F470341

General Info

Members Datasets Scaffolds Average Seq Length
625 268 1250 128

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100255709|Ga0070694_1002557092
Length 150
Sequence MSIFWLKKLTVMESTPTFQSTKSKRKSGVKRFIKRFFIVALLGLAVFIFFRYYYVFGEGVKAGRLNYAVRKGNIFKTYEGKLIQEGYRSTTGNVIQSYEFEFSVNNKRVYDILAANSGKRFDLHYKEYHGIIPWRGNTKYIVDSVISMEP

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
170 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
171 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
174 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
175 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
176 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
177 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
180 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
181 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
244 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
247 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
248 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
257 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
258 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
263 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
266 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
267 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
268 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0
Rhizoplane 2.24
Rhizosphere 90.72
Stem 0
Stem Tuber 0
Unclassified 20.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100255709 3300005444 Bacteria 1327
2 rootH1_10157391 3300003323 Bacteria 4842
3 Ga0055534_1026022 3300003784 Bacteria 935
4 Ga0065714_10158877 3300005288 Bacteria 1063
5 Ga0065704_10335986 3300005289 Bacteria 831
6 Ga0065712_10155663 3300005290 Bacteria 1337
7 Ga0065712_10206024 3300005290 Unclassified 1090
8 Ga0065712_10254642 3300005290 Bacteria 951
9 Ga0065715_10049567 3300005293 Bacteria 935
10 Ga0065715_10749071 3300005293 Bacteria 631
11 Ga0065707_10264879 3300005295 Bacteria 1087
12 Ga0070676_10005059 3300005328 Bacteria 6990
13 Ga0070676_10162452 3300005328 Bacteria 1439
14 Ga0070676_10234289 3300005328 Bacteria 1218
15 Ga0070683_100038502 3300005329 Bacteria 4384
16 Ga0070683_100773171 3300005329 Bacteria 920
17 Ga0070690_100032971 3300005330 Bacteria 3239
18 Ga0070690_100242434 3300005330 Bacteria 1271
19 Ga0070670_100134519 3300005331 Unclassified 2136
20 Ga0070670_100217730 3300005331 Unclassified 1661
21 Ga0070670_100466354 3300005331 Bacteria 1120
22 Ga0070670_100549532 3300005331 Unclassified 1030
23 Ga0070670_100718360 3300005331 Bacteria 899
24 Ga0070670_100788390 3300005331 Bacteria 858
25 Ga0070670_100798770 3300005331 Bacteria 852
26 Ga0070677_10144263 3300005333 Unclassified 1101
27 Ga0068869_100002017 3300005334 Bacteria 12210
28 Ga0068869_100003968 3300005334 Bacteria 9142
29 Ga0068869_100196790 3300005334 Bacteria 1588
30 Ga0068869_100456712 3300005334 Bacteria 1060
31 Ga0070666_10487935 3300005335 Bacteria 892
32 Ga0070666_10593515 3300005335 Bacteria 808
33 Ga0070682_100000290 3300005337 Bacteria 35754
34 Ga0070682_100565868 3300005337 Unclassified 892
35 Ga0070682_100793789 3300005337 Bacteria 768
36 Ga0070682_100919247 3300005337 Bacteria 720
37 Ga0070682_101848719 3300005337 Bacteria 528
38 Ga0068868_100003530 3300005338 Bacteria 10897
39 Ga0068868_100178064 3300005338 Bacteria 1763
40 Ga0068868_100217637 3300005338 Unclassified 1598
41 Ga0070660_100783789 3300005339 Bacteria 801
42 Ga0070689_100002002 3300005340 Bacteria 13203
43 Ga0070689_100008423 3300005340 Bacteria 7262
44 Ga0070689_100180273 3300005340 Unclassified 1715
45 Ga0070687_100270617 3300005343 Bacteria 1064
46 Ga0070687_101240908 3300005343 Bacteria 551
47 Ga0070661_100001041 3300005344 Bacteria 19623
48 Ga0070661_100016316 3300005344 Bacteria 5249
49 Ga0070661_100507224 3300005344 Bacteria 966
50 Ga0070661_101584817 3300005344 Bacteria 553
51 Ga0070668_100221976 3300005347 Bacteria 1559
52 Ga0070668_101268627 3300005347 Bacteria 669
53 Ga0070669_100357100 3300005353 Bacteria 1187
54 Ga0070675_100287939 3300005354 Bacteria 1445
55 Ga0070675_100485343 3300005354 Bacteria 1112
56 Ga0070675_101122661 3300005354 Bacteria 723
57 Ga0070675_102012529 3300005354 Bacteria 533
58 Ga0070671_100008744 3300005355 Bacteria 8124
59 Ga0070671_100041462 3300005355 Unclassified 3826
60 Ga0070671_100920594 3300005355 Bacteria 764
61 Ga0070671_101158998 3300005355 Bacteria 680
62 Ga0070674_100531095 3300005356 Unclassified 984
63 Ga0070674_101295687 3300005356 Bacteria 649
64 Ga0070673_100146198 3300005364 Bacteria 1998
65 Ga0070688_100000556 3300005365 Bacteria 18889
66 Ga0070688_100025303 3300005365 Unclassified 3514
67 Ga0070688_100031728 3300005365 Bacteria 3180
68 Ga0070688_100831053 3300005365 Bacteria 724
69 Ga0070688_101047096 3300005365 Bacteria 650
70 Ga0070659_100078930 3300005366 Bacteria 2627
71 Ga0070659_100153464 3300005366 Bacteria 1880
72 Ga0070659_100608328 3300005366 Bacteria 940
73 Ga0070667_100133691 3300005367 Unclassified 2167
74 Ga0070667_100195199 3300005367 Bacteria 1794
75 Ga0070667_100282295 3300005367 Bacteria 1491
76 Ga0070667_101052373 3300005367 Bacteria 760
77 Ga0070667_101902781 3300005367 Bacteria 560
78 Ga0070701_10183327 3300005438 Unclassified 1227
79 Ga0070701_10224701 3300005438 Bacteria 1121
80 Ga0070705_100271827 3300005440 Bacteria 1200
81 Ga0070700_100003823 3300005441 Bacteria 7799
82 Ga0070700_100055011 3300005441 Bacteria 2489
83 Ga0070700_101333205 3300005441 Bacteria 604
84 Ga0070663_100158619 3300005455 Bacteria 1740
85 Ga0070678_100018792 3300005456 Bacteria 4487
86 Ga0070678_100545871 3300005456 Bacteria 1028
87 Ga0070662_100022050 3300005457 Bacteria 4355
88 Ga0070662_100055700 3300005457 Bacteria 2869
89 Ga0070662_100066777 3300005457 Unclassified 2640
90 Ga0070662_100630909 3300005457 Bacteria 903
91 Ga0068867_100059942 3300005459 Bacteria 2822
92 Ga0068867_100169666 3300005459 Unclassified 1727
93 Ga0068867_100536141 3300005459 Bacteria 1011
94 Ga0068867_100899150 3300005459 Bacteria 797
95 Ga0070685_10041119 3300005466 Unclassified 2633
96 Ga0070685_10043489 3300005466 Bacteria 2568
97 Ga0070698_100004508 3300005471 Bacteria 15312
98 Ga0070684_100002017 3300005535 Bacteria 14936
99 Ga0070684_100014476 3300005535 Bacteria 6393
100 Ga0070684_100584097 3300005535 Bacteria 1038
101 Ga0070684_100708695 3300005535 Bacteria 938
102 Ga0070684_101029605 3300005535 Unclassified 773
103 Ga0068853_100005658 3300005539 Bacteria 9825
104 Ga0068853_100357308 3300005539 Bacteria 1360
105 Ga0068853_100816269 3300005539 Bacteria 893
106 Ga0070672_100053797 3300005543 Unclassified 3149
107 Ga0070672_100148444 3300005543 Bacteria 1938
108 Ga0070672_100170283 3300005543 Bacteria 1811
109 Ga0070672_100637527 3300005543 Unclassified 930
110 Ga0070672_100893991 3300005543 Bacteria 784
111 Ga0070686_100484711 3300005544 Bacteria 957
112 Ga0070686_101324715 3300005544 Unclassified 602
113 Ga0070696_100614034 3300005546 Bacteria 878
114 Ga0070693_100807870 3300005547 Bacteria 696
115 Ga0070665_100028746 3300005548 Bacteria 5598
116 Ga0070665_100437607 3300005548 Unclassified 1317
117 Ga0070704_101824294 3300005549 Bacteria 563
118 Ga0068855_100008669 3300005563 Bacteria 12289
119 Ga0068855_100459200 3300005563 Bacteria 1389
120 Ga0068855_100736767 3300005563 Unclassified 1052
121 Ga0068855_100944458 3300005563 Bacteria 909
122 Ga0068855_101826775 3300005563 Bacteria 617
123 Ga0070664_100001971 3300005564 Bacteria 16458
124 Ga0070664_100027127 3300005564 Bacteria 4758
125 Ga0070664_100048496 3300005564 Unclassified 3589
126 Ga0070664_100261496 3300005564 Bacteria 1557
127 Ga0070664_100481049 3300005564 Bacteria 1143
128 Ga0070664_100513769 3300005564 Bacteria 1105
129 Ga0070664_101770894 3300005564 Unclassified 586
130 Ga0070664_101989700 3300005564 Bacteria 551
131 Ga0068857_100016740 3300005577 Bacteria 6422
132 Ga0068857_100140867 3300005577 Bacteria 2180
133 Ga0068857_100192329 3300005577 Unclassified 1858
134 Ga0068857_100192711 3300005577 Bacteria 1856
135 Ga0068857_100744716 3300005577 Unclassified 933
136 Ga0068854_100216118 3300005578 Bacteria 1514
137 Ga0068854_100250692 3300005578 Bacteria 1413
138 Ga0068854_100617364 3300005578 Bacteria 927
139 Ga0068856_100057041 3300005614 Bacteria 3855
140 Ga0070702_100631033 3300005615 Bacteria 808
141 Ga0068852_100272099 3300005616 Bacteria 1630
142 Ga0068852_100670196 3300005616 Unclassified 1046
143 Ga0068859_100038203 3300005617 Unclassified 4817
144 Ga0068859_100177090 3300005617 Unclassified 2214
145 Ga0068859_100198086 3300005617 Bacteria 2093
146 Ga0068859_100306458 3300005617 Bacteria 1681
147 Ga0068859_100318019 3300005617 Bacteria 1650
148 Ga0068859_100748193 3300005617 Bacteria 1066
149 Ga0068859_101282850 3300005617 Bacteria 807
150 Ga0068864_100020994 3300005618 Bacteria 5468
151 Ga0068864_100068267 3300005618 Unclassified 3088
152 Ga0068864_100276167 3300005618 Bacteria 1567
153 Ga0068864_100447270 3300005618 Bacteria 1235
154 Ga0068864_100576712 3300005618 Unclassified 1090
155 Ga0068864_100952501 3300005618 Bacteria 849
156 Ga0068864_101667955 3300005618 Unclassified 642
157 Ga0068866_10272834 3300005718 Bacteria 1044
158 Ga0068866_10374033 3300005718 Bacteria 912
159 Ga0068861_100293233 3300005719 Bacteria 1405
160 Ga0068861_100674918 3300005719 Bacteria 957
161 Ga0068861_100875544 3300005719 Bacteria 849
162 Ga0068851_10204276 3300005834 Bacteria 1104
163 Ga0068870_10055357 3300005840 Bacteria 2113
164 Ga0068870_10379996 3300005840 Bacteria 914
165 Ga0068863_100075060 3300005841 Bacteria 3199
166 Ga0068863_100490355 3300005841 Bacteria 1209
167 Ga0068863_100784530 3300005841 Bacteria 950
168 Ga0068863_102410744 3300005841 Bacteria 536
169 Ga0068858_100117062 3300005842 Bacteria 2491
170 Ga0068858_100251759 3300005842 Unclassified 1678
171 Ga0068858_100283774 3300005842 Unclassified 1577
172 Ga0068858_100552564 3300005842 Bacteria 1115
173 Ga0068858_100673406 3300005842 Bacteria 1006
174 Ga0068858_100955260 3300005842 Bacteria 839
175 Ga0068860_100548432 3300005843 Bacteria 1158
176 Ga0068860_100757693 3300005843 Bacteria 983
177 Ga0068860_100784819 3300005843 Bacteria 965
178 Ga0068860_102565385 3300005843 Unclassified 529
179 Ga0068862_100254474 3300005844 Bacteria 1601
180 Ga0068862_100743533 3300005844 Unclassified 954
181 Ga0068862_100895486 3300005844 Bacteria 872
182 Ga0068862_101907090 3300005844 Bacteria 604
183 Ga0070715_10631008 3300006163 Unclassified 632
184 Ga0097621_100000118 3300006237 Bacteria 45384
185 Ga0097621_100106441 3300006237 Unclassified 2366
186 Ga0097621_100283584 3300006237 Unclassified 1459
187 Ga0097621_100981235 3300006237 Unclassified 790
188 Ga0097621_101264967 3300006237 Unclassified 696
189 Ga0075370_11016569 3300006353 Bacteria 508
190 Ga0068871_100002078 3300006358 Bacteria 13539
191 Ga0068871_100008672 3300006358 Bacteria 7313
192 Ga0068871_100037351 3300006358 Unclassified 3873
193 Ga0068871_100300688 3300006358 Bacteria 1408
194 Ga0068871_100536914 3300006358 Bacteria 1058
195 Ga0068871_100772823 3300006358 Bacteria 884
196 Ga0068871_101019168 3300006358 Bacteria 771
197 Ga0068871_101705193 3300006358 Bacteria 597
198 Ga0075428_100019208 3300006844 Bacteria 7557
199 Ga0075428_100660136 3300006844 Bacteria 1115
200 Ga0075430_100010287 3300006846 Bacteria 7918
201 Ga0075431_100036659 3300006847 Bacteria 5051
202 Ga0075431_100067168 3300006847 Bacteria 3701
203 Ga0075429_100063888 3300006880 Bacteria 3207
204 Ga0075429_100236852 3300006880 Unclassified 1599
205 Ga0068865_100210859 3300006881 Bacteria 1514
206 Ga0068865_100222598 3300006881 Bacteria 1476
207 Ga0068865_101338199 3300006881 Bacteria 638
208 Ga0068865_101648150 3300006881 Bacteria 577
209 Ga0097620_100038205 3300006931 Unclassified 4817
210 Ga0097620_100177098 3300006931 Unclassified 2214
211 Ga0097620_100198086 3300006931 Bacteria 2093
212 Ga0097620_100306468 3300006931 Bacteria 1681
213 Ga0097620_100317997 3300006931 Bacteria 1650
214 Ga0097620_100748172 3300006931 Bacteria 1066
215 Ga0097620_101283095 3300006931 Bacteria 807
216 Ga0097620_102295307 3300006931 Bacteria 595
217 Ga0105251_10225821 3300009011 Bacteria 843
218 Ga0105240_10438001 3300009093 Bacteria 1465
219 Ga0105240_11267257 3300009093 Bacteria 778
220 Ga0111539_10217005 3300009094 Bacteria 2228
221 Ga0111539_10588165 3300009094 Bacteria 1296
222 Ga0114129_10018475 3300009147 Bacteria 9930
223 Ga0114129_10276129 3300009147 Bacteria 2247
224 Ga0105243_10000268 3300009148 Bacteria 58509
225 Ga0105243_10299220 3300009148 Bacteria 1457
226 Ga0105241_10019927 3300009174 Unclassified 4951
227 Ga0105241_10136268 3300009174 Bacteria 1994
228 Ga0105241_10285144 3300009174 Bacteria 1412
229 Ga0105241_10325546 3300009174 Bacteria 1327
230 Ga0105241_10467361 3300009174 Bacteria 1119
231 Ga0105242_10405710 3300009176 Bacteria 1273
232 Ga0105242_10831923 3300009176 Bacteria 917
233 Ga0105248_10007403 3300009177 Bacteria 12044
234 Ga0105248_10898404 3300009177 Bacteria 1000
235 Ga0105237_10434482 3300009545 Bacteria 1318
236 Ga0105237_11752328 3300009545 Unclassified 629
237 Ga0105249_10023038 3300009553 Bacteria 5583
238 Ga0105249_10335793 3300009553 Bacteria 1526
239 Ga0105249_11790689 3300009553 Bacteria 687
240 Ga0105239_10060610 3300010375 Bacteria 4153
241 Ga0105239_12885265 3300010375 Bacteria 561
242 Ga0105246_10195233 3300011119 Unclassified 1570
243 Ga0157373_10122537 3300013100 Bacteria 1827
244 Ga0157373_10677937 3300013100 Bacteria 754
245 Ga0157371_10076440 3300013102 Bacteria 2371
246 Ga0157370_10007303 3300013104 Bacteria 12057
247 Ga0157370_10030871 3300013104 Bacteria 5248
248 Ga0157370_10171884 3300013104 Bacteria 2014
249 Ga0157370_10352436 3300013104 Bacteria 1356
250 Ga0157374_10000411 3300013296 Bacteria 38796
251 Ga0157374_10026440 3300013296 Bacteria 5222
252 Ga0157374_10118296 3300013296 Unclassified 2555
253 Ga0157374_10138624 3300013296 Bacteria 2360
254 Ga0157378_10034736 3300013297 Bacteria 4459
255 Ga0157378_10082259 3300013297 Bacteria 2911
256 Ga0157378_10091419 3300013297 Unclassified 2767
257 Ga0157378_10148050 3300013297 Bacteria 2185
258 Ga0157378_10174453 3300013297 Unclassified 2018
259 Ga0157378_10223469 3300013297 Unclassified 1791
260 Ga0157378_11529053 3300013297 Bacteria 712
261 Ga0163162_10000086 3300013306 Bacteria 85949
262 Ga0163162_10007598 3300013306 Bacteria 10553
263 Ga0163162_10015871 3300013306 Bacteria 7360
264 Ga0163162_10060408 3300013306 Unclassified 3826
265 Ga0163162_10069249 3300013306 Unclassified 3580
266 Ga0163162_10092162 3300013306 Bacteria 3113
267 Ga0163162_10135439 3300013306 Bacteria 2574
268 Ga0163162_10150956 3300013306 Unclassified 2441
269 Ga0163162_10169332 3300013306 Bacteria 2309
270 Ga0163162_10526121 3300013306 Bacteria 1312
271 Ga0163162_10739346 3300013306 Bacteria 1104
272 Ga0163162_11047649 3300013306 Bacteria 923
273 Ga0157372_10484092 3300013307 Bacteria 1443
274 Ga0157372_11108122 3300013307 Bacteria 916
275 Ga0157375_10000115 3300013308 Bacteria 77964
276 Ga0157375_10013195 3300013308 Bacteria 7346
277 Ga0157375_10022228 3300013308 Bacteria 5836
278 Ga0157375_10062801 3300013308 Unclassified 3692
279 Ga0157375_10117404 3300013308 Unclassified 2766
280 Ga0157375_10498663 3300013308 Bacteria 1382
281 Ga0157375_10502756 3300013308 Bacteria 1376
282 Ga0157375_10533023 3300013308 Bacteria 1337
283 Ga0157375_12224119 3300013308 Bacteria 653
284 Ga0157375_12885449 3300013308 Unclassified 574
285 Ga0163163_10000244 3300014325 Bacteria 55634
286 Ga0163163_10000261 3300014325 Bacteria 53342
287 Ga0163163_10198288 3300014325 Bacteria 2056
288 Ga0163163_10539863 3300014325 Bacteria 1228
289 Ga0163163_10588709 3300014325 Bacteria 1176
290 Ga0163163_10761910 3300014325 Unclassified 1031
291 Ga0163163_11299851 3300014325 Unclassified 789
292 Ga0163163_11494984 3300014325 Unclassified 737
293 Ga0157380_10019147 3300014326 Bacteria 5098
294 Ga0157377_10007514 3300014745 Bacteria 5267
295 Ga0157377_10014376 3300014745 Bacteria 4026
296 Ga0157377_10063588 3300014745 Bacteria 2114
297 Ga0157377_10120111 3300014745 Bacteria 1592
298 Ga0157379_10024898 3300014968 Bacteria 5312
299 Ga0157379_10036298 3300014968 Bacteria 4395
300 Ga0157379_10397322 3300014968 Unclassified 1267
301 Ga0157379_10475879 3300014968 Bacteria 1155
302 Ga0157379_10724006 3300014968 Bacteria 935
303 Ga0157379_10890984 3300014968 Unclassified 844
304 Ga0157376_10000429 3300014969 Bacteria 27200
305 Ga0157376_10123189 3300014969 Bacteria 2301
306 Ga0157376_10129560 3300014969 Bacteria 2249
307 Ga0157376_10961250 3300014969 Unclassified 875
308 Ga0157376_11284640 3300014969 Unclassified 762
309 Ga0157376_11335600 3300014969 Bacteria 747
310 Ga0163161_10008106 3300017792 Bacteria 7266
311 Ga0163161_10011537 3300017792 Bacteria 6132
312 Ga0163161_10015887 3300017792 Bacteria 5251
313 Ga0163161_10024801 3300017792 Bacteria 4239
314 Ga0163161_10035469 3300017792 Bacteria 3570
315 Ga0163161_10095024 3300017792 Unclassified 2211
316 Ga0163161_10292164 3300017792 Bacteria 1281
317 Ga0163161_10533548 3300017792 Bacteria 960
318 Ga0163161_10941704 3300017792 Unclassified 734
319 Ga0209675_1000042 3300025291 Bacteria 235989
320 Ga0207697_10155560 3300025315 Unclassified 996
321 Ga0207656_10136963 3300025321 Unclassified 1151
322 Ga0207656_10272456 3300025321 Bacteria 833
323 Ga0207655_1000517 3300025728 Bacteria 49084
324 Ga0207682_10012828 3300025893 Bacteria 3269
325 Ga0207642_10110187 3300025899 Bacteria 1400
326 Ga0207642_10778936 3300025899 Bacteria 607
327 Ga0207680_10565550 3300025903 Bacteria 812
328 Ga0207647_10267793 3300025904 Unclassified 977
329 Ga0207645_10068923 3300025907 Bacteria 2262
330 Ga0207645_10216706 3300025907 Bacteria 1261
331 Ga0207645_10701237 3300025907 Unclassified 688
332 Ga0207643_10079669 3300025908 Bacteria 1896
333 Ga0207654_10191580 3300025911 Bacteria 1340
334 Ga0207654_10876237 3300025911 Unclassified 650
335 Ga0207671_10009138 3300025914 Bacteria 8319
336 Ga0207662_10149536 3300025918 Bacteria 1484
337 Ga0207657_10206330 3300025919 Bacteria 1579
338 Ga0207649_10022992 3300025920 Unclassified 3605
339 Ga0207650_10098621 3300025925 Bacteria 2245
340 Ga0207650_10207680 3300025925 Unclassified 1571
341 Ga0207650_10232722 3300025925 Bacteria 1486
342 Ga0207650_10272399 3300025925 Bacteria 1376
343 Ga0207650_10580051 3300025925 Bacteria 942
344 Ga0207650_11458403 3300025925 Unclassified 582
345 Ga0207659_10011402 3300025926 Bacteria 5614
346 Ga0207659_10063549 3300025926 Unclassified 2669
347 Ga0207659_10272914 3300025926 Bacteria 1380
348 Ga0207659_10287706 3300025926 Bacteria 1345
349 Ga0207644_10047231 3300025931 Unclassified 3071
350 Ga0207644_10139609 3300025931 Unclassified 1865
351 Ga0207644_10356795 3300025931 Bacteria 1188
352 Ga0207644_10892936 3300025931 Bacteria 745
353 Ga0207690_10024581 3300025932 Unclassified 3774
354 Ga0207690_10036624 3300025932 Bacteria 3178
355 Ga0207690_10790730 3300025932 Bacteria 784
356 Ga0207706_10098722 3300025933 Unclassified 2569
357 Ga0207706_10182559 3300025933 Unclassified 1843
358 Ga0207686_10029671 3300025934 Bacteria 3229
359 Ga0207686_10365528 3300025934 Bacteria 1090
360 Ga0207709_10001541 3300025935 Bacteria 15827
361 Ga0207709_10356055 3300025935 Bacteria 1106
362 Ga0207670_10006419 3300025936 Bacteria 6520
363 Ga0207670_10018379 3300025936 Unclassified 4248
364 Ga0207670_10063685 3300025936 Bacteria 2524
365 Ga0207704_10174395 3300025938 Bacteria 1546
366 Ga0207704_10228082 3300025938 Bacteria 1383
367 Ga0207691_10059353 3300025940 Bacteria 3479
368 Ga0207691_10118635 3300025940 Unclassified 2347
369 Ga0207691_10457359 3300025940 Bacteria 1086
370 Ga0207691_10534994 3300025940 Unclassified 994
371 Ga0207691_10561255 3300025940 Bacteria 968
372 Ga0207711_10076177 3300025941 Unclassified 2921
373 Ga0207711_11348714 3300025941 Bacteria 656
374 Ga0207689_10009440 3300025942 Bacteria 8424
375 Ga0207689_10010495 3300025942 Bacteria 7978
376 Ga0207689_10011229 3300025942 Bacteria 7687
377 Ga0207689_10079383 3300025942 Bacteria 2697
378 Ga0207689_10188498 3300025942 Bacteria 1701
379 Ga0207689_10226414 3300025942 Bacteria 1545
380 Ga0207689_11005799 3300025942 Unclassified 703
381 Ga0207689_11175014 3300025942 Bacteria 646
382 Ga0207661_10001926 3300025944 Bacteria 14263
383 Ga0207661_10021238 3300025944 Bacteria 4863
384 Ga0207661_10717581 3300025944 Bacteria 920
385 Ga0207679_10001000 3300025945 Bacteria 18143
386 Ga0207679_10106451 3300025945 Unclassified 2204
387 Ga0207679_10133199 3300025945 Bacteria 1997
388 Ga0207679_10370783 3300025945 Bacteria 1253
389 Ga0207679_10871073 3300025945 Unclassified 823
390 Ga0207667_11723436 3300025949 Unclassified 592
391 Ga0207651_10191645 3300025960 Bacteria 1631
392 Ga0207651_10358178 3300025960 Bacteria 1230
393 Ga0207651_11029478 3300025960 Unclassified 736
394 Ga0207651_11354334 3300025960 Unclassified 640
395 Ga0207651_11640108 3300025960 Bacteria 579
396 Ga0207712_10052402 3300025961 Bacteria 2858
397 Ga0207712_10150365 3300025961 Bacteria 1798
398 Ga0207668_10164710 3300025972 Bacteria 1732
399 Ga0207640_10176655 3300025981 Bacteria 1597
400 Ga0207640_10373745 3300025981 Bacteria 1153
401 Ga0207640_10394928 3300025981 Unclassified 1125
402 Ga0207658_10021647 3300025986 Bacteria 4466
403 Ga0207658_10055332 3300025986 Unclassified 2940
404 Ga0207658_10161260 3300025986 Bacteria 1838
405 Ga0207658_10487074 3300025986 Bacteria 1097
406 Ga0207677_10091379 3300026023 Bacteria 2214
407 Ga0207677_10573468 3300026023 Bacteria 987
408 Ga0207703_10108970 3300026035 Bacteria 2359
409 Ga0207703_10595870 3300026035 Bacteria 1045
410 Ga0207703_10664723 3300026035 Unclassified 989
411 Ga0207703_11397032 3300026035 Unclassified 673
412 Ga0207639_10004041 3300026041 Bacteria 9898
413 Ga0207639_10062451 3300026041 Bacteria 2881
414 Ga0207639_10201551 3300026041 Bacteria 1707
415 Ga0207639_10402790 3300026041 Bacteria 1233
416 Ga0207639_11729801 3300026041 Unclassified 586
417 Ga0207708_10021952 3300026075 Bacteria 4818
418 Ga0207708_10028586 3300026075 Bacteria 4222
419 Ga0207708_10836520 3300026075 Bacteria 794
420 Ga0207702_10420569 3300026078 Bacteria 1292
421 Ga0207702_11679866 3300026078 Unclassified 628
422 Ga0207641_10038937 3300026088 Bacteria 3975
423 Ga0207648_10122721 3300026089 Bacteria 2284
424 Ga0207648_10202071 3300026089 Bacteria 1762
425 Ga0207648_11116557 3300026089 Bacteria 740
426 Ga0207676_10109223 3300026095 Bacteria 2311
427 Ga0207676_10186016 3300026095 Unclassified 1823
428 Ga0207676_10293929 3300026095 Bacteria 1480
429 Ga0207676_10746373 3300026095 Bacteria 951
430 Ga0207674_10004420 3300026116 Bacteria 16918
431 Ga0207674_10024556 3300026116 Bacteria 6437
432 Ga0207674_10121351 3300026116 Bacteria 2581
433 Ga0207675_100641469 3300026118 Bacteria 1068
434 Ga0207675_100690913 3300026118 Bacteria 1029
435 Ga0207675_102700330 3300026118 Bacteria 505
436 Ga0207683_10032184 3300026121 Bacteria 4555
437 Ga0207698_10292525 3300026142 Bacteria 1512
438 Ga0207698_10382203 3300026142 Bacteria 1340
439 Ga0207698_10468972 3300026142 Bacteria 1219
440 Ga0207428_10108412 3300027907 Unclassified 2139
441 Ga0268266_10144990 3300028379 Unclassified 2134
442 Ga0268265_10209989 3300028380 Unclassified 1696
443 Ga0268265_11213051 3300028380 Bacteria 752
444 Ga0268265_12258773 3300028380 Bacteria 551
445 Ga0268264_10090325 3300028381 Bacteria 2639
446 Ga0268264_10460594 3300028381 Bacteria 1233
447 Ga0268264_10632809 3300028381 Bacteria 1057
448 Ga0268264_10898214 3300028381 Bacteria 889
449 Ga0307515_10000001 3300028794 Bacteria 4259510
450 Ga0265338_10056563 3300028800 Bacteria 3478
451 Ga0316576_10011448 3300031727 Bacteria 5816
452 Ga0316578_10075693 3300031728 Bacteria 1997
453 Ga0307516_10688478 3300031730 Bacteria 679
454 Ga0307412_10002694 3300031911 Bacteria 9861
455 Ga0307412_10006416 3300031911 Bacteria 6648
456 Ga0307412_10590423 3300031911 Bacteria 939
457 Ga0307416_100000004 3300032002 Bacteria 505535
458 Ga0307414_10000032 3300032004 Bacteria 186421
459 Ga0307414_10027915 3300032004 Bacteria 3654
460 Ga0307414_10169762 3300032004 Bacteria 1742
461 Ga0307414_10519786 3300032004 Bacteria 1056
462 Ga0307411_10051309 3300032005 Bacteria 2690
463 Ga0373957_0378947 3300035120 Unclassified 607
464 Ga0373943_0753679 3300035170 Bacteria 578
465 Ga0373955_0080579 3300035172 Bacteria 1839
466 Ga0373937_0059192 3300036401 Bacteria 3520
467 Ga0316582_0415839 3300036647 Bacteria 926
468 Ga0316584_0066933 3300036712 Bacteria 2692
469 Ga0316584_0429904 3300036712 Unclassified 937
470 Ga0436365_1788442 3300039437 Bacteria 1793
471 Ga0439439_0017760 3300041406 Bacteria 1753
472 Ga0439465_0017565 3300041413 Bacteria 2234
473 Ga0451793_1557937 3300041452 Bacteria 826
474 Ga0451800_0688030 3300041459 Unclassified 665
475 Ga0451807_0333591 3300041486 Bacteria 1022
476 Ga0451835_0601935 3300041492 Unclassified 1225
477 Ga0451837_0238481 3300041494 Bacteria 766
478 Ga0451839_0630255 3300041496 Bacteria 2404
479 Ga0451839_0819690 3300041496 Unclassified 620
480 Ga0451841_1018027 3300041498 Bacteria 502
481 Ga0451843_0817617 3300041509 Unclassified 937
482 Ga0451853_1246287 3300041512 Bacteria 2142
483 Ga0439445_0000949 3300042004 Bacteria 6171
484 Ga0439449_0042471 3300042007 Bacteria 1689
485 Ga0439457_000276 3300042014 Bacteria 14138
486 Ga0451577_0011197 3300042876 Bacteria 8506
487 Ga0451577_0044901 3300042876 Unclassified 3955
488 Ga0451577_0050731 3300042876 Bacteria 3704
489 Ga0451577_0080411 3300042876 Bacteria 2906
490 Ga0451577_0092292 3300042876 Unclassified 2703
491 Ga0451577_0100132 3300042876 Bacteria 2589
492 Ga0451577_0757316 3300042876 Bacteria 878
493 Ga0466972_0005073 3300044658 Bacteria 6599
494 Ga0466972_0099956 3300044658 Bacteria 1373
495 Ga0453683_0000010 3300044673 Bacteria 470890
496 Ga0453683_0026419 3300044673 Bacteria 3686
497 Ga0453683_0112747 3300044673 Bacteria 1710
498 Ga0453683_0153541 3300044673 Unclassified 1455
499 Ga0453683_0339772 3300044673 Unclassified 964
500 Ga0453683_0372432 3300044673 Bacteria 919
501 Ga0466961_0167812 3300044693 Bacteria 1366
502 Ga0453684_0000547 3300044712 Bacteria 142253
503 Ga0453684_0001629 3300044712 Bacteria 61225
504 Ga0453684_0004630 3300044712 Bacteria 28594
505 Ga0453684_0023060 3300044712 Bacteria 9193
506 Ga0453684_0037189 3300044712 Bacteria 6685
507 Ga0453684_0063709 3300044712 Bacteria 4713
508 Ga0453684_0087755 3300044712 Bacteria 3854
509 Ga0453684_0234504 3300044712 Bacteria 2116
510 Ga0453684_0295832 3300044712 Bacteria 1841
511 Ga0453684_0414989 3300044712 Bacteria 1505
512 Ga0453684_0572869 3300044712 Unclassified 1241
513 Ga0453684_1381399 3300044712 Bacteria 731
514 Ga0466968_0126642 3300044735 Unclassified 1159
515 Ga0466970_0815769 3300044765 Bacteria 547
516 Ga0466960_0070128 3300044901 Bacteria 1743
517 Ga0451576_0003195 3300045051 Bacteria 22866
518 Ga0451576_0008092 3300045051 Bacteria 12394
519 Ga0451576_0014924 3300045051 Bacteria 8628
520 Ga0451576_0462928 3300045051 Bacteria 1332
521 Ga0451576_0960356 3300045051 Unclassified 896
522 Ga0451576_1909200 3300045051 Bacteria 613
523 Ga0495592_0154421 3300046454 Bacteria 1584
524 Ga0495638_0081852 3300046460 Bacteria 1959
525 Ga0495638_0423111 3300046460 Unclassified 686
526 Ga0495653_0099042 3300046463 Bacteria 2116
527 Ga0495596_0005270 3300046500 Bacteria 6141
528 Ga0495606_0009567 3300046507 Bacteria 8180
529 Ga0495606_0022105 3300046507 Bacteria 4646
530 Ga0495608_0035574 3300046511 Bacteria 3358
531 Ga0495610_0000001 3300046512 Bacteria 1620061
532 Ga0495628_0022591 3300046516 Bacteria 5167
533 Ga0495630_0013805 3300046517 Bacteria 5873
534 Ga0495663_0000546 3300046525 Bacteria 13265
535 Ga0495663_0005642 3300046525 Bacteria 3464
536 Ga0495640_0270365 3300046533 Unclassified 1060
537 Ga0495586_0645240 3300046535 Bacteria 612
538 Ga0495587_0289901 3300046536 Bacteria 916
539 Ga0495609_0000060 3300046538 Bacteria 139944
540 Ga0495667_0101483 3300046559 Bacteria 1862
541 Ga0495635_0063415 3300046663 Unclassified 2538
542 Ga0495624_0916781 3300046690 Unclassified 515
543 Ga0495600_0349814 3300046809 Bacteria 926
544 Ga0495604_0167410 3300047317 Bacteria 1549
545 Ga0495680_0628321 3300047322 Unclassified 716
546 Ga0495675_0214166 3300047444 Bacteria 1168
547 Ga0495684_0253628 3300047471 Unclassified 1279
548 Ga0496101_0118589 3300048904 Bacteria 1999
549 Ga0496102_0007151 3300048905 Bacteria 9528
550 Ga0496103_0085558 3300048906 Bacteria 1987
551 Ga0496104_0251793 3300048907 Bacteria 1679
552 Ga0496104_0353638 3300048907 Bacteria 1382
553 Ga0496105_0494880 3300048908 Unclassified 960
554 Ga0496106_1049646 3300048909 Unclassified 640
555 Ga0496108_0096074 3300048911 Bacteria 2524
556 Ga0496108_0237299 3300048911 Unclassified 1586
557 Ga0496110_0618919 3300048913 Bacteria 981
558 Ga0496113_0046488 3300048916 Bacteria 3222
559 Ga0496116_0000027 3300048919 Bacteria 448077
560 Ga0496117_0000021 3300048920 Bacteria 444168
561 Ga0496118_0000330 3300048921 Bacteria 80749
562 Ga0496118_0342013 3300048921 Bacteria 801
563 Ga0496119_0000004 3300048922 Bacteria 536344
564 Ga0496121_0062267 3300048924 Bacteria 3057
565 Ga0496122_0000154 3300048925 Bacteria 160610
566 Ga0496122_0002780 3300048925 Bacteria 24068
567 Ga0496122_0012001 3300048925 Bacteria 8688
568 Ga0496122_0013361 3300048925 Bacteria 8040
569 Ga0496123_0001767 3300048926 Bacteria 28517
570 Ga0496123_0028042 3300048926 Bacteria 4178
571 Ga0496123_0067847 3300048926 Bacteria 2250
572 Ga0496123_0513347 3300048926 Bacteria 521
573 Ga0496124_0001176 3300048927 Bacteria 40893
574 Ga0496125_0000457 3300048928 Bacteria 73822
575 Ga0496125_0005133 3300048928 Bacteria 14729
576 Ga0496125_0378442 3300048928 Bacteria 835
577 Ga0496126_0003451 3300048929 Bacteria 19950
578 Ga0501294_055477 3300049517 Unclassified 515
579 Ga0501031_0009870 3300049568 Bacteria 6214
580 Ga0501034_0000002 3300049571 Bacteria 565510
581 Ga0501034_0190385 3300049571 Bacteria 2014
582 Ga0501034_0327573 3300049571 Unclassified 1463
583 Ga0501036_0018206 3300049572 Bacteria 5882
584 Ga0501037_0187424 3300049573 Bacteria 1466
585 Ga0501038_0201841 3300049574 Bacteria 1595
586 Ga0501039_0026384 3300049575 Bacteria 4464
587 Ga0501040_0656959 3300049576 Unclassified 758
588 Ga0501043_0003386 3300049579 Bacteria 13133
589 Ga0501046_0135675 3300049580 Bacteria 1864
590 Ga0501047_1341882 3300049581 Bacteria 530
591 Ga0501206_052227 3300049653 Unclassified 653
592 Ga0501257_052751 3300049686 Bacteria 1017
593 Ga0501080_0082422 3300049742 Bacteria 2988
594 Ga0501232_030426 3300049757 Bacteria 747
595 Ga0501241_000024 3300049758 Bacteria 64119
596 Ga0501269_000720 3300049766 Bacteria 5418
597 Ga0501035_0096645 3300049822 Bacteria 2595
598 Ga0501035_1144304 3300049822 Unclassified 606
599 Ga0501044_0088071 3300049823 Bacteria 3135
600 Ga0501044_0327483 3300049823 Bacteria 1455
601 Ga0501044_0506346 3300049823 Bacteria 1108
602 nmdc:mga05p37_116185_c1 3300050507 Bacteria 3288
603 nmdc:mga05p37_163611_c1 3300050507 Bacteria 2716
604 nmdc:mga05p37_339898_c1 3300050507 Bacteria 1770
605 nmdc:mga09592_63956_c1 3300050508 Unclassified 3115
606 nmdc:mga09592_791034_c1 3300050508 Bacteria 803
607 nmdc:mga0qj67_19436_c1 3300050509 Bacteria 5190
608 nmdc:mga06r32_294661_c1 3300050510 Bacteria 1609
609 nmdc:mga06r32_433713_c1 3300050510 Unclassified 1295
610 nmdc:mga08y16_196316_c1 3300050511 Bacteria 2092
611 nmdc:mga08y16_501331_c1 3300050511 Bacteria 1233
612 nmdc:mga08y16_71425_c1 3300050511 Bacteria 3617
613 Ga0500644_0015886 3300053088 Bacteria 2158
614 Ga0500646_0055959 3300053090 Bacteria 1149
615 Ga0500583_0000607 3300053092 Bacteria 10683
616 Ga0500651_0456267 3300053093 Bacteria 710
617 Ga0500556_0128478 3300053104 Bacteria 992
618 Ga0500658_0459845 3300053134 Bacteria 579
619 Ga0500588_0094743 3300053146 Bacteria 1020
620 Ga0500589_086997 3300053147 Bacteria 1385
621 Ga0500636_0320213 3300053177 Bacteria 754
622 Ga0500637_0561580 3300053178 Unclassified 550
623 Ga0500587_064761 3300053739 Viruses 565
624 2896345081 2896344016 Bacteria 3811746
625 2919180555 2919177583 Bacteria 5641607
626 Ga0070694_100255709
627 rootH1_10157391
628 Ga0055534_1026022
629 Ga0065714_10158877
630 Ga0065704_10335986
631 Ga0065712_10155663
632 Ga0065712_10206024
633 Ga0065712_10254642
634 Ga0065715_10049567
635 Ga0065715_10749071
636 Ga0065707_10264879
637 Ga0070676_10005059
638 Ga0070676_10162452
639 Ga0070676_10234289
640 Ga0070683_100038502
641 Ga0070683_100773171
642 Ga0070690_100032971
643 Ga0070690_100242434
644 Ga0070670_100134519
645 Ga0070670_100217730
646 Ga0070670_100466354
647 Ga0070670_100549532
648 Ga0070670_100718360
649 Ga0070670_100788390
650 Ga0070670_100798770
651 Ga0070677_10144263
652 Ga0068869_100002017
653 Ga0068869_100003968
654 Ga0068869_100196790
655 Ga0068869_100456712
656 Ga0070666_10487935
657 Ga0070666_10593515
658 Ga0070682_100000290
659 Ga0070682_100565868
660 Ga0070682_100793789
661 Ga0070682_100919247
662 Ga0070682_101848719
663 Ga0068868_100003530
664 Ga0068868_100178064
665 Ga0068868_100217637
666 Ga0070660_100783789
667 Ga0070689_100002002
668 Ga0070689_100008423
669 Ga0070689_100180273
670 Ga0070687_100270617
671 Ga0070687_101240908
672 Ga0070661_100001041
673 Ga0070661_100016316
674 Ga0070661_100507224
675 Ga0070661_101584817
676 Ga0070668_100221976
677 Ga0070668_101268627
678 Ga0070669_100357100
679 Ga0070675_100287939
680 Ga0070675_100485343
681 Ga0070675_101122661
682 Ga0070675_102012529
683 Ga0070671_100008744
684 Ga0070671_100041462
685 Ga0070671_100920594
686 Ga0070671_101158998
687 Ga0070674_100531095
688 Ga0070674_101295687
689 Ga0070673_100146198
690 Ga0070688_100000556
691 Ga0070688_100025303
692 Ga0070688_100031728
693 Ga0070688_100831053
694 Ga0070688_101047096
695 Ga0070659_100078930
696 Ga0070659_100153464
697 Ga0070659_100608328
698 Ga0070667_100133691
699 Ga0070667_100195199
700 Ga0070667_100282295
701 Ga0070667_101052373
702 Ga0070667_101902781
703 Ga0070701_10183327
704 Ga0070701_10224701
705 Ga0070705_100271827
706 Ga0070700_100003823
707 Ga0070700_100055011
708 Ga0070700_101333205
709 Ga0070663_100158619
710 Ga0070678_100018792
711 Ga0070678_100545871
712 Ga0070662_100022050
713 Ga0070662_100055700
714 Ga0070662_100066777
715 Ga0070662_100630909
716 Ga0068867_100059942
717 Ga0068867_100169666
718 Ga0068867_100536141
719 Ga0068867_100899150
720 Ga0070685_10041119
721 Ga0070685_10043489
722 Ga0070698_100004508
723 Ga0070684_100002017
724 Ga0070684_100014476
725 Ga0070684_100584097
726 Ga0070684_100708695
727 Ga0070684_101029605
728 Ga0068853_100005658
729 Ga0068853_100357308
730 Ga0068853_100816269
731 Ga0070672_100053797
732 Ga0070672_100148444
733 Ga0070672_100170283
734 Ga0070672_100637527
735 Ga0070672_100893991
736 Ga0070686_100484711
737 Ga0070686_101324715
738 Ga0070696_100614034
739 Ga0070693_100807870
740 Ga0070665_100028746
741 Ga0070665_100437607
742 Ga0070704_101824294
743 Ga0068855_100008669
744 Ga0068855_100459200
745 Ga0068855_100736767
746 Ga0068855_100944458
747 Ga0068855_101826775
748 Ga0070664_100001971
749 Ga0070664_100027127
750 Ga0070664_100048496
751 Ga0070664_100261496
752 Ga0070664_100481049
753 Ga0070664_100513769
754 Ga0070664_101770894
755 Ga0070664_101989700
756 Ga0068857_100016740
757 Ga0068857_100140867
758 Ga0068857_100192329
759 Ga0068857_100192711
760 Ga0068857_100744716
761 Ga0068854_100216118
762 Ga0068854_100250692
763 Ga0068854_100617364
764 Ga0068856_100057041
765 Ga0070702_100631033
766 Ga0068852_100272099
767 Ga0068852_100670196
768 Ga0068859_100038203
769 Ga0068859_100177090
770 Ga0068859_100198086
771 Ga0068859_100306458
772 Ga0068859_100318019
773 Ga0068859_100748193
774 Ga0068859_101282850
775 Ga0068864_100020994
776 Ga0068864_100068267
777 Ga0068864_100276167
778 Ga0068864_100447270
779 Ga0068864_100576712
780 Ga0068864_100952501
781 Ga0068864_101667955
782 Ga0068866_10272834
783 Ga0068866_10374033
784 Ga0068861_100293233
785 Ga0068861_100674918
786 Ga0068861_100875544
787 Ga0068851_10204276
788 Ga0068870_10055357
789 Ga0068870_10379996
790 Ga0068863_100075060
791 Ga0068863_100490355
792 Ga0068863_100784530
793 Ga0068863_102410744
794 Ga0068858_100117062
795 Ga0068858_100251759
796 Ga0068858_100283774
797 Ga0068858_100552564
798 Ga0068858_100673406
799 Ga0068858_100955260
800 Ga0068860_100548432
801 Ga0068860_100757693
802 Ga0068860_100784819
803 Ga0068860_102565385
804 Ga0068862_100254474
805 Ga0068862_100743533
806 Ga0068862_100895486
807 Ga0068862_101907090
808 Ga0070715_10631008
809 Ga0097621_100000118
810 Ga0097621_100106441
811 Ga0097621_100283584
812 Ga0097621_100981235
813 Ga0097621_101264967
814 Ga0075370_11016569
815 Ga0068871_100002078
816 Ga0068871_100008672
817 Ga0068871_100037351
818 Ga0068871_100300688
819 Ga0068871_100536914
820 Ga0068871_100772823
821 Ga0068871_101019168
822 Ga0068871_101705193
823 Ga0075428_100019208
824 Ga0075428_100660136
825 Ga0075430_100010287
826 Ga0075431_100036659
827 Ga0075431_100067168
828 Ga0075429_100063888
829 Ga0075429_100236852
830 Ga0068865_100210859
831 Ga0068865_100222598
832 Ga0068865_101338199
833 Ga0068865_101648150
834 Ga0097620_100038205
835 Ga0097620_100177098
836 Ga0097620_100198086
837 Ga0097620_100306468
838 Ga0097620_100317997
839 Ga0097620_100748172
840 Ga0097620_101283095
841 Ga0097620_102295307
842 Ga0105251_10225821
843 Ga0105240_10438001
844 Ga0105240_11267257
845 Ga0111539_10217005
846 Ga0111539_10588165
847 Ga0114129_10018475
848 Ga0114129_10276129
849 Ga0105243_10000268
850 Ga0105243_10299220
851 Ga0105241_10019927
852 Ga0105241_10136268
853 Ga0105241_10285144
854 Ga0105241_10325546
855 Ga0105241_10467361
856 Ga0105242_10405710
857 Ga0105242_10831923
858 Ga0105248_10007403
859 Ga0105248_10898404
860 Ga0105237_10434482
861 Ga0105237_11752328
862 Ga0105249_10023038
863 Ga0105249_10335793
864 Ga0105249_11790689
865 Ga0105239_10060610
866 Ga0105239_12885265
867 Ga0105246_10195233
868 Ga0157373_10122537
869 Ga0157373_10677937
870 Ga0157371_10076440
871 Ga0157370_10007303
872 Ga0157370_10030871
873 Ga0157370_10171884
874 Ga0157370_10352436
875 Ga0157374_10000411
876 Ga0157374_10026440
877 Ga0157374_10118296
878 Ga0157374_10138624
879 Ga0157378_10034736
880 Ga0157378_10082259
881 Ga0157378_10091419
882 Ga0157378_10148050
883 Ga0157378_10174453
884 Ga0157378_10223469
885 Ga0157378_11529053
886 Ga0163162_10000086
887 Ga0163162_10007598
888 Ga0163162_10015871
889 Ga0163162_10060408
890 Ga0163162_10069249
891 Ga0163162_10092162
892 Ga0163162_10135439
893 Ga0163162_10150956
894 Ga0163162_10169332
895 Ga0163162_10526121
896 Ga0163162_10739346
897 Ga0163162_11047649
898 Ga0157372_10484092
899 Ga0157372_11108122
900 Ga0157375_10000115
901 Ga0157375_10013195
902 Ga0157375_10022228
903 Ga0157375_10062801
904 Ga0157375_10117404
905 Ga0157375_10498663
906 Ga0157375_10502756
907 Ga0157375_10533023
908 Ga0157375_12224119
909 Ga0157375_12885449
910 Ga0163163_10000244
911 Ga0163163_10000261
912 Ga0163163_10198288
913 Ga0163163_10539863
914 Ga0163163_10588709
915 Ga0163163_10761910
916 Ga0163163_11299851
917 Ga0163163_11494984
918 Ga0157380_10019147
919 Ga0157377_10007514
920 Ga0157377_10014376
921 Ga0157377_10063588
922 Ga0157377_10120111
923 Ga0157379_10024898
924 Ga0157379_10036298
925 Ga0157379_10397322
926 Ga0157379_10475879
927 Ga0157379_10724006
928 Ga0157379_10890984
929 Ga0157376_10000429
930 Ga0157376_10123189
931 Ga0157376_10129560
932 Ga0157376_10961250
933 Ga0157376_11284640
934 Ga0157376_11335600
935 Ga0163161_10008106
936 Ga0163161_10011537
937 Ga0163161_10015887
938 Ga0163161_10024801
939 Ga0163161_10035469
940 Ga0163161_10095024
941 Ga0163161_10292164
942 Ga0163161_10533548
943 Ga0163161_10941704
944 Ga0209675_1000042
945 Ga0207697_10155560
946 Ga0207656_10136963
947 Ga0207656_10272456
948 Ga0207655_1000517
949 Ga0207682_10012828
950 Ga0207642_10110187
951 Ga0207642_10778936
952 Ga0207680_10565550
953 Ga0207647_10267793
954 Ga0207645_10068923
955 Ga0207645_10216706
956 Ga0207645_10701237
957 Ga0207643_10079669
958 Ga0207654_10191580
959 Ga0207654_10876237
960 Ga0207671_10009138
961 Ga0207662_10149536
962 Ga0207657_10206330
963 Ga0207649_10022992
964 Ga0207650_10098621
965 Ga0207650_10207680
966 Ga0207650_10232722
967 Ga0207650_10272399
968 Ga0207650_10580051
969 Ga0207650_11458403
970 Ga0207659_10011402
971 Ga0207659_10063549
972 Ga0207659_10272914
973 Ga0207659_10287706
974 Ga0207644_10047231
975 Ga0207644_10139609
976 Ga0207644_10356795
977 Ga0207644_10892936
978 Ga0207690_10024581
979 Ga0207690_10036624
980 Ga0207690_10790730
981 Ga0207706_10098722
982 Ga0207706_10182559
983 Ga0207686_10029671
984 Ga0207686_10365528
985 Ga0207709_10001541
986 Ga0207709_10356055
987 Ga0207670_10006419
988 Ga0207670_10018379
989 Ga0207670_10063685
990 Ga0207704_10174395
991 Ga0207704_10228082
992 Ga0207691_10059353
993 Ga0207691_10118635
994 Ga0207691_10457359
995 Ga0207691_10534994
996 Ga0207691_10561255
997 Ga0207711_10076177
998 Ga0207711_11348714
999 Ga0207689_10009440
1000 Ga0207689_10010495
1001 Ga0207689_10011229
1002 Ga0207689_10079383
1003 Ga0207689_10188498
1004 Ga0207689_10226414
1005 Ga0207689_11005799
1006 Ga0207689_11175014
1007 Ga0207661_10001926
1008 Ga0207661_10021238
1009 Ga0207661_10717581
1010 Ga0207679_10001000
1011 Ga0207679_10106451
1012 Ga0207679_10133199
1013 Ga0207679_10370783
1014 Ga0207679_10871073
1015 Ga0207667_11723436
1016 Ga0207651_10191645
1017 Ga0207651_10358178
1018 Ga0207651_11029478
1019 Ga0207651_11354334
1020 Ga0207651_11640108
1021 Ga0207712_10052402
1022 Ga0207712_10150365
1023 Ga0207668_10164710
1024 Ga0207640_10176655
1025 Ga0207640_10373745
1026 Ga0207640_10394928
1027 Ga0207658_10021647
1028 Ga0207658_10055332
1029 Ga0207658_10161260
1030 Ga0207658_10487074
1031 Ga0207677_10091379
1032 Ga0207677_10573468
1033 Ga0207703_10108970
1034 Ga0207703_10595870
1035 Ga0207703_10664723
1036 Ga0207703_11397032
1037 Ga0207639_10004041
1038 Ga0207639_10062451
1039 Ga0207639_10201551
1040 Ga0207639_10402790
1041 Ga0207639_11729801
1042 Ga0207708_10021952
1043 Ga0207708_10028586
1044 Ga0207708_10836520
1045 Ga0207702_10420569
1046 Ga0207702_11679866
1047 Ga0207641_10038937
1048 Ga0207648_10122721
1049 Ga0207648_10202071
1050 Ga0207648_11116557
1051 Ga0207676_10109223
1052 Ga0207676_10186016
1053 Ga0207676_10293929
1054 Ga0207676_10746373
1055 Ga0207674_10004420
1056 Ga0207674_10024556
1057 Ga0207674_10121351
1058 Ga0207675_100641469
1059 Ga0207675_100690913
1060 Ga0207675_102700330
1061 Ga0207683_10032184
1062 Ga0207698_10292525
1063 Ga0207698_10382203
1064 Ga0207698_10468972
1065 Ga0207428_10108412
1066 Ga0268266_10144990
1067 Ga0268265_10209989
1068 Ga0268265_11213051
1069 Ga0268265_12258773
1070 Ga0268264_10090325
1071 Ga0268264_10460594
1072 Ga0268264_10632809
1073 Ga0268264_10898214
1074 Ga0307515_10000001
1075 Ga0265338_10056563
1076 Ga0316576_10011448
1077 Ga0316578_10075693
1078 Ga0307516_10688478
1079 Ga0307412_10002694
1080 Ga0307412_10006416
1081 Ga0307412_10590423
1082 Ga0307416_100000004
1083 Ga0307414_10000032
1084 Ga0307414_10027915
1085 Ga0307414_10169762
1086 Ga0307414_10519786
1087 Ga0307411_10051309
1088 Ga0373957_0378947
1089 Ga0373943_0753679
1090 Ga0373955_0080579
1091 Ga0373937_0059192
1092 Ga0316582_0415839
1093 Ga0316584_0066933
1094 Ga0316584_0429904
1095 Ga0436365_1788442
1096 Ga0439439_0017760
1097 Ga0439465_0017565
1098 Ga0451793_1557937
1099 Ga0451800_0688030
1100 Ga0451807_0333591
1101 Ga0451835_0601935
1102 Ga0451837_0238481
1103 Ga0451839_0630255
1104 Ga0451839_0819690
1105 Ga0451841_1018027
1106 Ga0451843_0817617
1107 Ga0451853_1246287
1108 Ga0439445_0000949
1109 Ga0439449_0042471
1110 Ga0439457_000276
1111 Ga0451577_0011197
1112 Ga0451577_0044901
1113 Ga0451577_0050731
1114 Ga0451577_0080411
1115 Ga0451577_0092292
1116 Ga0451577_0100132
1117 Ga0451577_0757316
1118 Ga0466972_0005073
1119 Ga0466972_0099956
1120 Ga0453683_0000010
1121 Ga0453683_0026419
1122 Ga0453683_0112747
1123 Ga0453683_0153541
1124 Ga0453683_0339772
1125 Ga0453683_0372432
1126 Ga0466961_0167812
1127 Ga0453684_0000547
1128 Ga0453684_0001629
1129 Ga0453684_0004630
1130 Ga0453684_0023060
1131 Ga0453684_0037189
1132 Ga0453684_0063709
1133 Ga0453684_0087755
1134 Ga0453684_0234504
1135 Ga0453684_0295832
1136 Ga0453684_0414989
1137 Ga0453684_0572869
1138 Ga0453684_1381399
1139 Ga0466968_0126642
1140 Ga0466970_0815769
1141 Ga0466960_0070128
1142 Ga0451576_0003195
1143 Ga0451576_0008092
1144 Ga0451576_0014924
1145 Ga0451576_0462928
1146 Ga0451576_0960356
1147 Ga0451576_1909200
1148 Ga0495592_0154421
1149 Ga0495638_0081852
1150 Ga0495638_0423111
1151 Ga0495653_0099042
1152 Ga0495596_0005270
1153 Ga0495606_0009567
1154 Ga0495606_0022105
1155 Ga0495608_0035574
1156 Ga0495610_0000001
1157 Ga0495628_0022591
1158 Ga0495630_0013805
1159 Ga0495663_0000546
1160 Ga0495663_0005642
1161 Ga0495640_0270365
1162 Ga0495586_0645240
1163 Ga0495587_0289901
1164 Ga0495609_0000060
1165 Ga0495667_0101483
1166 Ga0495635_0063415
1167 Ga0495624_0916781
1168 Ga0495600_0349814
1169 Ga0495604_0167410
1170 Ga0495680_0628321
1171 Ga0495675_0214166
1172 Ga0495684_0253628
1173 Ga0496101_0118589
1174 Ga0496102_0007151
1175 Ga0496103_0085558
1176 Ga0496104_0251793
1177 Ga0496104_0353638
1178 Ga0496105_0494880
1179 Ga0496106_1049646
1180 Ga0496108_0096074
1181 Ga0496108_0237299
1182 Ga0496110_0618919
1183 Ga0496113_0046488
1184 Ga0496116_0000027
1185 Ga0496117_0000021
1186 Ga0496118_0000330
1187 Ga0496118_0342013
1188 Ga0496119_0000004
1189 Ga0496121_0062267
1190 Ga0496122_0000154
1191 Ga0496122_0002780
1192 Ga0496122_0012001
1193 Ga0496122_0013361
1194 Ga0496123_0001767
1195 Ga0496123_0028042
1196 Ga0496123_0067847
1197 Ga0496123_0513347
1198 Ga0496124_0001176
1199 Ga0496125_0000457
1200 Ga0496125_0005133
1201 Ga0496125_0378442
1202 Ga0496126_0003451
1203 Ga0501294_055477
1204 Ga0501031_0009870
1205 Ga0501034_0000002
1206 Ga0501034_0190385
1207 Ga0501034_0327573
1208 Ga0501036_0018206
1209 Ga0501037_0187424
1210 Ga0501038_0201841
1211 Ga0501039_0026384
1212 Ga0501040_0656959
1213 Ga0501043_0003386
1214 Ga0501046_0135675
1215 Ga0501047_1341882
1216 Ga0501206_052227
1217 Ga0501257_052751
1218 Ga0501080_0082422
1219 Ga0501232_030426
1220 Ga0501241_000024
1221 Ga0501269_000720
1222 Ga0501035_0096645
1223 Ga0501035_1144304
1224 Ga0501044_0088071
1225 Ga0501044_0327483
1226 Ga0501044_0506346
1227 nmdc:mga05p37_116185_c1
1228 nmdc:mga05p37_163611_c1
1229 nmdc:mga05p37_339898_c1
1230 nmdc:mga09592_63956_c1
1231 nmdc:mga09592_791034_c1
1232 nmdc:mga0qj67_19436_c1
1233 nmdc:mga06r32_294661_c1
1234 nmdc:mga06r32_433713_c1
1235 nmdc:mga08y16_196316_c1
1236 nmdc:mga08y16_501331_c1
1237 nmdc:mga08y16_71425_c1
1238 Ga0500644_0015886
1239 Ga0500646_0055959
1240 Ga0500583_0000607
1241 Ga0500651_0456267
1242 Ga0500556_0128478
1243 Ga0500658_0459845
1244 Ga0500588_0094743
1245 Ga0500589_086997
1246 Ga0500636_0320213
1247 Ga0500637_0561580
1248 Ga0500587_064761
1249 2896345081
1250 2919180555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wgi-assembly1.cif.gz_7 atomic model of the mutant occm (orc-cdc6-cdt1-mcm2-7 with mcm6 whd truncation) loaded on dna at 10.5 a resolution 0.7299 48 117
6wgf-assembly1.cif.gz_7 atomic model of mutant mcm2-7 hexamer with mcm6 whd truncation 0.7299 48 117
6wgg-assembly1.cif.gz_7 atomic model of pre-insertion mutant occm-dna complex(orc-cdc6-cdt1-mcm2-7 with mcm6 whd truncation) 0.7299 48 117
7yny-assembly1.cif.gz_B crystal structure of baculovirus lef-3 from helicoverpa armigera nucleopolyhedrovirus 0.715 29 112
3vdy-assembly1.cif.gz_B-2 b. subtilis ssbb/ssdna 0.6982 28 121
ID Description Score Start End Superfamily
3k80C00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6749 30 119 2.40.50.140
af_F1QMX7_108_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.647 37 75 3.50.50.60
af_Q2G112_1_115_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6427 30 121 2.40.50.140
af_Q5AA01_14_143_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6415 25 121 2.40.50.140
3rd4A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.6414 30 104 2.40.50.660
ID Description Score Start End GO Terms
AF-A0A220SGE5-F1-model_v4 6-phosphogluconate dehydrogenase 0.9676 1 121 GO:0016020
AF-A0A3G2G439-F1-model_v4 6-phosphogluconate dehydrogenase 0.9633 1 121 GO:0016020
AF-A0A4V1UD76-F1-model_v4 6-phosphogluconate dehydrogenase 0.9618 11 121
AF-E4T8G1-F1-model_v4 6-phosphogluconate dehydrogenase 0.9612 2 121 GO:0016020
AF-A0A0J7LJZ9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9599 1 121 GO:0016020

Map