F470275

General Info

Members Datasets Scaffolds Average Seq Length
624 280 601 294

Family's Representative Sequence

Representative Sequence 3300025254|Ga0209148_1002183|Ga0209148_10021834
Length 323
Sequence MSNARSRPGAVRALRAAIMSPSPIPALLMSPIRYKQLDVFAARHGGGNPLGVVVDAQGWSDSRMQRFAHWTNLVETTFLMPPRVDGADYRARIYTPTKEIPFAGHPTIGSAHAALDAGLVTPDAAGIVWQECGAGVLPIRVEGDGPTRELFVQSPKARIVGDASRGGETLSAVLYGVKLGALAPACVEGGRRWWVAEFADESVLRGWRPDHAAIRALALATDTLGLCVFARSAEGLAVRAFPAGVGIVEDPASGAANGLIAAYVAERDTSGALANGYVVSQGREVGHDARIIIRIDGDAVWVGGRTNTIIDGHVDWQEWEPAA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2738543009 Luteibacter sp. OK325 Isolate Unclassified
10 2739367700 Dyella sp. YR388 Isolate Unclassified
11 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
12 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
13 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
14 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
15 2884411467 Dyella sp. AD56 Isolate Rhizosphere
16 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
17 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
18 2919085039 Luteibacter sp. 1214 Isolate Unclassified
19 2919404418 Luteibacter sp. 3190 Isolate Unclassified
20 2928963466 Dyella japonica 1073 Isolate Unclassified
21 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
22 2941471342 Luteibacter sp. 621 Isolate Unclassified
23 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
31 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
32 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
40 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
41 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
42 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
43 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
44 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
45 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
190 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
230 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
253 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
274 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
275 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
276 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 0.48
Isolates 3.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.03
Nodule 0
Rhizoplane 2.24
Rhizosphere 67.63
Stem 0
Stem Tuber 0
Unclassified 14.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015416 3300001979 Bacteria 2791
2 JGI24739J22299_10008023 3300001989 Bacteria 3948
3 JGI24737J22298_10023518 3300001990 Bacteria 1954
4 JGI24735J21928_10012147 3300002067 Bacteria 2724
5 JGI25156J39149_1000214 3300002705 Bacteria 40310
6 JGI25156J39149_1004656 3300002705 Bacteria 4124
7 JGI25162J39368_1000138 3300002737 Bacteria 78713
8 JGI25162J39368_1000443 3300002737 Bacteria 32916
9 JGI25162J39368_1000786 3300002737 Bacteria 21328
10 JGI25162J39368_1001136 3300002737 Bacteria 16004
11 JGI25162J39368_1001541 3300002737 Bacteria 11869
12 JGI25157J39369_1000172 3300002741 Bacteria 54469
13 JGI25157J39369_1000441 3300002741 Bacteria 26541
14 JGI25157J39369_1001675 3300002741 Bacteria 7530
15 JGI25157J39369_1002337 3300002741 Bacteria 4914
16 JGI25163J39215_1000278 3300002771 Bacteria 18020
17 JGI25164J39214_1000170 3300002772 Bacteria 60952
18 JGI25164J39214_1000310 3300002772 Bacteria 32075
19 JGI25164J39214_1000375 3300002772 Bacteria 26542
20 JGI25164J39214_1000704 3300002772 Bacteria 12938
21 JGI25165J46597_1000224 3300003214 Bacteria 78713
22 JGI25165J46597_1000580 3300003214 Bacteria 32075
23 JGI25165J46597_1001211 3300003214 Bacteria 15549
24 JGI25153J46596_10010874 3300003215 Bacteria 4074
25 rootH1_10004229 3300003316 Bacteria 2659
26 rootH1_10026498 3300003316 Bacteria 4956
27 rootH2_10000174 3300003320 Bacteria 21671
28 rootL2_10143337 3300003322 Bacteria 1835
29 rootH1_10370125 3300003323 Bacteria 1826
30 Ga0006562J51391_1040232 3300003578 Bacteria 2790
31 Ga0055538_1001394 3300003751 Bacteria 4730
32 Ga0055539_1005118 3300003752 Bacteria 1714
33 Ga0055533_1001750 3300003756 Bacteria 5528
34 Ga0055525_1000192 3300003759 Bacteria 72944
35 Ga0055527_1000041 3300003760 Bacteria 116981
36 Ga0055527_1000234 3300003760 Bacteria 34826
37 Ga0055535_1000193 3300003761 Bacteria 64634
38 Ga0055535_1000216 3300003761 Bacteria 60912
39 Ga0055535_1000457 3300003761 Bacteria 37713
40 Ga0055535_1000502 3300003761 Bacteria 34740
41 Ga0055535_1001000 3300003761 Bacteria 18231
42 Ga0055542_1000136 3300003762 Bacteria 93218
43 Ga0055542_1000152 3300003762 Bacteria 87561
44 Ga0055542_1000179 3300003762 Bacteria 78713
45 Ga0055542_1000183 3300003762 Bacteria 77794
46 Ga0055542_1000520 3300003762 Bacteria 34740
47 Ga0055529_1000116 3300003763 Bacteria 117929
48 Ga0055529_1000189 3300003763 Bacteria 84123
49 Ga0055529_1000254 3300003763 Bacteria 64036
50 Ga0055529_1001001 3300003763 Bacteria 13766
51 Ga0055529_1001913 3300003763 Bacteria 4754
52 Ga0065165_1000096 3300005262 Bacteria 144938
53 Ga0065165_1000790 3300005262 Bacteria 42379
54 Ga0070658_10015567 3300005327 Bacteria 6082
55 Ga0070658_10265566 3300005327 Bacteria 1458
56 Ga0070683_100047586 3300005329 Bacteria 3963
57 Ga0068869_100005338 3300005334 Bacteria 8079
58 Ga0070666_10000003 3300005335 Bacteria 463666
59 Ga0070666_10137130 3300005335 Bacteria 1703
60 Ga0070680_100004819 3300005336 Bacteria 10160
61 Ga0070680_100056142 3300005336 Bacteria 3219
62 Ga0070680_100134325 3300005336 Bacteria 2071
63 Ga0070682_100043403 3300005337 Bacteria 2780
64 Ga0068868_100021255 3300005338 Bacteria 4887
65 Ga0070660_100291430 3300005339 Bacteria 1337
66 Ga0070660_100293235 3300005339 Bacteria 1332
67 Ga0070661_100007344 3300005344 Bacteria 7598
68 Ga0070661_100041693 3300005344 Bacteria 3349
69 Ga0070661_100087345 3300005344 Bacteria 2306
70 Ga0070661_100103054 3300005344 Bacteria 2125
71 Ga0070661_100331038 3300005344 Bacteria 1191
72 Ga0070692_10006030 3300005345 Bacteria 5226
73 Ga0070692_10024287 3300005345 Bacteria 2978
74 Ga0070668_100059506 3300005347 Bacteria 2957
75 Ga0070668_100093852 3300005347 Bacteria 2368
76 Ga0070669_100154339 3300005353 Bacteria 1779
77 Ga0070659_100003331 3300005366 Bacteria 11431
78 Ga0070659_100132350 3300005366 Bacteria 2026
79 Ga0070667_100010708 3300005367 Bacteria 7579
80 Ga0070714_100000088 3300005435 Bacteria 77301
81 Ga0070714_100000148 3300005435 Bacteria 55926
82 Ga0070714_100047584 3300005435 Bacteria 3645
83 Ga0070713_100330964 3300005436 Bacteria 1409
84 Ga0070711_100456615 3300005439 Bacteria 1047
85 Ga0070663_100002993 3300005455 Bacteria 9640
86 Ga0070663_100060000 3300005455 Bacteria 2735
87 Ga0070663_100062106 3300005455 Bacteria 2692
88 Ga0070663_100091318 3300005455 Bacteria 2256
89 Ga0070678_100087489 3300005456 Bacteria 2380
90 Ga0070662_100019019 3300005457 Bacteria 4657
91 Ga0070681_10007740 3300005458 Bacteria 10502
92 Ga0070681_10016767 3300005458 Bacteria 7313
93 Ga0070681_10020540 3300005458 Bacteria 6619
94 Ga0070681_10022604 3300005458 Bacteria 6316
95 Ga0070681_10103891 3300005458 Bacteria 2784
96 Ga0070679_100003055 3300005530 Bacteria 15296
97 Ga0070679_100089416 3300005530 Bacteria 3067
98 Ga0070684_100010036 3300005535 Bacteria 7486
99 Ga0070684_100113926 3300005535 Bacteria 2427
100 Ga0068853_100001898 3300005539 Bacteria 15410
101 Ga0068853_100035461 3300005539 Bacteria 4237
102 Ga0068853_100164219 3300005539 Bacteria 2005
103 Ga0068853_100260775 3300005539 Bacteria 1593
104 Ga0068853_100470962 3300005539 Bacteria 1183
105 Ga0070672_100032024 3300005543 Bacteria 3964
106 Ga0070696_100014958 3300005546 Bacteria 5210
107 Ga0070696_100051264 3300005546 Bacteria 2870
108 Ga0070696_100091599 3300005546 Bacteria 2165
109 Ga0070693_100087809 3300005547 Bacteria 1868
110 Ga0070693_100182390 3300005547 Unclassified 1352
111 Ga0070665_100000108 3300005548 Bacteria 155204
112 Ga0070665_100080003 3300005548 Bacteria 3273
113 Ga0070665_100526427 3300005548 Bacteria 1194
114 Ga0070665_100557228 3300005548 Bacteria 1158
115 Ga0068855_100009108 3300005563 Bacteria 11992
116 Ga0068855_100017751 3300005563 Bacteria 8554
117 Ga0068855_100231504 3300005563 Bacteria 2069
118 Ga0068857_100000319 3300005577 Bacteria 33193
119 Ga0068857_100332255 3300005577 Bacteria 1405
120 Ga0068854_100001263 3300005578 Bacteria 15187
121 Ga0068854_100009471 3300005578 Bacteria 6288
122 Ga0068854_100209424 3300005578 Bacteria 1537
123 Ga0068856_100000652 3300005614 Bacteria 37607
124 Ga0068856_100004957 3300005614 Bacteria 13178
125 Ga0068856_100116890 3300005614 Bacteria 2668
126 Ga0068852_100016098 3300005616 Bacteria 5821
127 Ga0068852_100094362 3300005616 Bacteria 2684
128 Ga0068852_100316030 3300005616 Bacteria 1515
129 Ga0068859_100498816 3300005617 Bacteria 1312
130 Ga0068851_10013091 3300005834 Bacteria 3924
131 Ga0068870_10013383 3300005840 Bacteria 3855
132 Ga0068858_100101090 3300005842 Bacteria 2689
133 Ga0068860_100007698 3300005843 Bacteria 10771
134 Ga0068860_100042860 3300005843 Bacteria 4319
135 Ga0068860_100269856 3300005843 Bacteria 1660
136 Ga0068862_100285142 3300005844 Bacteria 1515
137 Ga0075369_10041684 3300006186 Bacteria 1966
138 Ga0097621_100030079 3300006237 Bacteria 4296
139 Ga0097621_100055814 3300006237 Bacteria 3226
140 Ga0097621_100119645 3300006237 Bacteria 2232
141 Ga0068871_100328157 3300006358 Bacteria 1349
142 Ga0068865_100056682 3300006881 Bacteria 2731
143 Ga0097620_100498793 3300006931 Bacteria 1312
144 Ga0105240_10000254 3300009093 Bacteria 106067
145 Ga0105240_10002163 3300009093 Bacteria 32091
146 Ga0105240_10014975 3300009093 Bacteria 10566
147 Ga0105240_10032831 3300009093 Bacteria 6715
148 Ga0105240_10073114 3300009093 Bacteria 4235
149 Ga0105240_10223465 3300009093 Bacteria 2192
150 Ga0105240_10500364 3300009093 Bacteria 1351
151 Ga0105245_10117984 3300009098 Bacteria 2476
152 Ga0105247_10046289 3300009101 Bacteria 2670
153 Ga0105241_10043360 3300009174 Bacteria 3407
154 Ga0105242_10000989 3300009176 Bacteria 22233
155 Ga0105242_10214624 3300009176 Bacteria 1716
156 Ga0105237_10000007 3300009545 Bacteria 367690
157 Ga0105237_10000307 3300009545 Bacteria 68076
158 Ga0105237_10179690 3300009545 Bacteria 2116
159 Ga0105237_10553705 3300009545 Bacteria 1157
160 Ga0105238_10000802 3300009551 Bacteria 32599
161 Ga0105238_10053485 3300009551 Bacteria 4057
162 Ga0105238_10231913 3300009551 Bacteria 1823
163 Ga0105239_10000020 3300010375 Bacteria 264435
164 Ga0105239_10011929 3300010375 Bacteria 9691
165 Ga0105239_10045299 3300010375 Bacteria 4821
166 Ga0105239_10055911 3300010375 Bacteria 4329
167 Ga0157314_1001390 3300012500 Bacteria 1744
168 Ga0157373_10022648 3300013100 Bacteria 4557
169 Ga0157373_10080848 3300013100 Bacteria 2292
170 Ga0157371_10033207 3300013102 Bacteria 3709
171 Ga0157371_10093840 3300013102 Bacteria 2126
172 Ga0157371_10376717 3300013102 Unclassified 1036
173 Ga0157370_10000371 3300013104 Bacteria 56531
174 Ga0157370_10008606 3300013104 Bacteria 10986
175 Ga0157370_10054162 3300013104 Bacteria 3824
176 Ga0157370_10056785 3300013104 Bacteria 3725
177 Ga0157370_10138013 3300013104 Bacteria 2272
178 Ga0157369_10000030 3300013105 Bacteria 203569
179 Ga0157369_10001880 3300013105 Bacteria 25312
180 Ga0157369_10002156 3300013105 Bacteria 23727
181 Ga0157374_10224417 3300013296 Bacteria 1844
182 Ga0157378_10000031 3300013297 Bacteria 124224
183 Ga0157378_10561244 3300013297 Bacteria 1148
184 Ga0163162_10019923 3300013306 Bacteria 6589
185 Ga0163162_10026006 3300013306 Bacteria 5784
186 Ga0163162_10051792 3300013306 Bacteria 4120
187 Ga0163162_10244487 3300013306 Bacteria 1926
188 Ga0157372_10007619 3300013307 Bacteria 11513
189 Ga0157372_10016545 3300013307 Bacteria 7914
190 Ga0157372_10239069 3300013307 Bacteria 2107
191 Ga0157372_10427550 3300013307 Bacteria 1544
192 Ga0157372_10526073 3300013307 Bacteria 1378
193 Ga0157375_10000333 3300013308 Bacteria 42507
194 Ga0157375_10021391 3300013308 Bacteria 5929
195 Ga0157375_10727856 3300013308 Bacteria 1144
196 Ga0182008_10009764 3300014497 Bacteria 5164
197 Ga0182008_10012102 3300014497 Bacteria 4564
198 Ga0182008_10078947 3300014497 Bacteria 1619
199 Ga0182008_10136813 3300014497 Bacteria 1224
200 Ga0157379_10146299 3300014968 Bacteria 2131
201 Ga0157376_10003889 3300014969 Bacteria 10330
202 Ga0157376_10271662 3300014969 Bacteria 1593
203 Ga0182006_1000293 3300015261 Bacteria 44075
204 Ga0182006_1000492 3300015261 Bacteria 30798
205 Ga0182006_1018790 3300015261 Bacteria 2916
206 Ga0182007_10009655 3300015262 Bacteria 3871
207 Ga0182007_10010487 3300015262 Bacteria 3656
208 Ga0182007_10015241 3300015262 Bacteria 2874
209 Ga0182007_10024285 3300015262 Bacteria 2122
210 Ga0182007_10036532 3300015262 Bacteria 1652
211 Ga0182005_1000079 3300015265 Bacteria 76726
212 Ga0182005_1001099 3300015265 Bacteria 11313
213 Ga0182005_1014243 3300015265 Bacteria 2226
214 Ga0183369_1006 3300015685 Bacteria 449058
215 Ga0206356_11456893 3300020070 Bacteria 1625
216 Ga0206354_10628491 3300020081 Bacteria 2222
217 Ga0209760_100574 3300025207 Bacteria 6512
218 Ga0209784_100068 3300025224 Bacteria 152526
219 Ga0209566_101753 3300025225 Bacteria 5169
220 Ga0209674_100012 3300025226 Bacteria 950162
221 Ga0209674_100148 3300025226 Bacteria 98100
222 Ga0209674_100336 3300025226 Bacteria 28357
223 Ga0209674_102042 3300025226 Bacteria 4633
224 Ga0209672_100005 3300025228 Bacteria 1069303
225 Ga0209672_100045 3300025228 Bacteria 264926
226 Ga0209672_100100 3300025228 Bacteria 108785
227 Ga0209672_100350 3300025228 Bacteria 29469
228 Ga0209672_100676 3300025228 Bacteria 17169
229 Ga0209563_100023 3300025230 Bacteria 636844
230 Ga0207427_100069 3300025231 Bacteria 161547
231 Ga0207427_100139 3300025231 Bacteria 84807
232 Ga0207427_100140 3300025231 Bacteria 84637
233 Ga0207427_100216 3300025231 Bacteria 50601
234 Ga0207427_102880 3300025231 Bacteria 4098
235 Ga0209437_100139 3300025233 Bacteria 172506
236 Ga0209437_100147 3300025233 Bacteria 161997
237 Ga0209437_100154 3300025233 Bacteria 153383
238 Ga0209437_100462 3300025233 Bacteria 32102
239 Ga0209437_100463 3300025233 Bacteria 32076
240 Ga0209437_102085 3300025233 Bacteria 4059
241 Ga0209437_102538 3300025233 Bacteria 3516
242 Ga0209258_100006 3300025242 Bacteria 1069303
243 Ga0209258_100024 3300025242 Bacteria 542096
244 Ga0209258_100111 3300025242 Bacteria 197019
245 Ga0209258_100200 3300025242 Bacteria 123379
246 Ga0209258_100360 3300025242 Bacteria 61533
247 Ga0209258_100992 3300025242 Bacteria 13094
248 Ga0209258_105591 3300025242 Bacteria 2098
249 Ga0209646_1000448 3300025246 Bacteria 21870
250 Ga0209646_1000896 3300025246 Bacteria 9713
251 Ga0209646_1004003 3300025246 Bacteria 2771
252 Ga0209026_1000074 3300025250 Bacteria 203820
253 Ga0209026_1000099 3300025250 Bacteria 161750
254 Ga0209026_1000145 3300025250 Bacteria 111490
255 Ga0209026_1000737 3300025250 Bacteria 18882
256 Ga0209026_1000914 3300025250 Bacteria 15138
257 Ga0209026_1005345 3300025250 Bacteria 3478
258 Ga0209148_1000002 3300025254 Bacteria 2399500
259 Ga0209148_1000009 3300025254 Bacteria 1395625
260 Ga0209148_1000010 3300025254 Bacteria 1265567
261 Ga0209148_1000012 3300025254 Bacteria 1069303
262 Ga0209148_1000045 3300025254 Bacteria 448076
263 Ga0209148_1000099 3300025254 Bacteria 227713
264 Ga0209148_1002183 3300025254 Bacteria 7237
265 Ga0209759_1000110 3300025256 Bacteria 144917
266 Ga0209759_1000247 3300025256 Bacteria 80850
267 Ga0209759_1000605 3300025256 Bacteria 34670
268 Ga0209759_1010011 3300025256 Bacteria 2816
269 Ga0209759_1011976 3300025256 Bacteria 2428
270 Ga0209129_1007014 3300025258 Bacteria 3465
271 Ga0209233_1000009 3300025261 Bacteria 1265567
272 Ga0209233_1000083 3300025261 Bacteria 336016
273 Ga0209233_1000092 3300025261 Bacteria 308668
274 Ga0209233_1000191 3300025261 Bacteria 127938
275 Ga0209233_1000251 3300025261 Bacteria 84807
276 Ga0209233_1013801 3300025261 Bacteria 2298
277 Ga0209455_1000008 3300025272 Bacteria 1069303
278 Ga0209455_1000029 3300025272 Bacteria 542096
279 Ga0209455_1000035 3300025272 Bacteria 479071
280 Ga0209455_1000086 3300025272 Bacteria 244650
281 Ga0209455_1000357 3300025272 Bacteria 42718
282 Ga0209758_1000276 3300025297 Bacteria 102362
283 Ga0209758_1008138 3300025297 Bacteria 6892
284 Ga0209256_1005639 3300025299 Bacteria 7066
285 Ga0207426_1010114 3300025302 Bacteria 3684
286 Ga0209051_1022640 3300025303 Bacteria 2640
287 Ga0209257_1039423 3300025304 Bacteria 1420
288 Ga0207656_10022469 3300025321 Bacteria 2531
289 Ga0207680_10000006 3300025903 Bacteria 635950
290 Ga0207680_10184660 3300025903 Bacteria 1412
291 Ga0207647_10000190 3300025904 Bacteria 49689
292 Ga0207647_10009552 3300025904 Bacteria 6885
293 Ga0207647_10015118 3300025904 Bacteria 5302
294 Ga0207705_10013820 3300025909 Bacteria 5823
295 Ga0207705_10018956 3300025909 Bacteria 4921
296 Ga0207705_10023487 3300025909 Bacteria 4398
297 Ga0207705_10109550 3300025909 Bacteria 2039
298 Ga0207654_10010585 3300025911 Bacteria 4696
299 Ga0207707_10000248 3300025912 Bacteria 59206
300 Ga0207707_10053099 3300025912 Bacteria 3528
301 Ga0207707_10057192 3300025912 Bacteria 3394
302 Ga0207707_10083785 3300025912 Bacteria 2784
303 Ga0207707_10218534 3300025912 Bacteria 1659
304 Ga0207695_10000408 3300025913 Bacteria 95748
305 Ga0207695_10001214 3300025913 Bacteria 44135
306 Ga0207695_10002857 3300025913 Bacteria 25113
307 Ga0207695_10003147 3300025913 Bacteria 23559
308 Ga0207695_10008177 3300025913 Bacteria 13142
309 Ga0207695_10015832 3300025913 Bacteria 8858
310 Ga0207695_10051819 3300025913 Bacteria 4306
311 Ga0207695_10163234 3300025913 Bacteria 2158
312 Ga0207695_10214448 3300025913 Bacteria 1834
313 Ga0207671_10000031 3300025914 Bacteria 247030
314 Ga0207671_10000074 3300025914 Bacteria 156482
315 Ga0207671_10015285 3300025914 Bacteria 6023
316 Ga0207660_10004289 3300025917 Bacteria 9303
317 Ga0207660_10083348 3300025917 Bacteria 2354
318 Ga0207657_10068020 3300025919 Bacteria 3027
319 Ga0207657_10132050 3300025919 Bacteria 2046
320 Ga0207649_10014053 3300025920 Bacteria 4480
321 Ga0207649_10037636 3300025920 Bacteria 2924
322 Ga0207649_10131316 3300025920 Bacteria 1701
323 Ga0207652_10000914 3300025921 Bacteria 27847
324 Ga0207652_10002467 3300025921 Bacteria 15587
325 Ga0207652_10162720 3300025921 Bacteria 2001
326 Ga0207694_10002078 3300025924 Bacteria 16565
327 Ga0207694_10016049 3300025924 Bacteria 5650
328 Ga0207694_10327863 3300025924 Bacteria 1264
329 Ga0207664_10000066 3300025929 Bacteria 109573
330 Ga0207664_10000472 3300025929 Bacteria 28497
331 Ga0207690_10000579 3300025932 Bacteria 23708
332 Ga0207690_10001265 3300025932 Bacteria 15996
333 Ga0207690_10026415 3300025932 Bacteria 3656
334 Ga0207706_10032376 3300025933 Bacteria 4657
335 Ga0207686_10102132 3300025934 Bacteria 1917
336 Ga0207704_10028145 3300025938 Bacteria 3113
337 Ga0207704_10100930 3300025938 Bacteria 1923
338 Ga0207691_10011255 3300025940 Bacteria 8584
339 Ga0207691_10018606 3300025940 Bacteria 6584
340 Ga0207689_10248412 3300025942 Bacteria 1471
341 Ga0207661_10027090 3300025944 Bacteria 4375
342 Ga0207667_10000082 3300025949 Bacteria 157749
343 Ga0207667_10000313 3300025949 Bacteria 67227
344 Ga0207667_10024859 3300025949 Bacteria 6567
345 Ga0207667_10100836 3300025949 Bacteria 2978
346 Ga0207667_10144148 3300025949 Bacteria 2452
347 Ga0207667_10155716 3300025949 Bacteria 2351
348 Ga0207640_10000018 3300025981 Bacteria 193664
349 Ga0207640_10000667 3300025981 Bacteria 20069
350 Ga0207640_10005150 3300025981 Bacteria 7109
351 Ga0207677_10065742 3300026023 Bacteria 2532
352 Ga0207703_10256454 3300026035 Bacteria 1579
353 Ga0207639_10021956 3300026041 Bacteria 4591
354 Ga0207639_10104045 3300026041 Bacteria 2301
355 Ga0207678_10007181 3300026067 Bacteria 9878
356 Ga0207678_10009903 3300026067 Bacteria 8367
357 Ga0207678_10034998 3300026067 Bacteria 4373
358 Ga0207678_10081039 3300026067 Bacteria 2778
359 Ga0207678_10142459 3300026067 Bacteria 2046
360 Ga0207702_10001333 3300026078 Bacteria 24688
361 Ga0207702_10003312 3300026078 Bacteria 14814
362 Ga0207702_10016366 3300026078 Bacteria 6139
363 Ga0207702_10382682 3300026078 Unclassified 1353
364 Ga0207674_10000397 3300026116 Bacteria 56299
365 Ga0207674_10018647 3300026116 Bacteria 7537
366 Ga0207674_10106366 3300026116 Bacteria 2783
367 Ga0207674_10479906 3300026116 Bacteria 1202
368 Ga0207683_10020713 3300026121 Bacteria 5627
369 Ga0207698_10010567 3300026142 Bacteria 5942
370 Ga0207698_10032143 3300026142 Bacteria 3798
371 Ga0207698_10041381 3300026142 Bacteria 3433
372 Ga0268266_10000001 3300028379 Bacteria 4040580
373 Ga0268266_10000021 3300028379 Bacteria 522453
374 Ga0268266_10225136 3300028379 Bacteria 1725
375 Ga0268265_10258800 3300028380 Bacteria 1546
376 Ga0268264_10036217 3300028381 Bacteria 4064
377 Ga0268264_10293780 3300028381 Bacteria 1527
378 Ga0268264_10404317 3300028381 Bacteria 1313
379 Ga0307412_10006301 3300031911 Bacteria 6701
380 Ga0307416_100112235 3300032002 Bacteria 2405
381 Ga0307507_10032565 3300033179 Bacteria 5438
382 Ga0307510_10010860 3300033180 Bacteria 10821
383 Ga0373933_0298913 3300035724 Bacteria 1042
384 Ga0395899_0000369 3300037312 Bacteria 54244
385 Ga0395899_0029464 3300037312 Bacteria 4128
386 Ga0395899_0041579 3300037312 Bacteria 3435
387 Ga0395899_0079942 3300037312 Bacteria 2380
388 Ga0395899_0112985 3300037312 Bacteria 1951
389 Ga0395900_0000664 3300037418 Bacteria 45818
390 Ga0395900_0147321 3300037418 Bacteria 2407
391 Ga0395898_0000305 3300037466 Bacteria 116565
392 Ga0395898_0000526 3300037466 Bacteria 73315
393 Ga0395898_0001738 3300037466 Bacteria 28763
394 Ga0395898_0108130 3300037466 Bacteria 2667
395 Ga0395898_0164142 3300037466 Bacteria 2124
396 Ga0395905_0058412 3300037471 Bacteria 3607
397 Ga0395901_0000161 3300038443 Bacteria 87191
398 Ga0395901_0028709 3300038443 Bacteria 5723
399 Ga0395901_0034197 3300038443 Bacteria 5248
400 Ga0395901_0036193 3300038443 Bacteria 5100
401 Ga0439436_0000090 3300041404 Bacteria 21493
402 Ga0439465_0018350 3300041413 Bacteria 2186
403 Ga0450908_004889 3300042184 Bacteria 2573
404 Ga0466969_0129963 3300044656 Bacteria 1168
405 Ga0466975_0059357 3300044661 Bacteria 2731
406 Ga0466982_0000004 3300044672 Bacteria 386724
407 Ga0466966_0007499 3300044684 Bacteria 7225
408 Ga0466966_0053095 3300044684 Bacteria 2571
409 Ga0466966_0063799 3300044684 Bacteria 2320
410 Ga0466961_0001025 3300044693 Bacteria 17250
411 Ga0466961_0006712 3300044693 Bacteria 7323
412 Ga0466961_0010644 3300044693 Bacteria 5871
413 Ga0466964_0078537 3300044706 Bacteria 1411
414 Ga0466971_0002157 3300044719 Bacteria 8320
415 Ga0466971_0032641 3300044719 Bacteria 2332
416 Ga0466968_0000200 3300044735 Bacteria 18463
417 Ga0466970_0000887 3300044765 Bacteria 14425
418 Ga0466970_0006845 3300044765 Bacteria 5706
419 Ga0466970_0105283 3300044765 Bacteria 1538
420 Ga0466957_0003699 3300044842 Bacteria 8447
421 Ga0466957_0005589 3300044842 Bacteria 7065
422 Ga0466957_0044422 3300044842 Bacteria 2692
423 Ga0466959_0030694 3300045049 Bacteria 3979
424 Ga0466959_0034140 3300045049 Bacteria 3764
425 Ga0466958_0003546 3300045836 Bacteria 8116
426 Ga0466958_0006027 3300045836 Bacteria 6571
427 Ga0466958_0032051 3300045836 Bacteria 3125
428 Ga0466967_0023786 3300045976 Bacteria 5026
429 Ga0495617_000073 3300046452 Bacteria 80606
430 Ga0495617_000546 3300046452 Bacteria 19492
431 Ga0495638_0000192 3300046460 Bacteria 90034
432 Ga0495638_0000194 3300046460 Bacteria 88601
433 Ga0495638_0000213 3300046460 Bacteria 81547
434 Ga0495638_0157256 3300046460 Bacteria 1314
435 Ga0495650_0000202 3300046471 Bacteria 129910
436 Ga0495650_0001063 3300046471 Bacteria 30453
437 Ga0495650_0026291 3300046471 Bacteria 2710
438 Ga0495584_0016916 3300046491 Bacteria 3716
439 Ga0495585_0000301 3300046492 Bacteria 49423
440 Ga0495585_0004457 3300046492 Bacteria 9079
441 Ga0495607_0000059 3300046501 Bacteria 109443
442 Ga0495607_0000289 3300046501 Bacteria 53401
443 Ga0495607_0009732 3300046501 Bacteria 6489
444 Ga0495583_0038625 3300046506 Bacteria 2255
445 Ga0495606_0001151 3300046507 Bacteria 37509
446 Ga0495606_0001702 3300046507 Bacteria 28412
447 Ga0495606_0138139 3300046507 Bacteria 1441
448 Ga0495610_0004346 3300046512 Bacteria 10523
449 Ga0495616_0000067 3300046513 Bacteria 89610
450 Ga0495616_0015119 3300046513 Bacteria 4295
451 Ga0495620_0000390 3300046515 Bacteria 29651
452 Ga0495620_0002319 3300046515 Bacteria 11028
453 Ga0495631_0000057 3300046518 Bacteria 69190
454 Ga0495631_0001891 3300046518 Bacteria 12340
455 Ga0495632_0000167 3300046519 Bacteria 68027
456 Ga0495632_0063766 3300046519 Bacteria 1783
457 Ga0495637_0020056 3300046520 Bacteria 3079
458 Ga0495648_0003151 3300046524 Bacteria 14672
459 Ga0495648_0053699 3300046524 Bacteria 2439
460 Ga0495587_0260496 3300046536 Bacteria 974
461 Ga0495609_0002408 3300046538 Bacteria 11511
462 Ga0495645_0101977 3300046543 Bacteria 2040
463 Ga0495622_0011897 3300046557 Bacteria 4024
464 Ga0495668_0018581 3300046616 Bacteria 4017
465 Ga0495611_0000001 3300046648 Bacteria 2628469
466 Ga0495611_0001386 3300046648 Bacteria 12129
467 Ga0495625_0000001 3300046660 Bacteria 1641829
468 Ga0495625_0051259 3300046660 Bacteria 2959
469 Ga0495625_0078377 3300046660 Bacteria 2306
470 Ga0495625_0153044 3300046660 Bacteria 1549
471 Ga0495661_0001187 3300046665 Bacteria 22607
472 Ga0495670_0001834 3300046691 Bacteria 10438
473 Ga0495670_0002399 3300046691 Bacteria 9240
474 Ga0495670_0007765 3300046691 Bacteria 5273
475 Ga0495671_0000075 3300046692 Bacteria 96084
476 Ga0495649_0003681 3300046694 Bacteria 10201
477 Ga0495589_0000106 3300046794 Bacteria 80663
478 Ga0495660_0000205 3300046810 Bacteria 61950
479 Ga0495660_0006700 3300046810 Bacteria 6805
480 Ga0495683_0001866 3300047323 Bacteria 13218
481 Ga0495679_000029 3300047446 Bacteria 190883
482 Ga0495673_0000001 3300047469 Bacteria 1630730
483 Ga0495673_0000018 3300047469 Bacteria 569190
484 Ga0495673_0000578 3300047469 Bacteria 36844
485 Ga0495686_0000043 3300047472 Bacteria 291565
486 Ga0495686_0000555 3300047472 Bacteria 53502
487 Ga0495686_0036214 3300047472 Bacteria 3167
488 Ga0495686_0062242 3300047472 Bacteria 2315
489 Ga0496100_0002003 3300048903 Bacteria 10193
490 Ga0496101_0000993 3300048904 Bacteria 16782
491 Ga0496101_0024146 3300048904 Bacteria 4205
492 Ga0496102_0189970 3300048905 Bacteria 1935
493 Ga0496104_0000058 3300048907 Bacteria 118768
494 Ga0496104_0375922 3300048907 Bacteria 1333
495 Ga0496105_0000048 3300048908 Bacteria 96832
496 Ga0496106_0000525 3300048909 Bacteria 27197
497 Ga0496107_0154422 3300048910 Bacteria 1699
498 Ga0496115_0000337 3300048918 Bacteria 39950
499 Ga0496115_0000646 3300048918 Bacteria 26178
500 Ga0496115_0000901 3300048918 Bacteria 21555
501 Ga0496115_0032004 3300048918 Bacteria 4148
502 Ga0496115_0077515 3300048918 Bacteria 2702
503 Ga0496116_0018536 3300048919 Bacteria 5361
504 Ga0496116_0089366 3300048919 Bacteria 1879
505 Ga0496117_0011302 3300048920 Bacteria 8007
506 Ga0496117_0026054 3300048920 Bacteria 4583
507 Ga0496117_0036786 3300048920 Bacteria 3657
508 Ga0496118_0003315 3300048921 Bacteria 20416
509 Ga0496118_0004706 3300048921 Bacteria 15987
510 Ga0496118_0005494 3300048921 Bacteria 14387
511 Ga0496118_0020772 3300048921 Bacteria 5811
512 Ga0496118_0056492 3300048921 Bacteria 2950
513 Ga0496119_0000058 3300048922 Bacteria 173131
514 Ga0496119_0051731 3300048922 Bacteria 2522
515 Ga0496120_0000184 3300048923 Bacteria 106643
516 Ga0496120_0000335 3300048923 Bacteria 78595
517 Ga0496121_0000369 3300048924 Bacteria 92541
518 Ga0496121_0000524 3300048924 Bacteria 73122
519 Ga0496121_0001486 3300048924 Bacteria 39523
520 Ga0496121_0001598 3300048924 Bacteria 37640
521 Ga0496121_0022896 3300048924 Bacteria 6038
522 Ga0496121_0042463 3300048924 Bacteria 3955
523 Ga0496121_0051776 3300048924 Bacteria 3455
524 Ga0496121_0065266 3300048924 Bacteria 2963
525 Ga0496122_0008336 3300048925 Bacteria 11212
526 Ga0496122_0118341 3300048925 Bacteria 1717
527 Ga0496123_0011068 3300048926 Bacteria 7874
528 Ga0496123_0028020 3300048926 Bacteria 4180
529 Ga0496124_0000565 3300048927 Bacteria 62666
530 Ga0496124_0000571 3300048927 Bacteria 62412
531 Ga0496124_0044551 3300048927 Bacteria 3806
532 Ga0496124_0302605 3300048927 Bacteria 1154
533 Ga0496125_0000499 3300048928 Bacteria 68475
534 Ga0496125_0026897 3300048928 Bacteria 5225
535 Ga0496126_0000835 3300048929 Bacteria 54796
536 Ga0496126_0005474 3300048929 Bacteria 14475
537 Ga0496126_0013973 3300048929 Bacteria 8142
538 Ga0496126_0022907 3300048929 Bacteria 6064
539 Ga0496126_0027279 3300048929 Bacteria 5457
540 Ga0496126_0041957 3300048929 Bacteria 4230
541 Ga0496126_0097336 3300048929 Bacteria 2579
542 Ga0495678_000090 3300049459 Bacteria 114550
543 Ga0495678_048735 3300049459 Bacteria 1650
544 Ga0495682_0001218 3300049460 Bacteria 14595
545 Ga0495682_0011070 3300049460 Bacteria 3475
546 Ga0501032_0149368 3300049569 Bacteria 1537
547 Ga0501033_0002347 3300049570 Bacteria 16140
548 Ga0501033_0177821 3300049570 Bacteria 1526
549 Ga0501034_0083486 3300049571 Bacteria 3196
550 Ga0501034_0148619 3300049571 Bacteria 2319
551 Ga0501034_0544896 3300049571 Bacteria 1070
552 Ga0501036_0030713 3300049572 Bacteria 4538
553 Ga0501036_0194116 3300049572 Bacteria 1708
554 Ga0501037_0002084 3300049573 Bacteria 14498
555 Ga0501037_0049355 3300049573 Bacteria 3082
556 Ga0501037_0198500 3300049573 Bacteria 1418
557 Ga0501038_0039334 3300049574 Bacteria 4136
558 Ga0501038_0291518 3300049574 Bacteria 1282
559 Ga0501039_0292942 3300049575 Bacteria 1279
560 Ga0501042_0402176 3300049578 Bacteria 992
561 Ga0501043_0019339 3300049579 Bacteria 5346
562 Ga0501043_0019703 3300049579 Bacteria 5298
563 Ga0501043_0035423 3300049579 Bacteria 3926
564 Ga0501043_0086737 3300049579 Bacteria 2459
565 Ga0501046_0370163 3300049580 Bacteria 1038
566 Ga0501047_0041357 3300049581 Bacteria 4454
567 Ga0501047_0051873 3300049581 Bacteria 3964
568 Ga0501047_0068997 3300049581 Bacteria 3405
569 Ga0501047_0212936 3300049581 Bacteria 1790
570 Ga0501048_0023757 3300049582 Bacteria 4476
571 Ga0501048_0190465 3300049582 Bacteria 1453
572 Ga0501069_0000202 3300049585 Bacteria 26292
573 Ga0501069_0188735 3300049585 Bacteria 1192
574 Ga0501070_0056393 3300049586 Bacteria 3256
575 Ga0501070_0605306 3300049586 Bacteria 873
576 Ga0501071_0421742 3300049587 Bacteria 1020
577 Ga0501074_0010387 3300049590 Bacteria 6754
578 Ga0501074_0011180 3300049590 Bacteria 6520
579 Ga0501080_0002764 3300049742 Bacteria 15413
580 Ga0501080_0114410 3300049742 Bacteria 2501
581 Ga0501035_0005183 3300049822 Bacteria 12327
582 Ga0501035_0008492 3300049822 Bacteria 9565
583 Ga0501035_0013740 3300049822 Bacteria 7472
584 Ga0501035_0015101 3300049822 Bacteria 7126
585 Ga0501035_0061903 3300049822 Bacteria 3330
586 Ga0501035_0334727 3300049822 Bacteria 1269
587 Ga0501035_0415994 3300049822 Bacteria 1116
588 Ga0501044_0014630 3300049823 Bacteria 8460
589 Ga0501044_0024692 3300049823 Bacteria 6376
590 Ga0501044_0072988 3300049823 Bacteria 3488
591 Ga0501044_0099285 3300049823 Bacteria 2930
592 Ga0501044_0272053 3300049823 Bacteria 1629
593 nmdc:mga0sz30_40246_c1 3300050516 Bacteria 1964
594 Ga0500643_000002 3300053087 Bacteria 1277657
595 Ga0500555_000664 3300053103 Bacteria 13115
596 Ga0500652_071025 3300053131 Bacteria 1443
597 Ga0500645_001579 3300053730 Bacteria 11336
598 Ga0501084_0016329 3300054114 Bacteria 6166
599 Ga0501082_0000268 3300060353 Bacteria 45918
600 Ga0466962_0003174 3300061719 Bacteria 7811
601 Ga0466962_0037120 3300061719 Bacteria 2332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005547 Ga0070693_100087809 Ga0070693_1000878092 236
2 3300049586 Ga0501070_0605306 Ga0501070_0605306_46_858 270
3 3300005458 Ga0070681_10020540 Ga0070681_100205402 273
4 3300005539 Ga0068853_100035461 Ga0068853_1000354614 273
5 3300025912 Ga0207707_10053099 Ga0207707_100530993 273
6 3300026116 Ga0207674_10106366 Ga0207674_101063664 273
7 3300044765 Ga0466970_0000887 Ga0466970_0000887_2819_3670 280
8 iso_pu_bacteria 2818991440 2819565300 282
9 iso_pu_bacteria 2904463128 2904466970 282
10 3300013306 Ga0163162_10026006 Ga0163162_100260066 283
11 3300049569 Ga0501032_0149368 Ga0501032_0149368_605_1519 283
12 iso_pu_bacteria 2718218334 2721026950 283
13 iso_pu_bacteria 2738543009 2739226933 283
14 iso_pu_bacteria 2842914999 2842917476 283
15 iso_pu_bacteria 2842918807 2842919412 283
16 iso_pu_bacteria 2884338543 2884341097 283
17 iso_pu_bacteria 2919404418 2919405793 283
18 iso_pu_bacteria 2941471342 2941471822 283
19 iso_pu_bacteria 2953994433 2953998120 283
20 3300045836 Ga0466958_0003546 Ga0466958_0003546_15_890 285
21 iso_pu_bacteria 2643221562 2643831593 285
22 iso_pu_bacteria 2895395659 2895397013 285
23 3300001989 JGI24739J22299_10008023 JGI24739J22299_100080234 286
24 3300002067 JGI24735J21928_10012147 JGI24735J21928_100121473 286
25 3300025304 Ga0209257_1039423 Ga0209257_10394232 286
26 3300048918 Ga0496115_0000901 Ga0496115_0000901_11920_12789 286
27 iso_pu_bacteria 2884411467 2884413853 286
28 iso_pu_bacteria 2928963466 2928964700 286
29 3300003323 rootH1_10370125 rootH1_103701252 287
30 3300003578 Ga0006562J51391_1040232 Ga0006562J51391_10402323 287
31 3300005262 Ga0065165_1000096 Ga0065165_1000096123 287
32 3300005614 Ga0068856_100004957 Ga0068856_1000049573 287
33 3300006186 Ga0075369_10041684 Ga0075369_100416841 287
34 3300009101 Ga0105247_10046289 Ga0105247_100462893 287
35 3300013104 Ga0157370_10054162 Ga0157370_100541623 287
36 3300013105 Ga0157369_10001880 Ga0157369_1000188016 287
37 3300013307 Ga0157372_10239069 Ga0157372_102390693 287
38 3300013308 Ga0157375_10727856 Ga0157375_107278561 287
39 3300014497 Ga0182008_10009764 Ga0182008_100097645 287
40 3300014497 Ga0182008_10012102 Ga0182008_100121022 287
41 3300015261 Ga0182006_1000293 Ga0182006_10002937 287
42 3300015261 Ga0182006_1000492 Ga0182006_100049214 287
43 3300015262 Ga0182007_10010487 Ga0182007_100104873 287
44 3300015265 Ga0182005_1000079 Ga0182005_100007926 287
45 3300015265 Ga0182005_1001099 Ga0182005_10010998 287
46 3300015265 Ga0182005_1014243 Ga0182005_10142432 287
47 3300025258 Ga0209129_1007014 Ga0209129_10070142 287
48 3300025297 Ga0209758_1008138 Ga0209758_10081385 287
49 3300025299 Ga0209256_1005639 Ga0209256_10056398 287
50 3300025302 Ga0207426_1010114 Ga0207426_10101144 287
51 3300025303 Ga0209051_1022640 Ga0209051_10226403 287
52 3300025904 Ga0207647_10000190 Ga0207647_1000019028 287
53 3300025920 Ga0207649_10131316 Ga0207649_101313162 287
54 3300026078 Ga0207702_10016366 Ga0207702_100163662 287
55 3300031911 Ga0307412_10006301 Ga0307412_100063016 287
56 3300041404 Ga0439436_0000090 Ga0439436_0000090_14510_15385 287
57 3300041413 Ga0439465_0018350 Ga0439465_0018350_1220_2095 287
58 3300042184 Ga0450908_004889 Ga0450908_004889_1636_2511 287
59 3300044735 Ga0466968_0000200 Ga0466968_0000200_7039_7914 287
60 3300046452 Ga0495617_000073 Ga0495617_000073_71020_71895 287
61 3300046452 Ga0495617_000546 Ga0495617_000546_2805_3680 287
62 3300046460 Ga0495638_0000192 Ga0495638_0000192_34064_34939 287
63 3300046460 Ga0495638_0157256 Ga0495638_0157256_36_911 287
64 3300046471 Ga0495650_0026291 Ga0495650_0026291_563_1438 287
65 3300046491 Ga0495584_0016916 Ga0495584_0016916_2423_3298 287
66 3300046492 Ga0495585_0000301 Ga0495585_0000301_956_1831 287
67 3300046492 Ga0495585_0004457 Ga0495585_0004457_7283_8158 287
68 3300046501 Ga0495607_0000059 Ga0495607_0000059_51842_52717 287
69 3300046501 Ga0495607_0009732 Ga0495607_0009732_4091_4966 287
70 3300046506 Ga0495583_0038625 Ga0495583_0038625_203_1078 287
71 3300046507 Ga0495606_0001702 Ga0495606_0001702_23319_24194 287
72 3300046507 Ga0495606_0138139 Ga0495606_0138139_532_1407 287
73 3300046512 Ga0495610_0004346 Ga0495610_0004346_5814_6689 287
74 3300046513 Ga0495616_0000067 Ga0495616_0000067_950_1825 287
75 3300046513 Ga0495616_0015119 Ga0495616_0015119_1941_2816 287
76 3300046515 Ga0495620_0000390 Ga0495620_0000390_28530_29405 287
77 3300046515 Ga0495620_0002319 Ga0495620_0002319_81_956 287
78 3300046518 Ga0495631_0000057 Ga0495631_0000057_59786_60661 287
79 3300046518 Ga0495631_0001891 Ga0495631_0001891_10984_11859 287
80 3300046519 Ga0495632_0000167 Ga0495632_0000167_62181_63056 287
81 3300046519 Ga0495632_0063766 Ga0495632_0063766_280_1155 287
82 3300046520 Ga0495637_0020056 Ga0495637_0020056_1160_2035 287
83 3300046524 Ga0495648_0003151 Ga0495648_0003151_5218_6093 287
84 3300046524 Ga0495648_0053699 Ga0495648_0053699_531_1406 287
85 3300046538 Ga0495609_0002408 Ga0495609_0002408_2268_3143 287
86 3300046616 Ga0495668_0018581 Ga0495668_0018581_1267_2142 287
87 3300046648 Ga0495611_0000001 Ga0495611_0000001_1679448_1680323 287
88 3300046648 Ga0495611_0001386 Ga0495611_0001386_547_1422 287
89 3300046660 Ga0495625_0000001 Ga0495625_0000001_235747_236622 287
90 3300046660 Ga0495625_0153044 Ga0495625_0153044_357_1232 287
91 3300046665 Ga0495661_0001187 Ga0495661_0001187_8583_9458 287
92 3300046691 Ga0495670_0001834 Ga0495670_0001834_1827_2702 287
93 3300046691 Ga0495670_0002399 Ga0495670_0002399_3406_4281 287
94 3300046691 Ga0495670_0007765 Ga0495670_0007765_3769_4644 287
95 3300046692 Ga0495671_0000075 Ga0495671_0000075_19669_20544 287
96 3300046794 Ga0495589_0000106 Ga0495589_0000106_54840_55715 287
97 3300046810 Ga0495660_0000205 Ga0495660_0000205_60163_61038 287
98 3300046810 Ga0495660_0006700 Ga0495660_0006700_5017_5892 287
99 3300047323 Ga0495683_0001866 Ga0495683_0001866_6370_7245 287
100 3300047446 Ga0495679_000029 Ga0495679_000029_96645_97520 287
101 3300047469 Ga0495673_0000001 Ga0495673_0000001_183982_184857 287
102 3300047469 Ga0495673_0000018 Ga0495673_0000018_370290_371165 287
103 3300047469 Ga0495673_0000578 Ga0495673_0000578_24307_25182 287
104 3300047472 Ga0495686_0000043 Ga0495686_0000043_216348_217223 287
105 3300047472 Ga0495686_0000555 Ga0495686_0000555_5172_6047 287
106 3300047472 Ga0495686_0036214 Ga0495686_0036214_389_1264 287
107 3300047472 Ga0495686_0062242 Ga0495686_0062242_819_1694 287
108 3300048903 Ga0496100_0002003 Ga0496100_0002003_2973_3848 287
109 3300048904 Ga0496101_0000993 Ga0496101_0000993_359_1234 287
110 3300048905 Ga0496102_0189970 Ga0496102_0189970_316_1191 287
111 3300048909 Ga0496106_0000525 Ga0496106_0000525_2628_3503 287
112 3300048919 Ga0496116_0089366 Ga0496116_0089366_320_1195 287
113 3300048920 Ga0496117_0011302 Ga0496117_0011302_6713_7588 287
114 3300048921 Ga0496118_0003315 Ga0496118_0003315_8498_9373 287
115 3300048921 Ga0496118_0004706 Ga0496118_0004706_9657_10532 287
116 3300048924 Ga0496121_0000524 Ga0496121_0000524_50828_51703 287
117 3300048924 Ga0496121_0001486 Ga0496121_0001486_12445_13320 287
118 3300048924 Ga0496121_0001598 Ga0496121_0001598_5039_5914 287
119 3300048925 Ga0496122_0008336 Ga0496122_0008336_6880_7755 287
120 3300048925 Ga0496122_0118341 Ga0496122_0118341_517_1392 287
121 3300048926 Ga0496123_0011068 Ga0496123_0011068_3207_4082 287
122 3300048926 Ga0496123_0028020 Ga0496123_0028020_18_893 287
123 3300048927 Ga0496124_0000565 Ga0496124_0000565_3882_4757 287
124 3300048927 Ga0496124_0000571 Ga0496124_0000571_57712_58587 287
125 3300048927 Ga0496124_0302605 Ga0496124_0302605_103_978 287
126 3300048928 Ga0496125_0026897 Ga0496125_0026897_4152_5027 287
127 3300048929 Ga0496126_0097336 Ga0496126_0097336_977_1852 287
128 3300049459 Ga0495678_000090 Ga0495678_000090_37185_38060 287
129 3300049460 Ga0495682_0001218 Ga0495682_0001218_5163_6038 287
130 3300049460 Ga0495682_0011070 Ga0495682_0011070_1035_1910 287
131 3300049574 Ga0501038_0291518 Ga0501038_0291518_388_1260 287
132 3300050516 nmdc:mga0sz30_40246_c1 nmdc:mga0sz30_40246_c1_39_914 287
133 3300053087 Ga0500643_000002 Ga0500643_000002_141863_142738 287
134 3300053103 Ga0500555_000664 Ga0500555_000664_9962_10837 287
135 3300053131 Ga0500652_071025 Ga0500652_071025_223_1098 287
136 3300053730 Ga0500645_001579 Ga0500645_001579_1883_2758 287
137 iso_pu_bacteria 2593339239 2595452050 287
138 iso_pu_bacteria 2643221577 2643893950 287
139 iso_pu_bacteria 2643221685 2644476169 287
140 iso_pu_bacteria 2687453130 2687583438 287
141 iso_pu_bacteria 2919085039 2919085040 287
142 3300005335 Ga0070666_10000003 Ga0070666_10000003357 288
143 3300005335 Ga0070666_10137130 Ga0070666_101371302 288
144 3300005344 Ga0070661_100007344 Ga0070661_1000073444 288
145 3300005347 Ga0070668_100059506 Ga0070668_1000595062 288
146 3300005435 Ga0070714_100000148 Ga0070714_10000014842 288
147 3300005539 Ga0068853_100470962 Ga0068853_1004709622 288
148 3300005548 Ga0070665_100000108 Ga0070665_10000010873 288
149 3300005548 Ga0070665_100557228 Ga0070665_1005572281 288
150 3300005578 Ga0068854_100209424 Ga0068854_1002094242 288
151 3300005616 Ga0068852_100016098 Ga0068852_1000160985 288
152 3300005843 Ga0068860_100269856 Ga0068860_1002698563 288
153 3300006237 Ga0097621_100030079 Ga0097621_1000300792 288
154 3300009098 Ga0105245_10117984 Ga0105245_101179842 288
155 3300009551 Ga0105238_10000802 Ga0105238_100008027 288
156 3300013297 Ga0157378_10000031 Ga0157378_1000003135 288
157 3300013306 Ga0163162_10019923 Ga0163162_100199233 288
158 3300014497 Ga0182008_10078947 Ga0182008_100789472 288
159 3300015262 Ga0182007_10024285 Ga0182007_100242852 288
160 3300025225 Ga0209566_101753 Ga0209566_1017533 288
161 3300025226 Ga0209674_102042 Ga0209674_1020425 288
162 3300025233 Ga0209437_102085 Ga0209437_1020854 288
163 3300025233 Ga0209437_102538 Ga0209437_1025383 288
164 3300025254 Ga0209148_1002183 Ga0209148_10021834 288
165 3300025256 Ga0209759_1011976 Ga0209759_10119762 288
166 3300025261 Ga0209233_1013801 Ga0209233_10138012 288
167 3300025903 Ga0207680_10000006 Ga0207680_10000006504 288
168 3300025903 Ga0207680_10184660 Ga0207680_101846602 288
169 3300025909 Ga0207705_10018956 Ga0207705_100189562 288
170 3300025920 Ga0207649_10014053 Ga0207649_100140534 288
171 3300025924 Ga0207694_10002078 Ga0207694_100020789 288
172 3300025929 Ga0207664_10000472 Ga0207664_1000047219 288
173 3300026142 Ga0207698_10010567 Ga0207698_100105672 288
174 3300028379 Ga0268266_10000001 Ga0268266_100000011962 288
175 3300028379 Ga0268266_10000021 Ga0268266_10000021313 288
176 3300028379 Ga0268266_10225136 Ga0268266_102251362 288
177 3300028380 Ga0268265_10258800 Ga0268265_102588002 288
178 3300028381 Ga0268264_10404317 Ga0268264_104043172 288
179 3300033179 Ga0307507_10032565 Ga0307507_100325653 288
180 3300033180 Ga0307510_10010860 Ga0307510_1001086013 288
181 3300044842 Ga0466957_0005589 Ga0466957_0005589_6010_6894 288
182 3300046471 Ga0495650_0001063 Ga0495650_0001063_766_1647 288
183 3300046501 Ga0495607_0000289 Ga0495607_0000289_20899_21780 288
184 3300046660 Ga0495625_0051259 Ga0495625_0051259_1000_1881 288
185 3300048924 Ga0496121_0051776 Ga0496121_0051776_1353_2234 288
186 3300048927 Ga0496124_0044551 Ga0496124_0044551_1636_2517 288
187 3300048929 Ga0496126_0013973 Ga0496126_0013973_3464_4345 288
188 3300049571 Ga0501034_0544896 Ga0501034_0544896_82_960 288
189 3300049581 Ga0501047_0212936 Ga0501047_0212936_355_1233 288
190 3300049742 Ga0501080_0114410 Ga0501080_0114410_1419_2297 288
191 3300049823 Ga0501044_0272053 Ga0501044_0272053_424_1302 288
192 3300054114 Ga0501084_0016329 Ga0501084_0016329_2956_3834 288
193 3300060353 Ga0501082_0000268 Ga0501082_0000268_12905_13783 288
194 iso_pu_bacteria 2537561836 2538833123 288
195 iso_pu_bacteria 2593339238 2595446010 288
196 iso_pu_bacteria 2939611941 2939614192 288
197 3300002737 JGI25162J39368_1000786 JGI25162J39368_100078610 289
198 3300002737 JGI25162J39368_1001541 JGI25162J39368_10015419 289
199 3300002741 JGI25157J39369_1001675 JGI25157J39369_10016757 289
200 3300002772 JGI25164J39214_1000704 JGI25164J39214_100070412 289
201 3300003214 JGI25165J46597_1001211 JGI25165J46597_10012114 289
202 3300005336 Ga0070680_100056142 Ga0070680_1000561422 289
203 3300005337 Ga0070682_100043403 Ga0070682_1000434032 289
204 3300005339 Ga0070660_100291430 Ga0070660_1002914302 289
205 3300005344 Ga0070661_100041693 Ga0070661_1000416933 289
206 3300005345 Ga0070692_10024287 Ga0070692_100242872 289
207 3300005366 Ga0070659_100003331 Ga0070659_10000333112 289
208 3300005366 Ga0070659_100132350 Ga0070659_1001323501 289
209 3300005367 Ga0070667_100010708 Ga0070667_1000107086 289
210 3300005435 Ga0070714_100000088 Ga0070714_10000008868 289
211 3300005435 Ga0070714_100047584 Ga0070714_1000475841 289
212 3300005436 Ga0070713_100330964 Ga0070713_1003309641 289
213 3300005455 Ga0070663_100091318 Ga0070663_1000913182 289
214 3300005457 Ga0070662_100019019 Ga0070662_1000190195 289
215 3300005458 Ga0070681_10016767 Ga0070681_100167672 289
216 3300005458 Ga0070681_10022604 Ga0070681_100226043 289
217 3300005530 Ga0070679_100089416 Ga0070679_1000894163 289
218 3300005539 Ga0068853_100260775 Ga0068853_1002607752 289
219 3300005546 Ga0070696_100051264 Ga0070696_1000512642 289
220 3300009545 Ga0105237_10553705 Ga0105237_105537051 289
221 3300013100 Ga0157373_10080848 Ga0157373_100808482 289
222 3300013102 Ga0157371_10033207 Ga0157371_100332075 289
223 3300013104 Ga0157370_10000371 Ga0157370_1000037139 289
224 3300013307 Ga0157372_10526073 Ga0157372_105260731 289
225 3300014497 Ga0182008_10136813 Ga0182008_101368131 289
226 3300015261 Ga0182006_1018790 Ga0182006_10187903 289
227 3300015262 Ga0182007_10009655 Ga0182007_100096552 289
228 3300015262 Ga0182007_10015241 Ga0182007_100152413 289
229 3300015262 Ga0182007_10036532 Ga0182007_100365322 289
230 3300025231 Ga0207427_100069 Ga0207427_100069106 289
231 3300025231 Ga0207427_100216 Ga0207427_10021616 289
232 3300025233 Ga0209437_100139 Ga0209437_10013939 289
233 3300025233 Ga0209437_100154 Ga0209437_100154122 289
234 3300025250 Ga0209026_1000145 Ga0209026_100014525 289
235 3300025261 Ga0209233_1000083 Ga0209233_1000083106 289
236 3300025261 Ga0209233_1000092 Ga0209233_1000092167 289
237 3300025261 Ga0209233_1000191 Ga0209233_1000191107 289
238 3300025904 Ga0207647_10009552 Ga0207647_100095522 289
239 3300025909 Ga0207705_10023487 Ga0207705_100234875 289
240 3300025912 Ga0207707_10057192 Ga0207707_100571922 289
241 3300025919 Ga0207657_10068020 Ga0207657_100680204 289
242 3300025921 Ga0207652_10162720 Ga0207652_101627203 289
243 3300025929 Ga0207664_10000066 Ga0207664_1000006631 289
244 3300025932 Ga0207690_10000579 Ga0207690_100005792 289
245 3300025932 Ga0207690_10001265 Ga0207690_1000126515 289
246 3300025932 Ga0207690_10026415 Ga0207690_100264152 289
247 3300025933 Ga0207706_10032376 Ga0207706_100323763 289
248 3300025949 Ga0207667_10100836 Ga0207667_101008364 289
249 3300026041 Ga0207639_10021956 Ga0207639_100219566 289
250 3300032002 Ga0307416_100112235 Ga0307416_1001122351 289
251 3300037312 Ga0395899_0041579 Ga0395899_0041579_2407_3285 289
252 3300037312 Ga0395899_0079942 Ga0395899_0079942_1255_2130 289
253 3300037418 Ga0395900_0147321 Ga0395900_0147321_826_1704 289
254 3300037466 Ga0395898_0108130 Ga0395898_0108130_74_952 289
255 3300038443 Ga0395901_0028709 Ga0395901_0028709_1031_1909 289
256 3300038443 Ga0395901_0036193 Ga0395901_0036193_2367_3329 289
257 3300002737 JGI25162J39368_1000443 JGI25162J39368_100044324 290
258 3300002741 JGI25157J39369_1000441 JGI25157J39369_10004415 290
259 3300002771 JGI25163J39215_1000278 JGI25163J39215_10002785 290
260 3300002772 JGI25164J39214_1000375 JGI25164J39214_10003755 290
261 3300003320 rootH2_10000174 rootH2_100001748 290
262 3300003322 rootL2_10143337 rootL2_101433371 290
263 3300003756 Ga0055533_1001750 Ga0055533_10017502 290
264 3300003762 Ga0055542_1000136 Ga0055542_100013655 290
265 3300005334 Ga0068869_100005338 Ga0068869_1000053387 290
266 3300005338 Ga0068868_100021255 Ga0068868_1000212555 290
267 3300005344 Ga0070661_100331038 Ga0070661_1003310381 290
268 3300005347 Ga0070668_100093852 Ga0070668_1000938522 290
269 3300005353 Ga0070669_100154339 Ga0070669_1001543391 290
270 3300005456 Ga0070678_100087489 Ga0070678_1000874892 290
271 3300005535 Ga0070684_100113926 Ga0070684_1001139262 290
272 3300005539 Ga0068853_100001898 Ga0068853_10000189812 290
273 3300005543 Ga0070672_100032024 Ga0070672_1000320245 290
274 3300005547 Ga0070693_100182390 Ga0070693_1001823902 290
275 3300005548 Ga0070665_100080003 Ga0070665_1000800032 290
276 3300005614 Ga0068856_100116890 Ga0068856_1001168903 290
277 3300005617 Ga0068859_100498816 Ga0068859_1004988162 290
278 3300005840 Ga0068870_10013383 Ga0068870_100133833 290
279 3300005843 Ga0068860_100042860 Ga0068860_1000428603 290
280 3300006237 Ga0097621_100055814 Ga0097621_1000558142 290
281 3300006237 Ga0097621_100119645 Ga0097621_1001196452 290
282 3300006358 Ga0068871_100328157 Ga0068871_1003281572 290
283 3300006881 Ga0068865_100056682 Ga0068865_1000566822 290
284 3300006931 Ga0097620_100498793 Ga0097620_1004987932 290
285 3300009093 Ga0105240_10000254 Ga0105240_1000025498 290
286 3300009093 Ga0105240_10002163 Ga0105240_1000216319 290
287 3300009176 Ga0105242_10214624 Ga0105242_102146242 290
288 3300009551 Ga0105238_10231913 Ga0105238_102319132 290
289 3300010375 Ga0105239_10000020 Ga0105239_1000002017 290
290 3300010375 Ga0105239_10045299 Ga0105239_100452993 290
291 3300013104 Ga0157370_10138013 Ga0157370_101380131 290
292 3300013296 Ga0157374_10224417 Ga0157374_102244172 290
293 3300013297 Ga0157378_10561244 Ga0157378_105612442 290
294 3300013306 Ga0163162_10051792 Ga0163162_100517922 290
295 3300013306 Ga0163162_10244487 Ga0163162_102444872 290
296 3300013307 Ga0157372_10016545 Ga0157372_100165452 290
297 3300013308 Ga0157375_10021391 Ga0157375_100213915 290
298 3300014969 Ga0157376_10271662 Ga0157376_102716622 290
299 3300025226 Ga0209674_100012 Ga0209674_100012548 290
300 3300025231 Ga0207427_102880 Ga0207427_1028803 290
301 3300025233 Ga0209437_100463 Ga0209437_10046317 290
302 3300025242 Ga0209258_100992 Ga0209258_1009927 290
303 3300025242 Ga0209258_105591 Ga0209258_1055911 290
304 3300025250 Ga0209026_1005345 Ga0209026_10053454 290
305 3300025254 Ga0209148_1000002 Ga0209148_10000021404 290
306 3300025913 Ga0207695_10002857 Ga0207695_1000285719 290
307 3300025913 Ga0207695_10003147 Ga0207695_1000314719 290
308 3300025920 Ga0207649_10037636 Ga0207649_100376362 290
309 3300025934 Ga0207686_10102132 Ga0207686_101021322 290
310 3300025938 Ga0207704_10100930 Ga0207704_101009301 290
311 3300025940 Ga0207691_10011255 Ga0207691_100112555 290
312 3300025940 Ga0207691_10018606 Ga0207691_100186062 290
313 3300025942 Ga0207689_10248412 Ga0207689_102484122 290
314 3300026023 Ga0207677_10065742 Ga0207677_100657422 290
315 3300026041 Ga0207639_10104045 Ga0207639_101040452 290
316 3300026078 Ga0207702_10382682 Ga0207702_103826822 290
317 3300026121 Ga0207683_10020713 Ga0207683_100207135 290
318 3300044842 Ga0466957_0044422 Ga0466957_0044422_1107_1997 290
319 3300046460 Ga0495638_0000194 Ga0495638_0000194_72434_73312 290
320 3300046471 Ga0495650_0000202 Ga0495650_0000202_123247_124125 290
321 3300046660 Ga0495625_0078377 Ga0495625_0078377_573_1454 290
322 3300048904 Ga0496101_0024146 Ga0496101_0024146_164_1045 290
323 3300048907 Ga0496104_0375922 Ga0496104_0375922_23_904 290
324 3300048910 Ga0496107_0154422 Ga0496107_0154422_240_1121 290
325 3300048918 Ga0496115_0000337 Ga0496115_0000337_15178_16059 290
326 3300048918 Ga0496115_0000646 Ga0496115_0000646_295_1182 290
327 3300048918 Ga0496115_0032004 Ga0496115_0032004_1443_2324 290
328 3300048918 Ga0496115_0077515 Ga0496115_0077515_925_1803 290
329 3300048919 Ga0496116_0018536 Ga0496116_0018536_4114_4995 290
330 3300048920 Ga0496117_0026054 Ga0496117_0026054_3026_3907 290
331 3300048920 Ga0496117_0036786 Ga0496117_0036786_1820_2701 290
332 3300048921 Ga0496118_0005494 Ga0496118_0005494_4431_5312 290
333 3300048921 Ga0496118_0020772 Ga0496118_0020772_1819_2700 290
334 3300048921 Ga0496118_0056492 Ga0496118_0056492_1682_2566 290
335 3300048922 Ga0496119_0000058 Ga0496119_0000058_36604_37485 290
336 3300048922 Ga0496119_0051731 Ga0496119_0051731_641_1522 290
337 3300048923 Ga0496120_0000184 Ga0496120_0000184_69152_70033 290
338 3300048923 Ga0496120_0000335 Ga0496120_0000335_16544_17425 290
339 3300048924 Ga0496121_0000369 Ga0496121_0000369_75728_76609 290
340 3300048924 Ga0496121_0042463 Ga0496121_0042463_2122_3003 290
341 3300048924 Ga0496121_0065266 Ga0496121_0065266_425_1303 290
342 3300048929 Ga0496126_0000835 Ga0496126_0000835_53739_54626 290
343 3300048929 Ga0496126_0005474 Ga0496126_0005474_4508_5389 290
344 3300048929 Ga0496126_0041957 Ga0496126_0041957_1649_2530 290
345 3300049581 Ga0501047_0068997 Ga0501047_0068997_611_1483 290
346 3300049585 Ga0501069_0188735 Ga0501069_0188735_102_974 290
347 3300049586 Ga0501070_0056393 Ga0501070_0056393_1702_2574 290
348 3300049587 Ga0501071_0421742 Ga0501071_0421742_49_921 290
349 3300049590 Ga0501074_0010387 Ga0501074_0010387_2593_3465 290
350 3300049742 Ga0501080_0002764 Ga0501080_0002764_8959_9831 290
351 3300049822 Ga0501035_0008492 Ga0501035_0008492_4032_4904 290
352 3300049823 Ga0501044_0099285 Ga0501044_0099285_248_1120 290
353 3300001990 JGI24737J22298_10023518 JGI24737J22298_100235181 291
354 3300002705 JGI25156J39149_1000214 JGI25156J39149_100021414 291
355 3300002705 JGI25156J39149_1004656 JGI25156J39149_10046564 291
356 3300002737 JGI25162J39368_1000138 JGI25162J39368_100013839 291
357 3300002737 JGI25162J39368_1001136 JGI25162J39368_10011369 291
358 3300002741 JGI25157J39369_1000172 JGI25157J39369_100017256 291
359 3300002741 JGI25157J39369_1002337 JGI25157J39369_10023374 291
360 3300002772 JGI25164J39214_1000170 JGI25164J39214_100017019 291
361 3300002772 JGI25164J39214_1000310 JGI25164J39214_100031014 291
362 3300003214 JGI25165J46597_1000224 JGI25165J46597_100022445 291
363 3300003214 JGI25165J46597_1000580 JGI25165J46597_100058014 291
364 3300003215 JGI25153J46596_10010874 JGI25153J46596_100108743 291
365 3300003316 rootH1_10004229 rootH1_100042292 291
366 3300003316 rootH1_10026498 rootH1_100264985 291
367 3300003751 Ga0055538_1001394 Ga0055538_10013944 291
368 3300003752 Ga0055539_1005118 Ga0055539_10051181 291
369 3300003759 Ga0055525_1000192 Ga0055525_100019217 291
370 3300003760 Ga0055527_1000041 Ga0055527_100004183 291
371 3300003760 Ga0055527_1000234 Ga0055527_10002348 291
372 3300003761 Ga0055535_1000193 Ga0055535_100019347 291
373 3300003761 Ga0055535_1000216 Ga0055535_100021645 291
374 3300003761 Ga0055535_1000457 Ga0055535_100045727 291
375 3300003761 Ga0055535_1000502 Ga0055535_100050231 291
376 3300003761 Ga0055535_1001000 Ga0055535_100100013 291
377 3300003762 Ga0055542_1000152 Ga0055542_100015247 291
378 3300003762 Ga0055542_1000179 Ga0055542_100017945 291
379 3300003762 Ga0055542_1000183 Ga0055542_100018352 291
380 3300003762 Ga0055542_1000520 Ga0055542_100052031 291
381 3300003763 Ga0055529_1000116 Ga0055529_100011670 291
382 3300003763 Ga0055529_1000189 Ga0055529_100018945 291
383 3300003763 Ga0055529_1000254 Ga0055529_10002548 291
384 3300003763 Ga0055529_1001001 Ga0055529_10010015 291
385 3300003763 Ga0055529_1001913 Ga0055529_10019132 291
386 3300005262 Ga0065165_1000790 Ga0065165_100079029 291
387 3300005344 Ga0070661_100103054 Ga0070661_1001030542 291
388 3300005439 Ga0070711_100456615 Ga0070711_1004566151 291
389 3300005455 Ga0070663_100060000 Ga0070663_1000600002 291
390 3300005455 Ga0070663_100062106 Ga0070663_1000621062 291
391 3300005548 Ga0070665_100526427 Ga0070665_1005264272 291
392 3300005563 Ga0068855_100009108 Ga0068855_10000910813 291
393 3300005563 Ga0068855_100231504 Ga0068855_1002315042 291
394 3300005577 Ga0068857_100000319 Ga0068857_10000031912 291
395 3300005578 Ga0068854_100001263 Ga0068854_1000012639 291
396 3300005616 Ga0068852_100094362 Ga0068852_1000943622 291
397 3300005834 Ga0068851_10013091 Ga0068851_100130914 291
398 3300005842 Ga0068858_100101090 Ga0068858_1001010902 291
399 3300005843 Ga0068860_100007698 Ga0068860_1000076982 291
400 3300005844 Ga0068862_100285142 Ga0068862_1002851422 291
401 3300009093 Ga0105240_10014975 Ga0105240_100149756 291
402 3300009093 Ga0105240_10032831 Ga0105240_100328316 291
403 3300009093 Ga0105240_10073114 Ga0105240_100731145 291
404 3300009093 Ga0105240_10500364 Ga0105240_105003641 291
405 3300009174 Ga0105241_10043360 Ga0105241_100433603 291
406 3300009176 Ga0105242_10000989 Ga0105242_100009897 291
407 3300009545 Ga0105237_10000007 Ga0105237_10000007205 291
408 3300009545 Ga0105237_10000307 Ga0105237_1000030730 291
409 3300009545 Ga0105237_10179690 Ga0105237_101796902 291
410 3300009551 Ga0105238_10053485 Ga0105238_100534852 291
411 3300010375 Ga0105239_10011929 Ga0105239_100119294 291
412 3300010375 Ga0105239_10055911 Ga0105239_100559113 291
413 3300012500 Ga0157314_1001390 Ga0157314_10013902 291
414 3300013104 Ga0157370_10056785 Ga0157370_100567853 291
415 3300013105 Ga0157369_10000030 Ga0157369_1000003090 291
416 3300013307 Ga0157372_10427550 Ga0157372_104275501 291
417 3300013308 Ga0157375_10000333 Ga0157375_1000033336 291
418 3300014968 Ga0157379_10146299 Ga0157379_101462992 291
419 3300014969 Ga0157376_10003889 Ga0157376_100038893 291
420 3300015685 Ga0183369_1006 Ga0183369_1006252 291
421 3300025207 Ga0209760_100574 Ga0209760_1005743 291
422 3300025224 Ga0209784_100068 Ga0209784_10006846 291
423 3300025226 Ga0209674_100148 Ga0209674_10014853 291
424 3300025226 Ga0209674_100336 Ga0209674_1003369 291
425 3300025228 Ga0209672_100005 Ga0209672_100005836 291
426 3300025228 Ga0209672_100045 Ga0209672_10004570 291
427 3300025228 Ga0209672_100100 Ga0209672_10010078 291
428 3300025228 Ga0209672_100350 Ga0209672_10035015 291
429 3300025228 Ga0209672_100676 Ga0209672_10067614 291
430 3300025230 Ga0209563_100023 Ga0209563_100023501 291
431 3300025231 Ga0207427_100139 Ga0207427_10013919 291
432 3300025231 Ga0207427_100140 Ga0207427_10014046 291
433 3300025233 Ga0209437_100147 Ga0209437_100147125 291
434 3300025233 Ga0209437_100462 Ga0209437_10046214 291
435 3300025242 Ga0209258_100006 Ga0209258_100006836 291
436 3300025242 Ga0209258_100024 Ga0209258_10002430 291
437 3300025242 Ga0209258_100111 Ga0209258_100111114 291
438 3300025242 Ga0209258_100200 Ga0209258_10020052 291
439 3300025242 Ga0209258_100360 Ga0209258_10036019 291
440 3300025246 Ga0209646_1000448 Ga0209646_10004487 291
441 3300025246 Ga0209646_1000896 Ga0209646_100089610 291
442 3300025246 Ga0209646_1004003 Ga0209646_10040033 291
443 3300025250 Ga0209026_1000074 Ga0209026_100007455 291
444 3300025250 Ga0209026_1000099 Ga0209026_100009946 291
445 3300025250 Ga0209026_1000737 Ga0209026_10007374 291
446 3300025250 Ga0209026_1000914 Ga0209026_100091413 291
447 3300025254 Ga0209148_1000009 Ga0209148_1000009358 291
448 3300025254 Ga0209148_1000010 Ga0209148_10000101037 291
449 3300025254 Ga0209148_1000012 Ga0209148_1000012836 291
450 3300025254 Ga0209148_1000045 Ga0209148_1000045335 291
451 3300025254 Ga0209148_1000099 Ga0209148_100009999 291
452 3300025256 Ga0209759_1000110 Ga0209759_100011055 291
453 3300025256 Ga0209759_1000247 Ga0209759_100024772 291
454 3300025256 Ga0209759_1000605 Ga0209759_100060521 291
455 3300025256 Ga0209759_1010011 Ga0209759_10100112 291
456 3300025261 Ga0209233_1000009 Ga0209233_1000009133 291
457 3300025261 Ga0209233_1000251 Ga0209233_100025119 291
458 3300025272 Ga0209455_1000008 Ga0209455_1000008836 291
459 3300025272 Ga0209455_1000029 Ga0209455_100002930 291
460 3300025272 Ga0209455_1000035 Ga0209455_1000035336 291
461 3300025272 Ga0209455_1000086 Ga0209455_1000086134 291
462 3300025272 Ga0209455_1000357 Ga0209455_10003575 291
463 3300025297 Ga0209758_1000276 Ga0209758_100027663 291
464 3300025321 Ga0207656_10022469 Ga0207656_100224692 291
465 3300025911 Ga0207654_10010585 Ga0207654_100105855 291
466 3300025912 Ga0207707_10218534 Ga0207707_102185342 291
467 3300025913 Ga0207695_10000408 Ga0207695_1000040863 291
468 3300025913 Ga0207695_10001214 Ga0207695_1000121436 291
469 3300025913 Ga0207695_10008177 Ga0207695_100081776 291
470 3300025913 Ga0207695_10015832 Ga0207695_100158324 291
471 3300025913 Ga0207695_10051819 Ga0207695_100518195 291
472 3300025914 Ga0207671_10000031 Ga0207671_1000003186 291
473 3300025914 Ga0207671_10000074 Ga0207671_1000007454 291
474 3300025914 Ga0207671_10015285 Ga0207671_100152856 291
475 3300025924 Ga0207694_10016049 Ga0207694_100160495 291
476 3300025924 Ga0207694_10327863 Ga0207694_103278632 291
477 3300025938 Ga0207704_10028145 Ga0207704_100281452 291
478 3300025949 Ga0207667_10000082 Ga0207667_10000082114 291
479 3300025949 Ga0207667_10000313 Ga0207667_1000031321 291
480 3300025949 Ga0207667_10144148 Ga0207667_101441483 291
481 3300025981 Ga0207640_10000018 Ga0207640_1000001838 291
482 3300025981 Ga0207640_10000667 Ga0207640_100006674 291
483 3300026035 Ga0207703_10256454 Ga0207703_102564542 291
484 3300026067 Ga0207678_10009903 Ga0207678_100099031 291
485 3300026067 Ga0207678_10034998 Ga0207678_100349982 291
486 3300026067 Ga0207678_10081039 Ga0207678_100810393 291
487 3300026078 Ga0207702_10003312 Ga0207702_1000331214 291
488 3300026116 Ga0207674_10000397 Ga0207674_1000039729 291
489 3300026116 Ga0207674_10479906 Ga0207674_104799061 291
490 3300026142 Ga0207698_10032143 Ga0207698_100321433 291
491 3300028381 Ga0268264_10036217 Ga0268264_100362172 291
492 3300028381 Ga0268264_10293780 Ga0268264_102937802 291
493 3300035724 Ga0373933_0298913 Ga0373933_0298913_140_1027 291
494 3300037312 Ga0395899_0000369 Ga0395899_0000369_47582_48466 291
495 3300037312 Ga0395899_0029464 Ga0395899_0029464_1304_2185 291
496 3300037312 Ga0395899_0112985 Ga0395899_0112985_606_1487 291
497 3300037418 Ga0395900_0000664 Ga0395900_0000664_15171_16052 291
498 3300037466 Ga0395898_0000305 Ga0395898_0000305_109903_110787 291
499 3300037466 Ga0395898_0000526 Ga0395898_0000526_42274_43161 291
500 3300037466 Ga0395898_0001738 Ga0395898_0001738_824_1705 291
501 3300037466 Ga0395898_0164142 Ga0395898_0164142_45_926 291
502 3300037471 Ga0395905_0058412 Ga0395905_0058412_1470_2351 291
503 3300038443 Ga0395901_0000161 Ga0395901_0000161_7703_8584 291
504 3300038443 Ga0395901_0034197 Ga0395901_0034197_4327_5208 291
505 3300044656 Ga0466969_0129963 Ga0466969_0129963_260_1144 291
506 3300044661 Ga0466975_0059357 Ga0466975_0059357_434_1318 291
507 3300044672 Ga0466982_0000004 Ga0466982_0000004_54769_55653 291
508 3300044684 Ga0466966_0007499 Ga0466966_0007499_1186_2070 291
509 3300044684 Ga0466966_0053095 Ga0466966_0053095_1331_2215 291
510 3300044684 Ga0466966_0063799 Ga0466966_0063799_1080_1964 291
511 3300044693 Ga0466961_0001025 Ga0466961_0001025_9581_10468 291
512 3300044693 Ga0466961_0006712 Ga0466961_0006712_129_1013 291
513 3300044693 Ga0466961_0010644 Ga0466961_0010644_4363_5256 291
514 3300044706 Ga0466964_0078537 Ga0466964_0078537_302_1186 291
515 3300044719 Ga0466971_0002157 Ga0466971_0002157_4569_5453 291
516 3300044719 Ga0466971_0032641 Ga0466971_0032641_472_1356 291
517 3300044765 Ga0466970_0006845 Ga0466970_0006845_3945_4829 291
518 3300044765 Ga0466970_0105283 Ga0466970_0105283_32_916 291
519 3300044842 Ga0466957_0003699 Ga0466957_0003699_791_1675 291
520 3300045049 Ga0466959_0030694 Ga0466959_0030694_719_1603 291
521 3300045049 Ga0466959_0034140 Ga0466959_0034140_223_1107 291
522 3300045836 Ga0466958_0006027 Ga0466958_0006027_2878_3765 291
523 3300045836 Ga0466958_0032051 Ga0466958_0032051_323_1207 291
524 3300045976 Ga0466967_0023786 Ga0466967_0023786_1264_2148 291
525 3300046460 Ga0495638_0000213 Ga0495638_0000213_57793_58716 291
526 3300046507 Ga0495606_0001151 Ga0495606_0001151_23880_24803 291
527 3300046536 Ga0495587_0260496 Ga0495587_0260496_57_944 291
528 3300046543 Ga0495645_0101977 Ga0495645_0101977_969_1856 291
529 3300046557 Ga0495622_0011897 Ga0495622_0011897_2584_3507 291
530 3300046694 Ga0495649_0003681 Ga0495649_0003681_9034_9957 291
531 3300048907 Ga0496104_0000058 Ga0496104_0000058_17365_18303 291
532 3300048908 Ga0496105_0000048 Ga0496105_0000048_57498_58436 291
533 3300048924 Ga0496121_0022896 Ga0496121_0022896_2741_3640 291
534 3300048928 Ga0496125_0000499 Ga0496125_0000499_39650_40549 291
535 3300048929 Ga0496126_0022907 Ga0496126_0022907_3302_4225 291
536 3300048929 Ga0496126_0027279 Ga0496126_0027279_1931_2854 291
537 3300049459 Ga0495678_048735 Ga0495678_048735_553_1476 291
538 3300049570 Ga0501033_0002347 Ga0501033_0002347_8606_9487 291
539 3300049570 Ga0501033_0177821 Ga0501033_0177821_257_1138 291
540 3300049571 Ga0501034_0083486 Ga0501034_0083486_1124_2029 291
541 3300049571 Ga0501034_0148619 Ga0501034_0148619_920_1801 291
542 3300049572 Ga0501036_0030713 Ga0501036_0030713_736_1641 291
543 3300049572 Ga0501036_0194116 Ga0501036_0194116_606_1487 291
544 3300049573 Ga0501037_0002084 Ga0501037_0002084_341_1246 291
545 3300049573 Ga0501037_0049355 Ga0501037_0049355_311_1192 291
546 3300049573 Ga0501037_0198500 Ga0501037_0198500_76_957 291
547 3300049574 Ga0501038_0039334 Ga0501038_0039334_2033_2914 291
548 3300049575 Ga0501039_0292942 Ga0501039_0292942_388_1269 291
549 3300049578 Ga0501042_0402176 Ga0501042_0402176_86_967 291
550 3300049579 Ga0501043_0019339 Ga0501043_0019339_3016_3897 291
551 3300049579 Ga0501043_0019703 Ga0501043_0019703_3674_4555 291
552 3300049579 Ga0501043_0035423 Ga0501043_0035423_1494_2375 291
553 3300049579 Ga0501043_0086737 Ga0501043_0086737_199_1170 291
554 3300049580 Ga0501046_0370163 Ga0501046_0370163_17_898 291
555 3300049581 Ga0501047_0041357 Ga0501047_0041357_2122_3003 291
556 3300049581 Ga0501047_0051873 Ga0501047_0051873_323_1204 291
557 3300049582 Ga0501048_0023757 Ga0501048_0023757_338_1219 291
558 3300049582 Ga0501048_0190465 Ga0501048_0190465_465_1355 291
559 3300049822 Ga0501035_0013740 Ga0501035_0013740_6011_6892 291
560 3300049822 Ga0501035_0015101 Ga0501035_0015101_4065_4946 291
561 3300049822 Ga0501035_0061903 Ga0501035_0061903_935_1840 291
562 3300049822 Ga0501035_0334727 Ga0501035_0334727_64_945 291
563 3300049822 Ga0501035_0415994 Ga0501035_0415994_28_909 291
564 3300049823 Ga0501044_0014630 Ga0501044_0014630_5901_6782 291
565 3300049823 Ga0501044_0024692 Ga0501044_0024692_426_1307 291
566 3300061719 Ga0466962_0003174 Ga0466962_0003174_1105_1989 291
567 3300061719 Ga0466962_0037120 Ga0466962_0037120_66_959 291
568 iso_pu_bacteria 2739367700 2739732007 291
569 3300001979 JGI24740J21852_10015416 JGI24740J21852_100154163 293
570 3300005327 Ga0070658_10015567 Ga0070658_100155672 293
571 3300005327 Ga0070658_10265566 Ga0070658_102655661 293
572 3300005329 Ga0070683_100047586 Ga0070683_1000475862 293
573 3300005336 Ga0070680_100004819 Ga0070680_1000048194 293
574 3300005336 Ga0070680_100134325 Ga0070680_1001343253 293
575 3300005339 Ga0070660_100293235 Ga0070660_1002932352 293
576 3300005344 Ga0070661_100087345 Ga0070661_1000873452 293
577 3300005345 Ga0070692_10006030 Ga0070692_100060303 293
578 3300005455 Ga0070663_100002993 Ga0070663_1000029932 293
579 3300005458 Ga0070681_10007740 Ga0070681_100077404 293
580 3300005458 Ga0070681_10103891 Ga0070681_101038913 293
581 3300005530 Ga0070679_100003055 Ga0070679_1000030554 293
582 3300005535 Ga0070684_100010036 Ga0070684_1000100368 293
583 3300005539 Ga0068853_100164219 Ga0068853_1001642192 293
584 3300005546 Ga0070696_100014958 Ga0070696_1000149583 293
585 3300005546 Ga0070696_100091599 Ga0070696_1000915992 293
586 3300005563 Ga0068855_100017751 Ga0068855_1000177512 293
587 3300005577 Ga0068857_100332255 Ga0068857_1003322552 293
588 3300005578 Ga0068854_100009471 Ga0068854_1000094714 293
589 3300005614 Ga0068856_100000652 Ga0068856_10000065217 293
590 3300005616 Ga0068852_100316030 Ga0068852_1003160302 293
591 3300009093 Ga0105240_10223465 Ga0105240_102234653 293
592 3300013100 Ga0157373_10022648 Ga0157373_100226482 293
593 3300013102 Ga0157371_10093840 Ga0157371_100938402 293
594 3300013102 Ga0157371_10376717 Ga0157371_103767171 293
595 3300013104 Ga0157370_10008606 Ga0157370_100086066 293
596 3300013105 Ga0157369_10002156 Ga0157369_100021564 293
597 3300013307 Ga0157372_10007619 Ga0157372_100076193 293
598 3300020070 Ga0206356_11456893 Ga0206356_114568932 293
599 3300020081 Ga0206354_10628491 Ga0206354_106284912 293
600 3300025904 Ga0207647_10015118 Ga0207647_100151184 293
601 3300025909 Ga0207705_10013820 Ga0207705_100138202 293
602 3300025909 Ga0207705_10109550 Ga0207705_101095501 293
603 3300025912 Ga0207707_10000248 Ga0207707_100002484 293
604 3300025912 Ga0207707_10083785 Ga0207707_100837852 293
605 3300025913 Ga0207695_10163234 Ga0207695_101632342 293
606 3300025913 Ga0207695_10214448 Ga0207695_102144482 293
607 3300025917 Ga0207660_10004289 Ga0207660_100042894 293
608 3300025917 Ga0207660_10083348 Ga0207660_100833483 293
609 3300025919 Ga0207657_10132050 Ga0207657_101320502 293
610 3300025921 Ga0207652_10000914 Ga0207652_100009144 293
611 3300025921 Ga0207652_10002467 Ga0207652_100024674 293
612 3300025944 Ga0207661_10027090 Ga0207661_100270906 293
613 3300025949 Ga0207667_10024859 Ga0207667_100248593 293
614 3300025949 Ga0207667_10155716 Ga0207667_101557162 293
615 3300025981 Ga0207640_10005150 Ga0207640_100051504 293
616 3300026067 Ga0207678_10007181 Ga0207678_100071815 293
617 3300026067 Ga0207678_10142459 Ga0207678_101424592 293
618 3300026078 Ga0207702_10001333 Ga0207702_1000133322 293
619 3300026116 Ga0207674_10018647 Ga0207674_100186479 293
620 3300026142 Ga0207698_10041381 Ga0207698_100413813 293
621 3300049585 Ga0501069_0000202 Ga0501069_0000202_18341_19261 293
622 3300049590 Ga0501074_0011180 Ga0501074_0011180_2983_3867 293
623 3300049822 Ga0501035_0005183 Ga0501035_0005183_3397_4278 293
624 3300049823 Ga0501044_0072988 Ga0501044_0072988_2427_3308 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

37

312

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.8923 2 289
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.8893 2 289
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8781 4 289
1ym5-assembly1.cif.gz_A-2 crystal structure of yhi9, the yeast member of the phenazine biosynthesis phzf enzyme superfamily. 0.8776 1 288
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8722 4 289
ID Description Score Start End Superfamily
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9833 6 109 3.10.310.10
af_P38765_5_131_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.9224 6 114 1.20.1730.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.922 6 109 3.10.310.10
1u1vA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9002 5 116 3.10.310.10
3ednB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8959 2 115 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A013T730-F1-model_v4 deleted 0.9775 1 114
AF-A0A806GD84-F1-model_v4 deleted 0.9747 4 84
AF-A0A1C2HRZ9-F1-model_v4 Phenazine biosynthesis protein PhzF 0.9743 6 85 GO:0005737
GO:0009058
GO:0016853
AF-A0A535SIR4-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9714 6 81 GO:0005737
GO:0009058
GO:0016853
AF-A0A349Y6F3-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9707 1 97 GO:0005737
GO:0009058
GO:0016853

Feature Viewer

pLDDT pTM Quality
92.81 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map