
314 Ga0207650_10247980 3300025925 Bacteria 1441
315 Ga0207687_10269109 3300025927 Bacteria 1361
316 Ga0207644_10045956 3300025931 Bacteria 3108
317 Ga0207644_10181009 3300025931 Bacteria 1652
318 Ga0207644_10222979 3300025931 Bacteria 1495
319 Ga0207690_10095709 3300025932 Bacteria 2110
320 Ga0207690_10119901 3300025932 Bacteria 1909
321 Ga0207706_10069054 3300025933 Unclassified 3108
322 Ga0207706_10365395 3300025933 Bacteria 1254
323 Ga0207706_10381567 3300025933 Bacteria 1223
324 Ga0207706_10535258 3300025933 Bacteria 1009
325 Ga0207686_10185596 3300025934 Bacteria 1478
326 Ga0207686_10334553 3300025934 Unclassified 1135
327 Ga0207670_10290416 3300025936 Unclassified 1277
328 Ga0207670_10592356 3300025936 Unclassified 910
329 Ga0207669_10002438 3300025937 Bacteria 7933
330 Ga0207669_10141765 3300025937 Bacteria 1669
331 Ga0207704_10332496 3300025938 Bacteria 1176
332 Ga0207665_10180206 3300025939 Unclassified 1530
333 Ga0207691_10151560 3300025940 Bacteria 2038
334 Ga0207691_10165848 3300025940 Bacteria 1936
335 Ga0207691_10243298 3300025940 Unclassified 1555
336 Ga0207711_10000578 3300025941 Bacteria 37304
337 Ga0207711_10038931 3300025941 Bacteria 4043
338 Ga0207711_10104205 3300025941 Bacteria 2513
339 Ga0207711_10141670 3300025941 Bacteria 2164
340 Ga0207711_10168778 3300025941 Bacteria 1985
341 Ga0207689_10287569 3300025942 Bacteria 1361
342 Ga0207661_10010817 3300025944 Bacteria 6581
343 Ga0207679_10101698 3300025945 Bacteria 2249
344 Ga0207679_10127850 3300025945 Bacteria 2034
345 Ga0207679_10135823 3300025945 Bacteria 1980
346 Ga0207679_10263215 3300025945 Bacteria 1472
347 Ga0207651_10213779 3300025960 Bacteria 1554
348 Ga0207651_10382692 3300025960 Bacteria 1193
349 Ga0207651_10689300 3300025960 Unclassified 899
350 Ga0207712_10017309 3300025961 Bacteria 4679
351 Ga0207712_10055435 3300025961 Bacteria 2788
352 Ga0207640_10081216 3300025981 Bacteria 2216
353 Ga0207640_10225091 3300025981 Unclassified 1439
354 Ga0207658_10032673 3300025986 Bacteria 3706
355 Ga0207703_10026161 3300026035 Bacteria 4591
356 Ga0207703_10056625 3300026035 Bacteria 3194
357 Ga0207703_10594053 3300026035 Bacteria 1047
358 Ga0207639_10118263 3300026041 Bacteria 2173
359 Ga0207678_10025937 3300026067 Bacteria 5114
360 Ga0207678_10094363 3300026067 Bacteria 2557
361 Ga0207678_10392288 3300026067 Bacteria 1201
362 Ga0207702_10012266 3300026078 Bacteria 7132
363 Ga0207702_10069362 3300026078 Bacteria 3030
364 Ga0207702_10137024 3300026078 Bacteria 2210
365 Ga0207641_10003082 3300026088 Bacteria 15022
366 Ga0207641_10009142 3300026088 Bacteria 8185
367 Ga0207641_10012473 3300026088 Bacteria 6966
368 Ga0207641_10337501 3300026088 Bacteria 1433
369 Ga0207648_10374288 3300026089 Unclassified 1287
370 Ga0207676_10017288 3300026095 Bacteria 5227
371 Ga0207676_10028316 3300026095 Bacteria 4183
372 Ga0207676_10182758 3300026095 Unclassified 1838
373 Ga0207674_10008806 3300026116 Bacteria 11617
374 Ga0207674_10048569 3300026116 Bacteria 4343
375 Ga0207674_10056044 3300026116 Bacteria 4004
376 Ga0207674_10522753 3300026116 Unclassified 1146
377 Ga0207675_100037682 3300026118 Bacteria 4510
378 Ga0207683_10420000 3300026121 Bacteria 1232
379 Ga0207698_10190906 3300026142 Bacteria 1824
380 Ga0209999_1007300 3300027543 Bacteria 1988
381 Ga0207428_10002483 3300027907 Bacteria 18414
382 Ga0207428_10003515 3300027907 Bacteria 15168
383 Ga0207428_10007912 3300027907 Bacteria 9661
384 Ga0207428_10009694 3300027907 Bacteria 8629
385 Ga0207428_10073275 3300027907 Bacteria 2687
386 Ga0207428_10134182 3300027907 Bacteria 1893
387 Ga0207428_10156883 3300027907 Bacteria 1730
388 Ga0268266_10000072 3300028379 Bacteria 232245
389 Ga0268266_10024032 3300028379 Bacteria 5186
390 Ga0268265_10008032 3300028380 Bacteria 7125
391 Ga0268265_10021744 3300028380 Bacteria 4498
392 Ga0268265_10076849 3300028380 Bacteria 2621
393 Ga0268265_10232879 3300028380 Unclassified 1620
394 Ga0268265_10502809 3300028380 Bacteria 1142
395 Ga0268264_10023468 3300028381 Bacteria 5031
396 Ga0268264_10112789 3300028381 Bacteria 2384
397 Ga0268264_10491683 3300028381 Bacteria 1195
398 Ga0265340_10008454 3300031247 Bacteria 5558
399 Ga0265316_10138987 3300031344 Bacteria 1826
400 Ga0307408_100006841 3300031548 Bacteria 7560
401 Ga0307408_100064541 3300031548 Bacteria 2682
402 Ga0307408_100826991 3300031548 Bacteria 842
403 Ga0265313_10044787 3300031595 Bacteria 2157
404 Ga0265314_10127485 3300031711 Bacteria 1592
405 Ga0265342_10022187 3300031712 Bacteria 4041
406 Ga0307405_10022038 3300031731 Bacteria 3594
407 Ga0307405_10280834 3300031731 Bacteria 1253
408 Ga0307413_10141055 3300031824 Bacteria 1665
409 Ga0307410_10006579 3300031852 Bacteria 6283
410 Ga0307410_10341995 3300031852 Bacteria 1193
411 Ga0307406_10034203 3300031901 Bacteria 3116
412 Ga0307407_10001537 3300031903 Bacteria 8463
413 Ga0307407_10130258 3300031903 Bacteria 1608
414 Ga0307412_10013799 3300031911 Bacteria 4747
415 Ga0307412_10169939 3300031911 Bacteria 1629
416 Ga0307409_100000789 3300031995 Bacteria 14401
417 Ga0307409_100326926 3300031995 Bacteria 1437
418 Ga0307409_100349859 3300031995 Bacteria 1394
419 Ga0307409_100375286 3300031995 Archaea 1350
420 Ga0307416_100042230 3300032002 Bacteria 3558
421 Ga0307416_100115377 3300032002 Bacteria 2378
422 Ga0307414_10230786 3300032004 Bacteria 1526
423 Ga0307411_10234968 3300032005 Archaea 1431
424 Ga0307415_100025715 3300032126 Bacteria 3700
425 Ga0307415_100163518 3300032126 Bacteria 1728
426 Ga0373957_0007776 3300035120 Bacteria 3444
427 Ga0373943_0033140 3300035170 Bacteria 2459
428 Ga0373955_0064352 3300035172 Bacteria 2033
429 Ga0373931_0419957 3300035691 Unclassified 850
430 Ga0373935_0080743 3300035692 Bacteria 2113
431 Ga0373933_0011987 3300035724 Bacteria 4786
432 Ga0373933_0241483 3300035724 Bacteria 1162
433 Ga0373947_0030780 3300035725 Bacteria 3155
434 Ga0373937_0118842 3300036401 Bacteria 2462
435 Ga0373925_0363204 3300037068 Bacteria 1177
436 Ga0395900_0428887 3300037418 Bacteria 1282
437 Ga0395898_0553237 3300037466 Bacteria 1093
438 Ga0395905_0605311 3300037471 Unclassified 998
439 Ga0436364_0601985 3300037853 Bacteria 3449
440 Ga0436364_1008259 3300037853 Archaea 1288
441 Ga0436365_0221145 3300039437 Bacteria 7331
442 Ga0436365_0763529 3300039437 Bacteria 4107
443 Ga0436363_0193238 3300039450 Bacteria 819
444 Ga0436362_0806068 3300039453 Bacteria 1299
445 Ga0439450_004875 3300042008 Bacteria 2324
446 Ga0439435_0037367 3300042436 Bacteria 1345
447 Ga0451577_0064339 3300042876 Bacteria 3271
448 Ga0466972_0030599 3300044658 Bacteria 2650
449 Ga0453684_0911004 3300044712 Bacteria 941
450 Ga0451576_0054070 3300045051 Bacteria 4204
451 Ga0495603_0086656 3300046455 Bacteria 1833
452 Ga0495603_0154467 3300046455 Unclassified 1332
453 Ga0495603_0192819 3300046455 Bacteria 1178
454 Ga0495629_0082599 3300046459 Archaea 2242
455 Ga0495629_0381986 3300046459 Unclassified 958
456 Ga0495580_0001274 3300046472 Bacteria 22214
457 Ga0495580_0019605 3300046472 Bacteria 5023
458 Ga0495580_0033199 3300046472 Unclassified 3720
459 Ga0495582_0000598 3300046473 Bacteria 19895
460 Ga0495582_0011349 3300046473 Bacteria 4909
461 Ga0495639_0011250 3300046475 Bacteria 3855
462 Ga0495662_0172767 3300046476 Unclassified 1065
463 Ga0495666_0126421 3300046526 Unclassified 1195
464 Ga0495640_0023395 3300046533 Bacteria 4501
465 Ga0495586_0141297 3300046535 Unclassified 1351
466 Ga0495645_0189093 3300046543 Bacteria 1405
467 Ga0495656_0226802 3300046615 Bacteria 936
468 Ga0495668_0004256 3300046616 Bacteria 10281
469 Ga0495634_0020558 3300046642 Bacteria 4680
470 Ga0495635_0164610 3300046663 Archaea 1509
471 Ga0495658_0027947 3300046683 Bacteria 3040
472 Ga0495658_0066390 3300046683 Bacteria 2084
473 Ga0495624_0014767 3300046690 Bacteria 5289
474 Ga0495581_0012155 3300047315 Bacteria 4983
475 Ga0495674_0028290 3300047319 Bacteria 5114
476 Ga0495676_0030357 3300047321 Bacteria 4589
477 Ga0495684_0122477 3300047471 Archaea 1958
478 Ga0496100_0234326 3300048903 Bacteria 1352
479 Ga0496101_0121855 3300048904 Unclassified 1972
480 Ga0496104_0003885 3300048907 Bacteria 12931
481 Ga0496105_0041888 3300048908 Bacteria 3774
482 Ga0496106_0284583 3300048909 Bacteria 1325
483 Ga0496108_0013213 3300048911 Bacteria 6728
484 Ga0496108_0572527 3300048911 Bacteria 985
485 Ga0496109_0004608 3300048912 Bacteria 11506
486 Ga0496109_0012315 3300048912 Bacteria 7384
487 Ga0496109_0219762 3300048912 Bacteria 1787
488 Ga0496110_0003685 3300048913 Bacteria 11793
489 Ga0496110_0432100 3300048913 Bacteria 1200
490 Ga0496111_0029330 3300048914 Bacteria 3907
491 Ga0496112_0003441 3300048915 Bacteria 13073
492 Ga0496112_0011334 3300048915 Bacteria 8136
493 Ga0496112_0015696 3300048915 Bacteria 7074
494 Ga0496114_0003609 3300048917 Bacteria 11893
495 Ga0496114_0443826 3300048917 Bacteria 1149
496 Ga0496115_0001395 3300048918 Bacteria 17265
497 Ga0496115_0004309 3300048918 Bacteria 10300
498 Ga0496115_0011614 3300048918 Bacteria 6608
499 Ga0501031_0336974 3300049568 Bacteria 976
500 Ga0501032_0018041 3300049569 Bacteria 4950
501 Ga0501032_0075667 3300049569 Bacteria 2242
502 Ga0501033_0008208 3300049570 Bacteria 8088
503 Ga0501034_0056519 3300049571 Bacteria 3948
504 Ga0501034_0060417 3300049571 Bacteria 3806
505 Ga0501034_0072415 3300049571 Bacteria 3455
506 Ga0501034_0485572 3300049571 Bacteria 1150
507 Ga0501034_0576459 3300049571 Bacteria 1032
508 Ga0501036_0015997 3300049572 Bacteria 6266
509 Ga0501036_0019488 3300049572 Bacteria 5697
510 Ga0501036_0025669 3300049572 Bacteria 4972
511 Ga0501036_0200897 3300049572 Bacteria 1676
512 Ga0501037_0039256 3300049573 Bacteria 3486
513 Ga0501038_0029624 3300049574 Bacteria 4848
514 Ga0501038_0033029 3300049574 Bacteria 4559
515 Ga0501039_0036855 3300049575 Bacteria 3773
516 Ga0501039_0200147 3300049575 Bacteria 1570
517 Ga0501041_0120056 3300049577 Bacteria 1633
518 Ga0501042_0020153 3300049578 Bacteria 4639
519 Ga0501043_0014285 3300049579 Bacteria 6213
520 Ga0501043_0033146 3300049579 Bacteria 4063
521 Ga0501043_0123161 3300049579 Bacteria 2033
522 Ga0501046_0010564 3300049580 Bacteria 7921
523 Ga0501046_0016873 3300049580 Bacteria 6106
524 Ga0501046_0117876 3300049580 Bacteria 2022
525 Ga0501047_0000308 3300049581 Bacteria 56269
526 Ga0501047_0021643 3300049581 Bacteria 6175
527 Ga0501047_0033125 3300049581 Bacteria 4988
528 Ga0501047_0053874 3300049581 Bacteria 3891
529 Ga0501048_0099667 3300049582 Bacteria 2049
530 Ga0501067_0001794 3300049583 Bacteria 11794
531 Ga0501067_0094556 3300049583 Bacteria 1659
532 Ga0501068_0028705 3300049584 Bacteria 3292
533 Ga0501068_0132231 3300049584 Bacteria 1561
534 Ga0501069_0051308 3300049585 Bacteria 2295
535 Ga0501070_0348155 3300049586 Bacteria 1203
536 Ga0501071_0040742 3300049587 Bacteria 3325
537 Ga0501071_0199197 3300049587 Bacteria 1504
538 Ga0501072_0010157 3300049588 Bacteria 7170
539 Ga0501072_0014739 3300049588 Bacteria 5994
540 Ga0501072_0055947 3300049588 Bacteria 3109
541 Ga0501072_0245046 3300049588 Bacteria 1428
542 Ga0501073_0009963 3300049589 Bacteria 6991
543 Ga0501073_0047932 3300049589 Bacteria 3001
544 Ga0501075_0002556 3300049591 Bacteria 12123
545 Ga0501075_0247894 3300049591 Bacteria 1358
546 Ga0501076_0038392 3300049592 Bacteria 3759
547 Ga0501076_0317612 3300049592 Archaea 1278
548 Ga0501076_0325060 3300049592 Bacteria 1262
549 Ga0501077_0068904 3300049593 Unclassified 2242
550 Ga0501077_0215535 3300049593 Unclassified 1220
551 Ga0501080_0003720 3300049742 Bacteria 13455
552 Ga0501080_0018517 3300049742 Bacteria 6442
553 Ga0501080_0086463 3300049742 Bacteria 2913
554 Ga0501080_0246240 3300049742 Bacteria 1630
555 Ga0501080_0549632 3300049742 Bacteria 1028
556 Ga0501081_0023531 3300049743 Bacteria 4129
557 Ga0501083_0000883 3300049744 Bacteria 19840
558 Ga0501083_0005052 3300049744 Bacteria 9347
559 Ga0501083_0016465 3300049744 Bacteria 5174
560 Ga0501083_0037918 3300049744 Bacteria 3278
561 Ga0501083_0084140 3300049744 Bacteria 2106
562 Ga0501083_0154015 3300049744 Bacteria 1505
563 Ga0501283_002903 3300049779 Unclassified 2245
564 Ga0501035_0065851 3300049822 Bacteria 3216
565 Ga0501035_0250918 3300049822 Bacteria 1502
566 Ga0501044_0006950 3300049823 Bacteria 12453
567 Ga0501044_0070249 3300049823 Bacteria 3562
568 Ga0501044_0467702 3300049823 Bacteria 1165
569 Ga0501045_0004260 3300049824 Bacteria 9864
570 Ga0501045_0612508 3300049824 Bacteria 806
571 nmdc:mga06z11_67472_c1 3300050494 Bacteria 1883
572 nmdc:mga05p37_122080_c1 3300050507 Bacteria 2399
573 nmdc:mga05p37_13471_c1 3300050507 Bacteria 9799
574 nmdc:mga05p37_3089_c1 3300050507 Bacteria 19345
575 nmdc:mga05p37_503521_c1 3300050507 Bacteria 1389
576 nmdc:mga05p37_9879_c1 3300050507 Bacteria 11322
577 nmdc:mga09592_121798_c1 3300050508 Bacteria 2241
578 nmdc:mga09592_1412_c1 3300050508 Bacteria 19239
579 nmdc:mga09592_35327_c1 3300050508 Bacteria 4184
580 nmdc:mga0qj67_14098_c1 3300050509 Bacteria 6037
581 nmdc:mga0qj67_39322_c1 3300050509 Bacteria 3714
582 nmdc:mga0qj67_63990_c1 3300050509 Bacteria 2925
583 nmdc:mga0qj67_97668_c1 3300050509 Bacteria 2365
584 nmdc:mga06r32_1883_c1 3300050510 Bacteria 18705
585 nmdc:mga06r32_35548_c1 3300050510 Bacteria 4701
586 nmdc:mga06r32_453654_c1 3300050510 Bacteria 1262
587 nmdc:mga06r32_4607_c1 3300050510 Bacteria 12364
588 nmdc:mga06r32_87515_c1 3300050510 Bacteria 3040
589 nmdc:mga08y16_1311_c1 3300050511 Bacteria 24756
590 nmdc:mga08y16_19304_c1 3300050511 Bacteria 7185
591 nmdc:mga08y16_444583_c1 3300050511 Archaea 1323
592 nmdc:mga08y16_69179_c1 3300050511 Bacteria 3681
593 nmdc:mga08y16_73723_c1 3300050511 Bacteria 3557
594 nmdc:mga08y16_94397_c2 3300050511 Bacteria 2330
595 nmdc:mga0n895_13356_c1 3300050512 Bacteria 7405
596 nmdc:mga0n895_145244_c1 3300050512 Bacteria 2401
597 nmdc:mga0n895_211046_c1 3300050512 Bacteria 1972
598 nmdc:mga0n895_57173_c1 3300050512 Bacteria 3845
599 nmdc:mga0n895_57356_c1 3300050512 Bacteria 3838
600 nmdc:mga0rr50_105006_c1 3300050513 Bacteria 2226
601 nmdc:mga0rr50_288654_c1 3300050513 Bacteria 1370
602 nmdc:mga0rr50_32742_c1 3300050513 Bacteria 3707
603 nmdc:mga0rr50_428239_c1 3300050513 Unclassified 1120
604 nmdc:mga08x19_283_c1 3300050514 Bacteria 38329
605 nmdc:mga0a205_126346_c1 3300050515 Unclassified 2457
606 nmdc:mga0a205_14851_c1 3300050515 Bacteria 7268
607 nmdc:mga0a205_438586_c1 3300050515 Bacteria 1167
608 nmdc:mga0a205_65257_c1 3300050515 Bacteria 3517
609 nmdc:mga0a205_8478_c1 3300050515 Bacteria 2741
610 Ga0495601_0055141 3300053077 Bacteria 2516
611 Ga0500641_0005376 3300053096 Bacteria 4538
612 Ga0500617_017963 3300053124 Bacteria 3075
613 Ga0500658_0033886 3300053134 Bacteria 2011
614 Ga0500588_0002915 3300053146 Bacteria 3552
615 Ga0500616_0000567 3300053153 Bacteria 45260
616 Ga0500599_006970 3300053736 Bacteria 1447
617 Ga0501084_0002104 3300054114 Bacteria 15904
618 Ga0501084_0009353 3300054114 Bacteria 8110
619 Ga0501084_0010226 3300054114 Bacteria 7761
620 Ga0501084_0020991 3300054114 Bacteria 5447
621 Ga0501084_0045565 3300054114 Bacteria 3672
622 Ga0501082_0020093 3300060353 Bacteria 5756
623 Ga0501082_0045805 3300060353 Bacteria 3771
624 Ga0501082_0446771 3300060353 Bacteria 1129
625 Ga0530510_0179985 3300061734 Bacteria 1567
626 Ga0105248_10517656
627 JGI24751J29686_10026306
628 Ga0065704_10132450
629 Ga0065712_10008015
630 Ga0065712_10070089
631 Ga0065715_10007867
632 Ga0065715_10016431
633 Ga0065715_10091908
634 Ga0065715_10107005
635 Ga0065715_10126295
636 Ga0065715_10162741
637 Ga0065715_10300759
638 Ga0065707_10001489
639 Ga0070676_10109938
640 Ga0070683_100010352
641 Ga0070683_100092908
642 Ga0070690_100004917
643 Ga0070670_100003870
644 Ga0070670_100039116
645 Ga0070670_100481399
646 Ga0070670_100575892
647 Ga0068869_100028187
648 Ga0070666_10007317
649 Ga0070666_10008769
650 Ga0070666_10020706
651 Ga0070682_100201844
652 Ga0070682_100258058
653 Ga0068868_100005278
654 Ga0068868_100048637
655 Ga0070689_100014307
656 Ga0070689_100042290
657 Ga0070689_100139052
658 Ga0070689_100666535
659 Ga0070661_100018189
660 Ga0070661_100040306
661 Ga0070661_100050404
662 Ga0070669_100000753
663 Ga0070669_100569238
664 Ga0070675_100009226
665 Ga0070675_100080217
666 Ga0070675_100387780
667 Ga0070671_100004176
668 Ga0070671_100009302
669 Ga0070674_100005811
670 Ga0070674_100118630
671 Ga0070673_100017403
672 Ga0070673_100390231
673 Ga0070688_100093504
674 Ga0070688_100285249
675 Ga0070659_100425957
676 Ga0070667_100001912
677 Ga0070667_100070357
678 Ga0070667_100100263
679 Ga0070701_10039938
680 Ga0070711_100297961
681 Ga0070705_100099070
682 Ga0070705_100281963
683 Ga0070700_100000757
684 Ga0070700_100066052
685 Ga0070700_100685300
686 Ga0070694_100125751
687 Ga0070663_100017312
688 Ga0070663_100060560
689 Ga0070678_100555007
690 Ga0070678_100706293
691 Ga0070662_100542226
692 Ga0070662_100668972
693 Ga0070681_10087996
694 Ga0070681_10649109
695 Ga0070706_100187384
696 Ga0070707_100000707
697 Ga0070707_100007749
698 Ga0070707_100073818
699 Ga0070707_100587337
700 Ga0070699_100034738
701 Ga0070699_100405952
702 Ga0070679_100234831
703 Ga0070684_100001218
704 Ga0070672_100257793
705 Ga0070672_100331280
706 Ga0070672_100533294
707 Ga0070672_100629298
708 Ga0070695_100222034
709 Ga0070696_100062371
710 Ga0070693_100322599
711 Ga0070665_100000496
712 Ga0070665_100008596
713 Ga0070704_100004317
714 Ga0070704_100180787
715 Ga0070704_100397391
716 Ga0068855_100028309
717 Ga0070664_100007454
718 Ga0070664_100018865
719 Ga0070664_100049035
720 Ga0070664_100060068
721 Ga0070664_100139367
722 Ga0068857_100011755
723 Ga0068857_100075379
724 Ga0068857_100423247
725 Ga0068854_100370167
726 Ga0068856_100001805
727 Ga0068856_100022778
728 Ga0068856_100714015
729 Ga0068852_100077649
730 Ga0068852_100087023
731 Ga0068859_100026361
732 Ga0068859_100036629
733 Ga0068859_100070053
734 Ga0068859_100096135
735 Ga0068859_100458891
736 Ga0068864_100504450
737 Ga0068864_100803528
738 Ga0068861_100013889
739 Ga0068861_100379650
740 Ga0068861_100399040
741 Ga0068861_100575583
742 Ga0068851_10026983
743 Ga0068851_10132484
744 Ga0068851_10133716
745 Ga0068863_100002139
746 Ga0068863_100011399
747 Ga0068863_100079747
748 Ga0068863_100193624
749 Ga0068863_100308347
750 Ga0068863_100381498
751 Ga0068858_100009014
752 Ga0068858_100094880
753 Ga0068858_100146181
754 Ga0068860_100018879
755 Ga0068860_100024770
756 Ga0068862_100010077
757 Ga0068862_100039335
758 Ga0068862_100234190
759 Ga0068862_100248693
760 Ga0081455_10003552
761 Ga0081455_10188473
762 Ga0081540_1090721
763 Ga0081539_10023231
764 Ga0070715_10067009
765 Ga0070712_100125170
766 Ga0075367_10006204
767 Ga0097621_100007210
768 Ga0097621_100012508
769 Ga0097621_100067863
770 Ga0097621_100088450
771 Ga0097621_100091559
772 Ga0097621_100116347
773 Ga0068871_100115913
774 Ga0068871_100116720
775 Ga0075428_100001699
776 Ga0075428_100003643
777 Ga0075428_100024691
778 Ga0075428_100026191
779 Ga0075428_100029031
780 Ga0075430_100004720
781 Ga0075430_100024591
782 Ga0075430_100162420
783 Ga0075430_100165978
784 Ga0075430_100556038
785 Ga0075431_100000275
786 Ga0075431_100001487
787 Ga0075431_100003529
788 Ga0075431_100031428
789 Ga0075431_100197583
790 Ga0075433_10094613
791 Ga0075433_10337434
792 Ga0075433_10463925
793 Ga0075433_10575632
794 Ga0075434_100004994
795 Ga0075434_100008866
796 Ga0075434_100609008
797 Ga0075429_100002658
798 Ga0075429_100004667
799 Ga0075429_100008631
800 Ga0075429_100065774
801 Ga0075429_100396041
802 Ga0075429_100536987
803 Ga0075436_100008792
804 Ga0075436_100266794
805 Ga0097620_100026360
806 Ga0097620_100036627
807 Ga0097620_100070049
808 Ga0097620_100096127
809 Ga0097620_100458907
810 Ga0075435_100031891
811 Ga0075435_100038212
812 Ga0075435_100196374
813 Ga0075435_100241387
814 Ga0111539_10000056
815 Ga0111539_10004761
816 Ga0111539_10013833
817 Ga0111539_10020590
818 Ga0111539_10025777
819 Ga0111539_10029639
820 Ga0111539_10079222
821 Ga0111539_10138344
822 Ga0111539_10765522
823 Ga0105245_10029059
824 Ga0105245_10460125
825 Ga0105247_10006013
826 Ga0114129_10001009
827 Ga0114129_10003006
828 Ga0114129_10003920
829 Ga0114129_10006539
830 Ga0114129_10189984
831 Ga0114129_10195322
832 Ga0114129_10546264
833 Ga0105241_10058092
834 Ga0105242_10042724
835 Ga0105242_10171792
836 Ga0105242_10302032
837 Ga0105242_10753525
838 Ga0105248_10006041
839 Ga0105248_10101604
840 Ga0105248_10133891
841 Ga0105248_10386978
842 Ga0105248_10477213
843 Ga0105248_11140232
844 Ga0105237_10075044
845 Ga0105237_10732037
846 Ga0105238_10025693
847 Ga0105238_10569901
848 Ga0105249_10026046
849 Ga0105249_10041833
850 Ga0105249_10055929
851 Ga0105249_10148917
852 Ga0105249_10224648
853 Ga0105239_10237465
854 Ga0105246_10004120
855 Ga0105246_10270185
856 Ga0157373_10063355
857 Ga0157373_10131849
858 Ga0157371_10062981
859 Ga0157370_10147906
860 Ga0157370_10152633
861 Ga0157370_10636999
862 Ga0157369_10005373
863 Ga0157374_10003744
864 Ga0157374_10023027
865 Ga0157374_10036786
866 Ga0157374_10048240
867 Ga0157374_10123741
868 Ga0157374_10264891
869 Ga0157378_10002804
870 Ga0157378_10152322
871 Ga0157378_10160086
872 Ga0157378_10166087
873 Ga0157378_10197119
874 Ga0157378_10494519
875 Ga0157378_10550343
876 Ga0163162_10022648
877 Ga0163162_10052504
878 Ga0163162_10165422
879 Ga0163162_10237806
880 Ga0163162_10272732
881 Ga0163162_10524362
882 Ga0163162_10549170
883 Ga0157372_10056725
884 Ga0157372_10140329
885 Ga0157372_10244530
886 Ga0157375_10002031
887 Ga0157375_10037060
888 Ga0157375_10107822
889 Ga0163163_10011286
890 Ga0163163_10067535
891 Ga0163163_10376293
892 Ga0163163_10568640
893 Ga0157380_10013328
894 Ga0157380_10020013
895 Ga0157380_10436426
896 Ga0157380_10786473
897 Ga0157379_10044667
898 Ga0157379_10095110
899 Ga0157379_10335499
900 Ga0157379_10571747
901 Ga0157376_10000032
902 Ga0157376_10000629
903 Ga0157376_10013950
904 Ga0157376_10098697
905 Ga0157376_10121666
906 Ga0157376_10135480
907 Ga0157376_10270732
908 Ga0163161_10011698
909 Ga0213876_10000945
910 Ga0213876_10053021
911 Ga0207697_10015188
912 Ga0207656_10094799
913 Ga0207656_10096449
914 Ga0207682_10175859
915 Ga0207710_10012248
916 Ga0207688_10034245
917 Ga0207688_10243898
918 Ga0207680_10031286
919 Ga0207680_10041205
920 Ga0207680_10069024
921 Ga0207647_10211936
922 Ga0207707_10011081
923 Ga0207663_10319668
924 Ga0207663_10633217
925 Ga0207662_10045824
926 Ga0207657_10022053
927 Ga0207649_10016523
928 Ga0207649_10127136
929 Ga0207646_10000236
930 Ga0207646_10001982
931 Ga0207646_10348612
932 Ga0207681_10018736
933 Ga0207681_10239708
934 Ga0207694_10015625
935 Ga0207650_10008841
936 Ga0207650_10010891
937 Ga0207650_10016067
938 Ga0207650_10087508
939 Ga0207650_10247980
940 Ga0207687_10269109
941 Ga0207644_10045956
942 Ga0207644_10181009
943 Ga0207644_10222979
944 Ga0207690_10095709
945 Ga0207690_10119901
946 Ga0207706_10069054
947 Ga0207706_10365395
948 Ga0207706_10381567
949 Ga0207706_10535258
950 Ga0207686_10185596
951 Ga0207686_10334553
952 Ga0207670_10290416
953 Ga0207670_10592356
954 Ga0207669_10002438
955 Ga0207669_10141765
956 Ga0207704_10332496
957 Ga0207665_10180206
958 Ga0207691_10151560
959 Ga0207691_10165848
960 Ga0207691_10243298
961 Ga0207711_10000578
962 Ga0207711_10038931
963 Ga0207711_10104205
964 Ga0207711_10141670
965 Ga0207711_10168778
966 Ga0207689_10287569
967 Ga0207661_10010817
968 Ga0207679_10101698
969 Ga0207679_10127850
970 Ga0207679_10135823
971 Ga0207679_10263215
972 Ga0207651_10213779
973 Ga0207651_10382692
974 Ga0207651_10689300
975 Ga0207712_10017309
976 Ga0207712_10055435
977 Ga0207640_10081216
978 Ga0207640_10225091
979 Ga0207658_10032673
980 Ga0207703_10026161
981 Ga0207703_10056625
982 Ga0207703_10594053
983 Ga0207639_10118263
984 Ga0207678_10025937
985 Ga0207678_10094363
986 Ga0207678_10392288
987 Ga0207702_10012266
988 Ga0207702_10069362
989 Ga0207702_10137024
990 Ga0207641_10003082
991 Ga0207641_10009142
992 Ga0207641_10012473
993 Ga0207641_10337501
994 Ga0207648_10374288
995 Ga0207676_10017288
996 Ga0207676_10028316
997 Ga0207676_10182758
998 Ga0207674_10008806
999 Ga0207674_10048569
1000 Ga0207674_10056044
1001 Ga0207674_10522753
1002 Ga0207675_100037682
1003 Ga0207683_10420000
1004 Ga0207698_10190906
1005 Ga0209999_1007300
1006 Ga0207428_10002483
1007 Ga0207428_10003515
1008 Ga0207428_10007912
1009 Ga0207428_10009694
1010 Ga0207428_10073275
1011 Ga0207428_10134182
1012 Ga0207428_10156883
1013 Ga0268266_10000072
1014 Ga0268266_10024032
1015 Ga0268265_10008032
1016 Ga0268265_10021744
1017 Ga0268265_10076849
1018 Ga0268265_10232879
1019 Ga0268265_10502809
1020 Ga0268264_10023468
1021 Ga0268264_10112789
1022 Ga0268264_10491683
1023 Ga0265340_10008454
1024 Ga0265316_10138987
1025 Ga0307408_100006841
1026 Ga0307408_100064541
1027 Ga0307408_100826991
1028 Ga0265313_10044787
1029 Ga0265314_10127485
1030 Ga0265342_10022187
1031 Ga0307405_10022038
1032 Ga0307405_10280834
1033 Ga0307413_10141055
1034 Ga0307410_10006579
1035 Ga0307410_10341995
1036 Ga0307406_10034203
1037 Ga0307407_10001537
1038 Ga0307407_10130258
1039 Ga0307412_10013799
1040 Ga0307412_10169939
1041 Ga0307409_100000789
1042 Ga0307409_100326926
1043 Ga0307409_100349859
1044 Ga0307409_100375286
1045 Ga0307416_100042230
1046 Ga0307416_100115377
1047 Ga0307414_10230786
1048 Ga0307411_10234968
1049 Ga0307415_100025715
1050 Ga0307415_100163518
1051 Ga0373957_0007776
1052 Ga0373943_0033140
1053 Ga0373955_0064352
1054 Ga0373931_0419957
1055 Ga0373935_0080743
1056 Ga0373933_0011987
1057 Ga0373933_0241483
1058 Ga0373947_0030780
1059 Ga0373937_0118842
1060 Ga0373925_0363204
1061 Ga0395900_0428887
1062 Ga0395898_0553237
1063 Ga0395905_0605311
1064 Ga0436364_0601985
1065 Ga0436364_1008259
1066 Ga0436365_0221145
1067 Ga0436365_0763529
1068 Ga0436363_0193238
1069 Ga0436362_0806068
1070 Ga0439450_004875
1071 Ga0439435_0037367
1072 Ga0451577_0064339
1073 Ga0466972_0030599
1074 Ga0453684_0911004
1075 Ga0451576_0054070
1076 Ga0495603_0086656
1077 Ga0495603_0154467
1078 Ga0495603_0192819
1079 Ga0495629_0082599
1080 Ga0495629_0381986
1081 Ga0495580_0001274
1082 Ga0495580_0019605
1083 Ga0495580_0033199
1084 Ga0495582_0000598
1085 Ga0495582_0011349
1086 Ga0495639_0011250
1087 Ga0495662_0172767
1088 Ga0495666_0126421
1089 Ga0495640_0023395
1090 Ga0495586_0141297
1091 Ga0495645_0189093
1092 Ga0495656_0226802
1093 Ga0495668_0004256
1094 Ga0495634_0020558
1095 Ga0495635_0164610
1096 Ga0495658_0027947
1097 Ga0495658_0066390
1098 Ga0495624_0014767
1099 Ga0495581_0012155
1100 Ga0495674_0028290
1101 Ga0495676_0030357
1102 Ga0495684_0122477
1103 Ga0496100_0234326
1104 Ga0496101_0121855
1105 Ga0496104_0003885
1106 Ga0496105_0041888
1107 Ga0496106_0284583
1108 Ga0496108_0013213
1109 Ga0496108_0572527
1110 Ga0496109_0004608
1111 Ga0496109_0012315
1112 Ga0496109_0219762
1113 Ga0496110_0003685
1114 Ga0496110_0432100
1115 Ga0496111_0029330
1116 Ga0496112_0003441
1117 Ga0496112_0011334
1118 Ga0496112_0015696
1119 Ga0496114_0003609
1120 Ga0496114_0443826
1121 Ga0496115_0001395
1122 Ga0496115_0004309
1123 Ga0496115_0011614
1124 Ga0501031_0336974
1125 Ga0501032_0018041
1126 Ga0501032_0075667
1127 Ga0501033_0008208
1128 Ga0501034_0056519
1129 Ga0501034_0060417
1130 Ga0501034_0072415
1131 Ga0501034_0485572
1132 Ga0501034_0576459
1133 Ga0501036_0015997
1134 Ga0501036_0019488
1135 Ga0501036_0025669
1136 Ga0501036_0200897
1137 Ga0501037_0039256
1138 Ga0501038_0029624
1139 Ga0501038_0033029
1140 Ga0501039_0036855
1141 Ga0501039_0200147
1142 Ga0501041_0120056
1143 Ga0501042_0020153
1144 Ga0501043_0014285
1145 Ga0501043_0033146
1146 Ga0501043_0123161
1147 Ga0501046_0010564
1148 Ga0501046_0016873
1149 Ga0501046_0117876
1150 Ga0501047_0000308
1151 Ga0501047_0021643
1152 Ga0501047_0033125
1153 Ga0501047_0053874
1154 Ga0501048_0099667
1155 Ga0501067_0001794
1156 Ga0501067_0094556
1157 Ga0501068_0028705
1158 Ga0501068_0132231
1159 Ga0501069_0051308
1160 Ga0501070_0348155
1161 Ga0501071_0040742
1162 Ga0501071_0199197
1163 Ga0501072_0010157
1164 Ga0501072_0014739
1165 Ga0501072_0055947
1166 Ga0501072_0245046
1167 Ga0501073_0009963
1168 Ga0501073_0047932
1169 Ga0501075_0002556
1170 Ga0501075_0247894
1171 Ga0501076_0038392
1172 Ga0501076_0317612
1173 Ga0501076_0325060
1174 Ga0501077_0068904
1175 Ga0501077_0215535
1176 Ga0501080_0003720
1177 Ga0501080_0018517
1178 Ga0501080_0086463
1179 Ga0501080_0246240
1180 Ga0501080_0549632
1181 Ga0501081_0023531
1182 Ga0501083_0000883
1183 Ga0501083_0005052
1184 Ga0501083_0016465
1185 Ga0501083_0037918
1186 Ga0501083_0084140
1187 Ga0501083_0154015
1188 Ga0501283_002903
1189 Ga0501035_0065851
1190 Ga0501035_0250918
1191 Ga0501044_0006950
1192 Ga0501044_0070249
1193 Ga0501044_0467702
1194 Ga0501045_0004260
1195 Ga0501045_0612508
1196 nmdc:mga06z11_67472_c1
1197 nmdc:mga05p37_122080_c1
1198 nmdc:mga05p37_13471_c1
1199 nmdc:mga05p37_3089_c1
1200 nmdc:mga05p37_503521_c1
1201 nmdc:mga05p37_9879_c1
1202 nmdc:mga09592_121798_c1
1203 nmdc:mga09592_1412_c1
1204 nmdc:mga09592_35327_c1
1205 nmdc:mga0qj67_14098_c1
1206 nmdc:mga0qj67_39322_c1
1207 nmdc:mga0qj67_63990_c1
1208 nmdc:mga0qj67_97668_c1
1209 nmdc:mga06r32_1883_c1
1210 nmdc:mga06r32_35548_c1
1211 nmdc:mga06r32_453654_c1
1212 nmdc:mga06r32_4607_c1
1213 nmdc:mga06r32_87515_c1
1214 nmdc:mga08y16_1311_c1
1215 nmdc:mga08y16_19304_c1
1216 nmdc:mga08y16_444583_c1
1217 nmdc:mga08y16_69179_c1
1218 nmdc:mga08y16_73723_c1
1219 nmdc:mga08y16_94397_c2
1220 nmdc:mga0n895_13356_c1
1221 nmdc:mga0n895_145244_c1
1222 nmdc:mga0n895_211046_c1
1223 nmdc:mga0n895_57173_c1
1224 nmdc:mga0n895_57356_c1
1225 nmdc:mga0rr50_105006_c1
1226 nmdc:mga0rr50_288654_c1
1227 nmdc:mga0rr50_32742_c1
1228 nmdc:mga0rr50_428239_c1
1229 nmdc:mga08x19_283_c1
1230 nmdc:mga0a205_126346_c1
1231 nmdc:mga0a205_14851_c1
1232 nmdc:mga0a205_438586_c1
1233 nmdc:mga0a205_65257_c1
1234 nmdc:mga0a205_8478_c1
1235 Ga0495601_0055141
1236 Ga0500641_0005376
1237 Ga0500617_017963
1238 Ga0500658_0033886
1239 Ga0500588_0002915
1240 Ga0500616_0000567
1241 Ga0500599_006970
1242 Ga0501084_0002104
1243 Ga0501084_0009353
1244 Ga0501084_0010226
1245 Ga0501084_0020991
1246 Ga0501084_0045565
1247 Ga0501082_0020093
1248 Ga0501082_0045805
1249 Ga0501082_0446771
1250 Ga0530510_0179985

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

2

205

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8wbx-assembly1.cif.gz_B cryo-em structure of the abcg25 bound to aba 0.7555 3 251
8i3d-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 0.7545 3 251
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.7496 6 250
8i3c-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 with chs 0.7484 3 251
8wba-assembly1.cif.gz_A cryo-em structure of the abcg25 bound to chs 0.7462 3 251
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8817 56 247 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8704 55 247 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8356 56 244 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6796 56 247 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6746 55 247 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7J2HAA6-F1-model_v4 deleted 0.9739 60 252
AF-A0A2V7PC00-F1-model_v4 Transport permease protein 0.9723 9 253 GO:0043190
GO:0140359
AF-A0A1G1Z5S2-F1-model_v4 Transport permease protein 0.9704 8 253 GO:0043190
GO:0140359
AF-A0A7V4PCJ6-F1-model_v4 Transport permease protein 0.9699 3 253 GO:0043190
GO:0140359
AF-A0A2G9PQH7-F1-model_v4 Multidrug ABC transporter permease 0.9656 5 253 GO:0043190
GO:0140359

Map