F470146

General Info

Members Datasets Scaffolds Average Seq Length
622 259 596 471

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_554_c1|nmdc:mga00v17_554_c1_556_1983
Length 460
Sequence MLEKTYPLYVANRPETPNTDLDVLDKYSGEVATRVAMADAATIERAIQAAVDAAPTMAALPAYKRQAILEHCVRRFRERAEELALALCIEAGKPIKDARGEVTRLIDTFRIAAEEAVRIEGQTVDLEISERGSGYRGIWKRVPIGPCSFITPFNFPLNLVAHKVAPAIAAGCPFVLKPAAKTPVGALIIAEVLAETDLPKGAFSVFACNNEDAAPLIEDDRIKLLSFTGGLVGWDFKARAGRKKVTLELGGNAACIVDGDQAGKLDHVVDRLAFGAYYQSGQSCISVQRILVHDTFVCGDPKDEATFIGPVIDEAAAKKIEGWIGAARDAGASVLAGGGRDGNMLQPALLEHVPRDAELQRQEAFAPVALLERFSDFDKALATVNDSDFGLQAGVFTDSLAHAMQAWDRLEVGGVIVGDVPSFRMDNMPYGGVKDSGLGREGVKFAIEDMSEVRLLVLKT

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2734482264 Dyella sp. AD052 Isolate Unclassified
9 2738543009 Luteibacter sp. OK325 Isolate Unclassified
10 2739367700 Dyella sp. YR388 Isolate Unclassified
11 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
12 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
13 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
14 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
15 2884411467 Dyella sp. AD56 Isolate Rhizosphere
16 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
17 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
18 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
19 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
20 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
21 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
22 2919404418 Luteibacter sp. 3190 Isolate Unclassified
23 2928963466 Dyella japonica 1073 Isolate Unclassified
24 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
25 2941471342 Luteibacter sp. 621 Isolate Unclassified
26 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
27 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
28 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
29 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
30 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
31 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
35 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
42 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
96 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
167 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
224 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 1.45
Isolates 4.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.27
Nodule 0
Rhizoplane 2.89
Rhizosphere 69.13
Stem 0
Stem Tuber 0
Unclassified 12.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000296 3300001915 Bacteria 15024
2 JGI24741J21665_1001236 3300001915 Bacteria 7521
3 JGI24741J21665_1004269 3300001915 Bacteria 3203
4 JGI24741J21665_1006936 3300001915 Bacteria 2232
5 JGI24740J21852_10001743 3300001979 Bacteria 10000
6 JGI24737J22298_10010146 3300001990 Bacteria 3120
7 JGI24735J21928_10014002 3300002067 Bacteria 2515
8 JGI25156J39149_1004679 3300002705 Bacteria 4110
9 JGI25156J39149_1004804 3300002705 Bacteria 4036
10 JGI25162J39368_1000018 3300002737 Bacteria 277875
11 JGI25162J39368_1000988 3300002737 Bacteria 17990
12 JGI25162J39368_1001244 3300002737 Bacteria 14623
13 JGI25157J39369_1000274 3300002741 Bacteria 37731
14 JGI25157J39369_1000749 3300002741 Bacteria 17079
15 JGI25157J39369_1000780 3300002741 Bacteria 16346
16 JGI25157J39369_1002943 3300002741 Bacteria 3768
17 JGI25163J39215_1000566 3300002771 Bacteria 10519
18 JGI25164J39214_1000007 3300002772 Bacteria 312507
19 JGI25164J39214_1000372 3300002772 Bacteria 26710
20 JGI25164J39214_1000612 3300002772 Bacteria 15250
21 JGI25164J39214_1000635 3300002772 Bacteria 14623
22 JGI25165J46597_1000029 3300003214 Bacteria 312507
23 JGI25165J46597_1001233 3300003214 Bacteria 15193
24 JGI25165J46597_1001700 3300003214 Bacteria 9902
25 JGI25165J46597_1002214 3300003214 Bacteria 6819
26 JGI25153J46596_10026221 3300003215 Bacteria 2067
27 rootH2_10016448 3300003320 Bacteria 31308
28 Ga0006562J51391_1059408 3300003578 Bacteria 2500
29 Ga0006562J51391_1086826 3300003578 Bacteria 4430
30 Ga0055539_1001371 3300003752 Bacteria 4636
31 Ga0055525_1000211 3300003759 Bacteria 65308
32 Ga0055527_1000257 3300003760 Bacteria 32518
33 Ga0055527_1000263 3300003760 Bacteria 31815
34 Ga0055527_1002299 3300003760 Bacteria 3309
35 Ga0055535_1000103 3300003761 Bacteria 91199
36 Ga0055535_1000541 3300003761 Bacteria 32518
37 Ga0055535_1000679 3300003761 Bacteria 26491
38 Ga0055535_1003025 3300003761 Bacteria 5128
39 Ga0055542_1000024 3300003762 Bacteria 277875
40 Ga0055542_1000222 3300003762 Bacteria 68762
41 Ga0055542_1000476 3300003762 Bacteria 37344
42 Ga0055542_1000567 3300003762 Bacteria 32518
43 Ga0055542_1000578 3300003762 Bacteria 31815
44 Ga0055542_1000584 3300003762 Bacteria 31631
45 Ga0055529_1000029 3300003763 Bacteria 277978
46 Ga0055529_1000110 3300003763 Bacteria 120255
47 Ga0055529_1000426 3300003763 Bacteria 43142
48 Ga0055529_1000538 3300003763 Bacteria 32518
49 Ga0065165_1000157 3300005262 Bacteria 118005
50 Ga0065165_1008011 3300005262 Bacteria 5051
51 Ga0070658_10001514 3300005327 Bacteria 19725
52 Ga0070666_10000003 3300005335 Bacteria 463666
53 Ga0070680_100000370 3300005336 Bacteria 30250
54 Ga0070680_100000773 3300005336 Bacteria 22446
55 Ga0070680_100040055 3300005336 Bacteria 3792
56 Ga0070682_100003689 3300005337 Bacteria 8507
57 Ga0070682_100052049 3300005337 Bacteria 2562
58 Ga0070660_100018173 3300005339 Bacteria 5133
59 Ga0070660_100026133 3300005339 Bacteria 4346
60 Ga0070660_100034190 3300005339 Bacteria 3838
61 Ga0070660_100072406 3300005339 Bacteria 2693
62 Ga0070689_100001746 3300005340 Bacteria 13911
63 Ga0070691_10004165 3300005341 Bacteria 6569
64 Ga0070661_100003938 3300005344 Bacteria 10218
65 Ga0070661_100072385 3300005344 Bacteria 2536
66 Ga0070661_100130420 3300005344 Bacteria 1887
67 Ga0070659_100069623 3300005366 Bacteria 2793
68 Ga0070659_100130940 3300005366 Bacteria 2037
69 Ga0070667_100000125 3300005367 Bacteria 97665
70 Ga0070667_100035235 3300005367 Bacteria 4192
71 Ga0070714_100099976 3300005435 Bacteria 2554
72 Ga0070663_100000058 3300005455 Bacteria 48647
73 Ga0070663_100001587 3300005455 Bacteria 12518
74 Ga0070663_100031254 3300005455 Bacteria 3658
75 Ga0070663_100074034 3300005455 Bacteria 2486
76 Ga0070663_100097110 3300005455 Bacteria 2193
77 Ga0070663_100130511 3300005455 Bacteria 1908
78 Ga0070662_100021005 3300005457 Bacteria 4454
79 Ga0070681_10000047 3300005458 Bacteria 83504
80 Ga0070681_10006318 3300005458 Bacteria 11522
81 Ga0070681_10007696 3300005458 Bacteria 10534
82 Ga0070681_10011591 3300005458 Bacteria 8727
83 Ga0070681_10024625 3300005458 Bacteria 6055
84 Ga0070685_10016080 3300005466 Bacteria 3981
85 Ga0070679_100000903 3300005530 Bacteria 25743
86 Ga0070679_100002174 3300005530 Bacteria 17690
87 Ga0070679_100064911 3300005530 Bacteria 3639
88 Ga0068853_100001149 3300005539 Bacteria 18771
89 Ga0068853_100017321 3300005539 Bacteria 5948
90 Ga0068853_100029539 3300005539 Bacteria 4622
91 Ga0068853_100041196 3300005539 Bacteria 3943
92 Ga0068853_100052919 3300005539 Bacteria 3496
93 Ga0070696_100005439 3300005546 Bacteria 8493
94 Ga0070696_100007708 3300005546 Bacteria 7190
95 Ga0070696_100062880 3300005546 Bacteria 2599
96 Ga0070693_100002616 3300005547 Bacteria 8289
97 Ga0070693_100011824 3300005547 Bacteria 4403
98 Ga0070693_100019975 3300005547 Bacteria 3524
99 Ga0070665_100009457 3300005548 Bacteria 9865
100 Ga0070665_100011171 3300005548 Bacteria 9079
101 Ga0070665_100062035 3300005548 Bacteria 3748
102 Ga0068855_100004282 3300005563 Bacteria 17432
103 Ga0068855_100017031 3300005563 Bacteria 8742
104 Ga0068855_100040293 3300005563 Bacteria 5544
105 Ga0068855_100144867 3300005563 Bacteria 2705
106 Ga0068855_100168268 3300005563 Bacteria 2483
107 Ga0068855_100254637 3300005563 Bacteria 1957
108 Ga0070664_100018499 3300005564 Bacteria 5725
109 Ga0070664_100024847 3300005564 Bacteria 4962
110 Ga0070664_100090503 3300005564 Bacteria 2648
111 Ga0068857_100009902 3300005577 Bacteria 8274
112 Ga0068857_100155808 3300005577 Bacteria 2071
113 Ga0068854_100001291 3300005578 Bacteria 15082
114 Ga0068854_100002151 3300005578 Bacteria 12098
115 Ga0068854_100004749 3300005578 Bacteria 8568
116 Ga0068854_100010198 3300005578 Bacteria 6090
117 Ga0068854_100040288 3300005578 Bacteria 3296
118 Ga0068856_100010189 3300005614 Bacteria 9139
119 Ga0068856_100054927 3300005614 Bacteria 3930
120 Ga0068852_100005537 3300005616 Bacteria 9054
121 Ga0068852_100064233 3300005616 Bacteria 3199
122 Ga0068851_10018070 3300005834 Bacteria 3395
123 Ga0068858_100125991 3300005842 Bacteria 2399
124 Ga0081540_1002730 3300005983 Bacteria 14362
125 Ga0075364_10001321 3300006051 Bacteria 13342
126 Ga0075369_10013197 3300006186 Bacteria 3273
127 Ga0097621_100070341 3300006237 Bacteria 2890
128 Ga0105240_10000127 3300009093 Bacteria 156461
129 Ga0105240_10005795 3300009093 Bacteria 18320
130 Ga0105240_10045390 3300009093 Bacteria 5575
131 Ga0105240_10118550 3300009093 Bacteria 3189
132 Ga0105240_10152464 3300009093 Bacteria 2751
133 Ga0105247_10018803 3300009101 Bacteria 4148
134 Ga0105248_10004329 3300009177 Bacteria 15699
135 Ga0105237_10000023 3300009545 Bacteria 226144
136 Ga0105237_10000250 3300009545 Bacteria 76317
137 Ga0105237_10037279 3300009545 Bacteria 4916
138 Ga0105238_10000702 3300009551 Bacteria 35000
139 Ga0105238_10007169 3300009551 Bacteria 11150
140 Ga0105249_10000648 3300009553 Bacteria 31755
141 Ga0105239_10000933 3300010375 Bacteria 41307
142 Ga0105239_10025206 3300010375 Bacteria 6548
143 Ga0105239_10030681 3300010375 Bacteria 5913
144 Ga0105239_10259470 3300010375 Bacteria 1953
145 Ga0157373_10014773 3300013100 Bacteria 5719
146 Ga0157373_10084755 3300013100 Bacteria 2233
147 Ga0157371_10013621 3300013102 Bacteria 6172
148 Ga0157371_10032905 3300013102 Bacteria 3729
149 Ga0157371_10046238 3300013102 Bacteria 3096
150 Ga0157370_10004562 3300013104 Bacteria 15855
151 Ga0157369_10000080 3300013105 Bacteria 133011
152 Ga0157369_10001525 3300013105 Bacteria 28397
153 Ga0157369_10026321 3300013105 Bacteria 6454
154 Ga0157374_10152766 3300013296 Bacteria 2245
155 Ga0163162_10007139 3300013306 Bacteria 10842
156 Ga0157372_10001386 3300013307 Bacteria 26144
157 Ga0157372_10004029 3300013307 Bacteria 15755
158 Ga0157372_10018077 3300013307 Bacteria 7578
159 Ga0157372_10035474 3300013307 Bacteria 5491
160 Ga0157372_10051509 3300013307 Bacteria 4582
161 Ga0157372_10208500 3300013307 Bacteria 2264
162 Ga0182008_10016313 3300014497 Bacteria 3860
163 Ga0182006_1000140 3300015261 Bacteria 77650
164 Ga0182006_1000222 3300015261 Bacteria 55421
165 Ga0183369_1012 3300015685 Bacteria 251554
166 Ga0183368_1004 3300015687 Bacteria 1211761
167 Ga0206356_10107366 3300020070 Bacteria 2314
168 Ga0206356_11377764 3300020070 Bacteria 12585
169 Ga0206352_10454266 3300020078 Bacteria 2670
170 Ga0206354_10822484 3300020081 Bacteria 9584
171 Ga0206353_10744446 3300020082 Bacteria 2516
172 Ga0154015_1110366 3300020610 Bacteria 1725
173 Ga0224712_10017407 3300022467 Bacteria 2383
174 Ga0209760_100349 3300025207 Bacteria 13209
175 Ga0209784_100026 3300025224 Bacteria 371540
176 Ga0209674_100016 3300025226 Bacteria 696756
177 Ga0209674_100108 3300025226 Bacteria 150893
178 Ga0209674_100473 3300025226 Bacteria 17588
179 Ga0209674_101452 3300025226 Bacteria 6259
180 Ga0209674_101601 3300025226 Bacteria 5689
181 Ga0209672_100007 3300025228 Bacteria 959482
182 Ga0209672_100009 3300025228 Bacteria 883623
183 Ga0209672_100106 3300025228 Bacteria 100509
184 Ga0209672_100268 3300025228 Bacteria 38409
185 Ga0209672_100863 3300025228 Bacteria 13890
186 Ga0209563_100079 3300025230 Bacteria 203017
187 Ga0207427_100023 3300025231 Bacteria 439725
188 Ga0207427_100105 3300025231 Bacteria 118241
189 Ga0207427_100107 3300025231 Bacteria 116422
190 Ga0207427_100261 3300025231 Bacteria 41118
191 Ga0207427_104067 3300025231 Bacteria 2645
192 Ga0209437_100039 3300025233 Bacteria 448321
193 Ga0209437_100069 3300025233 Bacteria 307733
194 Ga0209437_100129 3300025233 Bacteria 184661
195 Ga0209437_100252 3300025233 Bacteria 84185
196 Ga0209437_100563 3300025233 Bacteria 24403
197 Ga0209258_100011 3300025242 Bacteria 867542
198 Ga0209258_100046 3300025242 Bacteria 369794
199 Ga0209258_100059 3300025242 Bacteria 324934
200 Ga0209258_100155 3300025242 Bacteria 157847
201 Ga0209258_100511 3300025242 Bacteria 37397
202 Ga0209258_101052 3300025242 Bacteria 12139
203 Ga0209646_1000392 3300025246 Bacteria 27054
204 Ga0209026_1000036 3300025250 Bacteria 296607
205 Ga0209026_1000051 3300025250 Bacteria 250792
206 Ga0209026_1000194 3300025250 Bacteria 85950
207 Ga0209026_1000234 3300025250 Bacteria 74634
208 Ga0209026_1000635 3300025250 Bacteria 21860
209 Ga0209026_1003202 3300025250 Bacteria 5536
210 Ga0209148_1000002 3300025254 Bacteria 2399500
211 Ga0209148_1000010 3300025254 Bacteria 1265567
212 Ga0209148_1000013 3300025254 Bacteria 956684
213 Ga0209148_1000084 3300025254 Bacteria 268147
214 Ga0209148_1000220 3300025254 Bacteria 94901
215 Ga0209148_1000533 3300025254 Bacteria 37397
216 Ga0209148_1003283 3300025254 Bacteria 4577
217 Ga0209759_1000300 3300025256 Bacteria 68198
218 Ga0209759_1000442 3300025256 Bacteria 48456
219 Ga0209759_1000901 3300025256 Bacteria 22183
220 Ga0209759_1002380 3300025256 Bacteria 8348
221 Ga0209759_1016040 3300025256 Bacteria 1909
222 Ga0209129_1004409 3300025258 Bacteria 5502
223 Ga0209233_1000009 3300025261 Bacteria 1265567
224 Ga0209233_1000224 3300025261 Bacteria 103605
225 Ga0209233_1000227 3300025261 Bacteria 102833
226 Ga0209233_1000300 3300025261 Bacteria 59294
227 Ga0209233_1000364 3300025261 Bacteria 41118
228 Ga0209233_1012560 3300025261 Bacteria 2452
229 Ga0209455_1000010 3300025272 Bacteria 959482
230 Ga0209455_1000012 3300025272 Bacteria 867234
231 Ga0209455_1000020 3300025272 Bacteria 702259
232 Ga0209455_1000077 3300025272 Bacteria 279165
233 Ga0209455_1000922 3300025272 Bacteria 15165
234 Ga0209455_1006643 3300025272 Bacteria 3390
235 Ga0209758_1002866 3300025297 Bacteria 16735
236 Ga0209758_1014061 3300025297 Bacteria 4297
237 Ga0207426_1003878 3300025302 Bacteria 7705
238 Ga0207680_10000006 3300025903 Bacteria 635950
239 Ga0207647_10000099 3300025904 Bacteria 66290
240 Ga0207647_10000716 3300025904 Bacteria 25997
241 Ga0207647_10005371 3300025904 Bacteria 9418
242 Ga0207647_10031625 3300025904 Bacteria 3404
243 Ga0207705_10001564 3300025909 Bacteria 18182
244 Ga0207705_10001744 3300025909 Bacteria 17217
245 Ga0207705_10002617 3300025909 Bacteria 13797
246 Ga0207705_10003215 3300025909 Bacteria 12441
247 Ga0207705_10003650 3300025909 Bacteria 11716
248 Ga0207707_10000083 3300025912 Bacteria 95462
249 Ga0207707_10000093 3300025912 Bacteria 89975
250 Ga0207707_10000214 3300025912 Bacteria 61954
251 Ga0207707_10000273 3300025912 Bacteria 55671
252 Ga0207707_10000516 3300025912 Bacteria 39572
253 Ga0207707_10004435 3300025912 Bacteria 12370
254 Ga0207707_10004941 3300025912 Bacteria 11719
255 Ga0207695_10000907 3300025913 Bacteria 53347
256 Ga0207695_10001809 3300025913 Bacteria 33712
257 Ga0207695_10004302 3300025913 Bacteria 19518
258 Ga0207695_10004792 3300025913 Bacteria 18304
259 Ga0207695_10006439 3300025913 Bacteria 15246
260 Ga0207695_10007245 3300025913 Bacteria 14168
261 Ga0207695_10014060 3300025913 Bacteria 9504
262 Ga0207695_10070435 3300025913 Bacteria 3575
263 Ga0207695_10116716 3300025913 Bacteria 2643
264 Ga0207695_10192414 3300025913 Bacteria 1957
265 Ga0207671_10000020 3300025914 Bacteria 309636
266 Ga0207671_10000033 3300025914 Bacteria 245869
267 Ga0207671_10000116 3300025914 Bacteria 122775
268 Ga0207671_10009215 3300025914 Bacteria 8277
269 Ga0207693_10041506 3300025915 Bacteria 3622
270 Ga0207663_10101291 3300025916 Bacteria 1935
271 Ga0207660_10000690 3300025917 Bacteria 22578
272 Ga0207660_10000954 3300025917 Bacteria 19144
273 Ga0207660_10001280 3300025917 Bacteria 16882
274 Ga0207660_10001400 3300025917 Bacteria 16210
275 Ga0207660_10003995 3300025917 Bacteria 9613
276 Ga0207657_10001271 3300025919 Bacteria 26893
277 Ga0207657_10004595 3300025919 Bacteria 14588
278 Ga0207657_10073111 3300025919 Bacteria 2899
279 Ga0207657_10078493 3300025919 Bacteria 2780
280 Ga0207649_10000779 3300025920 Bacteria 20674
281 Ga0207649_10002975 3300025920 Bacteria 9336
282 Ga0207652_10000038 3300025921 Bacteria 133467
283 Ga0207652_10000125 3300025921 Bacteria 82619
284 Ga0207652_10000257 3300025921 Bacteria 55336
285 Ga0207694_10001036 3300025924 Bacteria 24194
286 Ga0207664_10094704 3300025929 Bacteria 2455
287 Ga0207644_10009468 3300025931 Bacteria 6397
288 Ga0207690_10000689 3300025932 Bacteria 21712
289 Ga0207690_10000793 3300025932 Bacteria 20362
290 Ga0207690_10019317 3300025932 Bacteria 4194
291 Ga0207670_10001642 3300025936 Bacteria 11672
292 Ga0207704_10102029 3300025938 Bacteria 1915
293 Ga0207711_10004901 3300025941 Bacteria 11362
294 Ga0207661_10005487 3300025944 Bacteria 8946
295 Ga0207661_10007193 3300025944 Bacteria 7908
296 Ga0207661_10104260 3300025944 Bacteria 2387
297 Ga0207679_10012988 3300025945 Bacteria 5449
298 Ga0207667_10000130 3300025949 Bacteria 115321
299 Ga0207667_10000169 3300025949 Bacteria 95977
300 Ga0207667_10002427 3300025949 Bacteria 23337
301 Ga0207667_10006312 3300025949 Bacteria 14377
302 Ga0207667_10008956 3300025949 Bacteria 11838
303 Ga0207667_10019459 3300025949 Bacteria 7579
304 Ga0207667_10025291 3300025949 Bacteria 6501
305 Ga0207667_10027857 3300025949 Bacteria 6143
306 Ga0207667_10070830 3300025949 Bacteria 3628
307 Ga0207712_10000972 3300025961 Bacteria 20638
308 Ga0207640_10000144 3300025981 Bacteria 51999
309 Ga0207640_10000939 3300025981 Bacteria 16269
310 Ga0207640_10002085 3300025981 Bacteria 10766
311 Ga0207640_10004146 3300025981 Bacteria 7833
312 Ga0207640_10025104 3300025981 Bacteria 3603
313 Ga0207640_10070526 3300025981 Bacteria 2351
314 Ga0207640_10084219 3300025981 Bacteria 2183
315 Ga0207658_10000050 3300025986 Bacteria 129714
316 Ga0207658_10032798 3300025986 Bacteria 3700
317 Ga0207658_10033246 3300025986 Bacteria 3678
318 Ga0207639_10000601 3300026041 Bacteria 24806
319 Ga0207639_10000690 3300026041 Bacteria 23246
320 Ga0207639_10002797 3300026041 Bacteria 11719
321 Ga0207639_10006067 3300026041 Bacteria 8202
322 Ga0207639_10011089 3300026041 Bacteria 6251
323 Ga0207639_10030268 3300026041 Bacteria 3969
324 Ga0207678_10000916 3300026067 Bacteria 26995
325 Ga0207678_10001375 3300026067 Bacteria 22403
326 Ga0207678_10004494 3300026067 Bacteria 12538
327 Ga0207678_10004831 3300026067 Bacteria 12098
328 Ga0207678_10006700 3300026067 Bacteria 10215
329 Ga0207678_10006710 3300026067 Bacteria 10210
330 Ga0207678_10017667 3300026067 Bacteria 6262
331 Ga0207678_10018220 3300026067 Bacteria 6167
332 Ga0207678_10030490 3300026067 Bacteria 4707
333 Ga0207678_10153390 3300026067 Bacteria 1967
334 Ga0207702_10000384 3300026078 Bacteria 50456
335 Ga0207702_10005697 3300026078 Bacteria 10861
336 Ga0207702_10006665 3300026078 Bacteria 9930
337 Ga0207702_10009006 3300026078 Bacteria 8404
338 Ga0207702_10022182 3300026078 Bacteria 5262
339 Ga0207702_10195859 3300026078 Bacteria 1870
340 Ga0207641_10063680 3300026088 Bacteria 3150
341 Ga0207674_10001362 3300026116 Bacteria 31632
342 Ga0207674_10001719 3300026116 Bacteria 28008
343 Ga0207674_10002346 3300026116 Bacteria 23934
344 Ga0207674_10067093 3300026116 Bacteria 3612
345 Ga0207674_10183884 3300026116 Bacteria 2040
346 Ga0207698_10001087 3300026142 Bacteria 15802
347 Ga0207698_10005570 3300026142 Bacteria 7787
348 Ga0207698_10283241 3300026142 Bacteria 1534
349 Ga0268266_10000021 3300028379 Bacteria 522453
350 Ga0268266_10016237 3300028379 Bacteria 6365
351 Ga0268265_10034462 3300028380 Bacteria 3691
352 Ga0268264_10164805 3300028381 Bacteria 2000
353 Ga0307412_10000773 3300031911 Bacteria 18455
354 Ga0307510_10000577 3300033180 Bacteria 36999
355 Ga0395899_0000460 3300037312 Bacteria 46114
356 Ga0395899_0006509 3300037312 Bacteria 9050
357 Ga0395899_0038376 3300037312 Bacteria 3587
358 Ga0395900_0000051 3300037418 Bacteria 224228
359 Ga0395900_0005345 3300037418 Bacteria 13457
360 Ga0395900_0012146 3300037418 Bacteria 8800
361 Ga0395900_0035069 3300037418 Bacteria 5167
362 Ga0395898_0000034 3300037466 Bacteria 356745
363 Ga0395898_0000363 3300037466 Bacteria 99698
364 Ga0395901_0001129 3300038443 Bacteria 28299
365 Ga0439436_0000011 3300041404 Bacteria 100668
366 Ga0439465_0000292 3300041413 Bacteria 14130
367 Ga0451793_0322512 3300041452 Bacteria 3437
368 Ga0451793_1765168 3300041452 Bacteria 3064
369 Ga0451802_1844544 3300041460 Bacteria 2647
370 Ga0451807_1050170 3300041486 Bacteria 1917
371 Ga0451853_0156874 3300041512 Bacteria 2950
372 Ga0439448_0018831 3300042005 Bacteria 2120
373 Ga0450908_000023 3300042184 Bacteria 36671
374 Ga0466972_0027965 3300044658 Bacteria 2786
375 Ga0466972_0028135 3300044658 Bacteria 2775
376 Ga0466982_0000020 3300044672 Bacteria 99164
377 Ga0466982_0000036 3300044672 Bacteria 43109
378 Ga0466966_0045502 3300044684 Bacteria 2805
379 Ga0466961_0003216 3300044693 Bacteria 10165
380 Ga0466964_0007589 3300044706 Bacteria 4058
381 Ga0466971_0006011 3300044719 Bacteria 5283
382 Ga0466968_0001311 3300044735 Bacteria 8891
383 Ga0466968_0005485 3300044735 Bacteria 4746
384 Ga0466970_0001722 3300044765 Bacteria 10533
385 Ga0466970_0015845 3300044765 Bacteria 3880
386 Ga0466957_0001506 3300044842 Bacteria 12229
387 Ga0466959_0001256 3300045049 Bacteria 15326
388 Ga0466959_0014169 3300045049 Bacteria 5787
389 Ga0466967_0130553 3300045976 Bacteria 2332
390 Ga0495617_000921 3300046452 Bacteria 13691
391 Ga0495590_0017038 3300046457 Bacteria 2620
392 Ga0495638_0000069 3300046460 Bacteria 167503
393 Ga0495638_0000078 3300046460 Bacteria 157545
394 Ga0495638_0000166 3300046460 Bacteria 102926
395 Ga0495638_0000516 3300046460 Bacteria 45213
396 Ga0495638_0018029 3300046460 Bacteria 4697
397 Ga0495650_0000220 3300046471 Bacteria 119197
398 Ga0495650_0000452 3300046471 Bacteria 65082
399 Ga0495650_0000686 3300046471 Bacteria 43752
400 Ga0495584_0006849 3300046491 Bacteria 5956
401 Ga0495585_0000080 3300046492 Bacteria 99617
402 Ga0495585_0001139 3300046492 Bacteria 21767
403 Ga0495607_0000144 3300046501 Bacteria 74813
404 Ga0495607_0000954 3300046501 Bacteria 26747
405 Ga0495607_0003306 3300046501 Bacteria 12380
406 Ga0495583_0008258 3300046506 Bacteria 6384
407 Ga0495606_0000050 3300046507 Bacteria 203375
408 Ga0495606_0000227 3300046507 Bacteria 99782
409 Ga0495606_0011999 3300046507 Bacteria 6997
410 Ga0495610_0001128 3300046512 Bacteria 24366
411 Ga0495616_0000036 3300046513 Bacteria 128264
412 Ga0495616_0010735 3300046513 Bacteria 5283
413 Ga0495631_0000017 3300046518 Bacteria 98047
414 Ga0495631_0001740 3300046518 Bacteria 12930
415 Ga0495632_0000004 3300046519 Bacteria 381372
416 Ga0495632_0000786 3300046519 Bacteria 28264
417 Ga0495632_0027855 3300046519 Bacteria 2954
418 Ga0495648_0005309 3300046524 Bacteria 10747
419 Ga0495648_0024157 3300046524 Bacteria 4148
420 Ga0495609_0014457 3300046538 Bacteria 3708
421 Ga0495668_0009877 3300046616 Bacteria 5821
422 Ga0495611_0000001 3300046648 Bacteria 2628469
423 Ga0495611_0000022 3300046648 Bacteria 122452
424 Ga0495625_0016987 3300046660 Bacteria 5706
425 Ga0495661_0000657 3300046665 Bacteria 34630
426 Ga0495670_0013676 3300046691 Bacteria 3991
427 Ga0495649_0004268 3300046694 Bacteria 9375
428 Ga0495589_0000053 3300046794 Bacteria 111458
429 Ga0495660_0000233 3300046810 Bacteria 54493
430 Ga0495679_000004 3300047446 Bacteria 748056
431 Ga0495673_0000004 3300047469 Bacteria 1354526
432 Ga0495673_0000048 3300047469 Bacteria 265950
433 Ga0495673_0000644 3300047469 Bacteria 34268
434 Ga0495686_0000017 3300047472 Bacteria 435554
435 Ga0495686_0000295 3300047472 Bacteria 86824
436 Ga0495686_0003885 3300047472 Bacteria 12612
437 Ga0495686_0026907 3300047472 Bacteria 3760
438 Ga0495686_0040185 3300047472 Bacteria 2984
439 Ga0496100_0004368 3300048903 Bacteria 7487
440 Ga0496101_0005402 3300048904 Bacteria 8141
441 Ga0496101_0103684 3300048904 Bacteria 2132
442 Ga0496104_0276585 3300048907 Bacteria 1592
443 Ga0496105_0006103 3300048908 Bacteria 9222
444 Ga0496106_0010355 3300048909 Bacteria 6891
445 Ga0496106_0172547 3300048909 Bacteria 1714
446 Ga0496108_0050537 3300048911 Bacteria 3480
447 Ga0496113_0006783 3300048916 Bacteria 7297
448 Ga0496115_0000039 3300048918 Bacteria 124044
449 Ga0496115_0000180 3300048918 Bacteria 59336
450 Ga0496115_0008559 3300048918 Bacteria 7575
451 Ga0496115_0022001 3300048918 Bacteria 4932
452 Ga0496115_0034830 3300048918 Bacteria 3979
453 Ga0496117_0005946 3300048920 Bacteria 12582
454 Ga0496117_0021175 3300048920 Bacteria 5272
455 Ga0496117_0024598 3300048920 Bacteria 4758
456 Ga0496118_0000413 3300048921 Bacteria 71305
457 Ga0496118_0000645 3300048921 Bacteria 57218
458 Ga0496118_0000805 3300048921 Bacteria 50087
459 Ga0496118_0008916 3300048921 Bacteria 10240
460 Ga0496118_0011703 3300048921 Bacteria 8528
461 Ga0496118_0012593 3300048921 Bacteria 8096
462 Ga0496119_0000868 3300048922 Bacteria 39828
463 Ga0496119_0008515 3300048922 Bacteria 8995
464 Ga0496119_0026697 3300048922 Bacteria 3994
465 Ga0496120_0001056 3300048923 Bacteria 36468
466 Ga0496120_0001816 3300048923 Bacteria 23877
467 Ga0496121_0000372 3300048924 Bacteria 92348
468 Ga0496121_0001970 3300048924 Bacteria 32682
469 Ga0496121_0004478 3300048924 Bacteria 18747
470 Ga0496121_0013350 3300048924 Bacteria 8837
471 Ga0496121_0022568 3300048924 Bacteria 6099
472 Ga0496121_0024061 3300048924 Bacteria 5836
473 Ga0496122_0003660 3300048925 Bacteria 19965
474 Ga0496122_0027095 3300048925 Bacteria 4912
475 Ga0496122_0075011 3300048925 Bacteria 2389
476 Ga0496123_0002907 3300048926 Bacteria 20040
477 Ga0496123_0016637 3300048926 Bacteria 5957
478 Ga0496123_0026568 3300048926 Bacteria 4332
479 Ga0496124_0000289 3300048927 Bacteria 95056
480 Ga0496125_0000344 3300048928 Bacteria 88380
481 Ga0496125_0010084 3300048928 Bacteria 9586
482 Ga0496125_0022927 3300048928 Bacteria 5784
483 Ga0496126_0009400 3300048929 Bacteria 10387
484 Ga0496126_0017325 3300048929 Bacteria 7180
485 Ga0496126_0023281 3300048929 Bacteria 6002
486 Ga0496126_0026524 3300048929 Bacteria 5554
487 Ga0496126_0036929 3300048929 Bacteria 4564
488 Ga0495678_000276 3300049459 Bacteria 56670
489 Ga0495682_0001190 3300049460 Bacteria 14806
490 Ga0501031_0000386 3300049568 Bacteria 25889
491 Ga0501031_0014850 3300049568 Bacteria 5061
492 Ga0501032_0008566 3300049569 Bacteria 7457
493 Ga0501033_0000238 3300049570 Bacteria 52874
494 Ga0501033_0001455 3300049570 Bacteria 20987
495 Ga0501033_0012400 3300049570 Bacteria 6505
496 Ga0501033_0023636 3300049570 Bacteria 4635
497 Ga0501033_0141135 3300049570 Bacteria 1741
498 Ga0501034_0010160 3300049571 Bacteria 9821
499 Ga0501034_0091388 3300049571 Bacteria 3041
500 Ga0501036_0034507 3300049572 Bacteria 4279
501 Ga0501037_0001617 3300049573 Bacteria 16362
502 Ga0501037_0004498 3300049573 Bacteria 10135
503 Ga0501037_0013086 3300049573 Bacteria 6117
504 Ga0501037_0044700 3300049573 Bacteria 3252
505 Ga0501037_0108977 3300049573 Bacteria 1996
506 Ga0501037_0151966 3300049573 Bacteria 1654
507 Ga0501038_0000102 3300049574 Bacteria 72409
508 Ga0501038_0021857 3300049574 Bacteria 5737
509 Ga0501038_0076890 3300049574 Bacteria 2819
510 Ga0501038_0110282 3300049574 Bacteria 2280
511 Ga0501038_0146823 3300049574 Bacteria 1925
512 Ga0501038_0190116 3300049574 Bacteria 1652
513 Ga0501039_0013117 3300049575 Bacteria 6336
514 Ga0501039_0039581 3300049575 Bacteria 3640
515 Ga0501039_0199689 3300049575 Bacteria 1572
516 Ga0501042_0025452 3300049578 Bacteria 4157
517 Ga0501043_0090751 3300049579 Bacteria 2402
518 Ga0501043_0109102 3300049579 Bacteria 2173
519 Ga0501043_0122673 3300049579 Bacteria 2038
520 Ga0501046_0002342 3300049580 Bacteria 17858
521 Ga0501046_0005065 3300049580 Bacteria 11814
522 Ga0501046_0006985 3300049580 Bacteria 9944
523 Ga0501047_0001387 3300049581 Bacteria 23760
524 Ga0501047_0002444 3300049581 Bacteria 17736
525 Ga0501047_0006853 3300049581 Bacteria 10706
526 Ga0501047_0038457 3300049581 Bacteria 4629
527 Ga0501047_0064041 3300049581 Bacteria 3547
528 Ga0501047_0097471 3300049581 Bacteria 2818
529 Ga0501047_0178231 3300049581 Bacteria 1992
530 Ga0501047_0217607 3300049581 Bacteria 1767
531 Ga0501047_0230405 3300049581 Bacteria 1706
532 Ga0501048_0015772 3300049582 Bacteria 5576
533 Ga0501048_0034651 3300049582 Bacteria 3640
534 Ga0501048_0126060 3300049582 Bacteria 1810
535 Ga0501069_0004418 3300049585 Bacteria 7261
536 Ga0501069_0008197 3300049585 Bacteria 5487
537 Ga0501069_0034028 3300049585 Bacteria 2807
538 Ga0501069_0035806 3300049585 Bacteria 2735
539 Ga0501070_0004912 3300049586 Bacteria 11416
540 Ga0501070_0011269 3300049586 Bacteria 7552
541 Ga0501070_0013787 3300049586 Bacteria 6807
542 Ga0501070_0014708 3300049586 Bacteria 6583
543 Ga0501070_0024306 3300049586 Bacteria 5081
544 Ga0501070_0036419 3300049586 Bacteria 4108
545 Ga0501070_0044037 3300049586 Bacteria 3714
546 Ga0501070_0077685 3300049586 Bacteria 2747
547 Ga0501071_0002502 3300049587 Bacteria 11180
548 Ga0501071_0016751 3300049587 Bacteria 5041
549 Ga0501072_0014581 3300049588 Bacteria 6023
550 Ga0501073_0002707 3300049589 Bacteria 13269
551 Ga0501073_0003684 3300049589 Bacteria 11502
552 Ga0501073_0058417 3300049589 Bacteria 2695
553 Ga0501073_0060276 3300049589 Bacteria 2648
554 Ga0501074_0003853 3300049590 Bacteria 10679
555 Ga0501074_0027420 3300049590 Bacteria 4130
556 Ga0501074_0033587 3300049590 Bacteria 3718
557 Ga0501074_0066901 3300049590 Bacteria 2584
558 Ga0501077_0086504 3300049593 Bacteria 1987
559 Ga0501079_0014047 3300049741 Bacteria 6105
560 Ga0501080_0009969 3300049742 Bacteria 8683
561 Ga0501080_0021387 3300049742 Bacteria 5988
562 Ga0501080_0037362 3300049742 Bacteria 4535
563 Ga0501080_0065677 3300049742 Bacteria 3375
564 Ga0501080_0074806 3300049742 Bacteria 3151
565 Ga0501083_0001689 3300049744 Bacteria 15046
566 Ga0501035_0001523 3300049822 Bacteria 23664
567 Ga0501035_0019597 3300049822 Bacteria 6215
568 Ga0501035_0021435 3300049822 Bacteria 5940
569 Ga0501035_0061562 3300049822 Bacteria 3340
570 Ga0501035_0061783 3300049822 Bacteria 3333
571 Ga0501035_0093654 3300049822 Bacteria 2643
572 Ga0501044_0002052 3300049823 Bacteria 23242
573 Ga0501044_0008967 3300049823 Bacteria 10937
574 Ga0501044_0012187 3300049823 Bacteria 9308
575 Ga0501044_0015321 3300049823 Bacteria 8257
576 Ga0501044_0026174 3300049823 Bacteria 6177
577 Ga0501044_0042412 3300049823 Bacteria 4732
578 Ga0501044_0046404 3300049823 Bacteria 4498
579 Ga0501044_0054069 3300049823 Bacteria 4129
580 Ga0501044_0054456 3300049823 Bacteria 4111
581 Ga0501044_0103064 3300049823 Bacteria 2868
582 Ga0501044_0182554 3300049823 Bacteria 2064
583 nmdc:mga00v17_554_c1 3300050491 Bacteria 20868
584 Ga0500610_0002210 3300053079 Bacteria 7039
585 Ga0500643_000888 3300053087 Bacteria 18939
586 Ga0500597_000045 3300053120 Bacteria 23880
587 Ga0500568_0000665 3300053139 Bacteria 24861
588 Ga0500645_000391 3300053730 Bacteria 30650
589 Ga0501084_0043300 3300054114 Bacteria 3766
590 Ga0501084_0049115 3300054114 Bacteria 3532
591 Ga0500661_004961 3300055283 Bacteria 2494
592 Ga0501082_0001868 3300060353 Bacteria 18525
593 Ga0501082_0038278 3300060353 Bacteria 4137
594 Ga0466962_0004865 3300061719 Bacteria 6465
595 Ga0466962_0005997 3300061719 Bacteria 5840
596 Ga0466962_0031299 3300061719 Bacteria 2547

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10000023 Ga0105237_1000002385 414
2 3300049581 Ga0501047_0217607 Ga0501047_0217607_418_1737 416
3 3300001990 JGI24737J22298_10010146 JGI24737J22298_100101463 417
4 3300048909 Ga0496106_0172547 Ga0496106_0172547_10_1338 417
5 3300049573 Ga0501037_0108977 Ga0501037_0108977_697_1959 417
6 3300006051 Ga0075364_10001321 Ga0075364_1000132111 430
7 3300050491 nmdc:mga00v17_554_c1 nmdc:mga00v17_554_c1_556_1983 430
8 3300025936 Ga0207670_10001642 Ga0207670_1000164210 435
9 iso_pu_bacteria 2895498888 2895504054 441
10 iso_pu_bacteria 2895511927 2895515408 441
11 iso_pu_bacteria 2895522137 2895525081 441
12 iso_pu_bacteria 2895525241 2895527817 441
13 iso_pu_bacteria 2537561836 2538832712 442
14 iso_pu_bacteria 2593339238 2595446884 442
15 iso_pu_bacteria 2593339239 2595449647 442
16 iso_pu_bacteria 2643221562 2643830193 442
17 iso_pu_bacteria 2643221577 2643894762 442
18 iso_pu_bacteria 2643221685 2644476920 442
19 iso_pu_bacteria 2687453130 2687582996 442
20 iso_pu_bacteria 2734482264 2735833572 442
21 iso_pu_bacteria 2738543009 2739229700 442
22 iso_pu_bacteria 2739367700 2739730927 442
23 iso_pu_bacteria 2818991440 2819564038 442
24 iso_pu_bacteria 2842914999 2842917589 442
25 iso_pu_bacteria 2884411467 2884412377 442
26 iso_pu_bacteria 2895395659 2895398455 442
27 iso_pu_bacteria 2904463128 2904464674 442
28 iso_pu_bacteria 2919404418 2919406170 442
29 iso_pu_bacteria 2928963466 2928964004 442
30 iso_pu_bacteria 2939611941 2939614728 442
31 iso_pu_bacteria 2941471342 2941473007 442
32 3300048907 Ga0496104_0276585 Ga0496104_0276585_81_1505 444
33 iso_pu_bacteria 2884338543 2884341564 444
34 3300005547 Ga0070693_100011824 Ga0070693_1000118243 445
35 3300005547 Ga0070693_100019975 Ga0070693_1000199752 445
36 3300005563 Ga0068855_100144867 Ga0068855_1001448672 445
37 3300005614 Ga0068856_100010189 Ga0068856_1000101896 445
38 3300009093 Ga0105240_10005795 Ga0105240_1000579511 445
39 3300009545 Ga0105237_10000250 Ga0105237_1000025029 445
40 3300013105 Ga0157369_10026321 Ga0157369_100263215 445
41 3300022467 Ga0224712_10017407 Ga0224712_100174072 445
42 3300025250 Ga0209026_1000234 Ga0209026_100023443 445
43 3300025256 Ga0209759_1016040 Ga0209759_10160402 445
44 3300025272 Ga0209455_1000922 Ga0209455_10009227 445
45 3300025913 Ga0207695_10001809 Ga0207695_1000180921 445
46 3300025913 Ga0207695_10004792 Ga0207695_1000479211 445
47 3300025914 Ga0207671_10000116 Ga0207671_1000011613 445
48 3300025931 Ga0207644_10009468 Ga0207644_100094683 445
49 3300026067 Ga0207678_10004494 Ga0207678_100044945 445
50 3300026078 Ga0207702_10000384 Ga0207702_1000038450 445
51 3300048904 Ga0496101_0103684 Ga0496101_0103684_681_2108 445
52 3300048911 Ga0496108_0050537 Ga0496108_0050537_1754_3181 445
53 3300049568 Ga0501031_0000386 Ga0501031_0000386_24107_25534 445
54 3300049573 Ga0501037_0001617 Ga0501037_0001617_12470_13897 445
55 3300049574 Ga0501038_0000102 Ga0501038_0000102_35694_37121 445
56 3300049574 Ga0501038_0076890 Ga0501038_0076890_606_2033 445
57 3300049575 Ga0501039_0013117 Ga0501039_0013117_4316_5743 445
58 3300049580 Ga0501046_0002342 Ga0501046_0002342_5001_6428 445
59 3300049581 Ga0501047_0001387 Ga0501047_0001387_20528_21955 445
60 3300049582 Ga0501048_0126060 Ga0501048_0126060_309_1736 445
61 3300049589 Ga0501073_0003684 Ga0501073_0003684_715_2142 445
62 3300049742 Ga0501080_0009969 Ga0501080_0009969_6145_7572 445
63 3300049823 Ga0501044_0002052 Ga0501044_0002052_2746_4173 445
64 3300002067 JGI24735J21928_10014002 JGI24735J21928_100140022 446
65 3300002705 JGI25156J39149_1004679 JGI25156J39149_10046792 446
66 3300002705 JGI25156J39149_1004804 JGI25156J39149_10048042 446
67 3300002737 JGI25162J39368_1000018 JGI25162J39368_1000018232 446
68 3300002737 JGI25162J39368_1000988 JGI25162J39368_10009884 446
69 3300002737 JGI25162J39368_1001244 JGI25162J39368_10012444 446
70 3300002741 JGI25157J39369_1000274 JGI25157J39369_100027433 446
71 3300002741 JGI25157J39369_1000749 JGI25157J39369_10007493 446
72 3300002741 JGI25157J39369_1000780 JGI25157J39369_10007803 446
73 3300002741 JGI25157J39369_1002943 JGI25157J39369_10029431 446
74 3300002771 JGI25163J39215_1000566 JGI25163J39215_10005667 446
75 3300002772 JGI25164J39214_1000007 JGI25164J39214_1000007232 446
76 3300002772 JGI25164J39214_1000372 JGI25164J39214_10003722 446
77 3300002772 JGI25164J39214_1000612 JGI25164J39214_10006124 446
78 3300002772 JGI25164J39214_1000635 JGI25164J39214_10006359 446
79 3300003214 JGI25165J46597_1000029 JGI25165J46597_100002957 446
80 3300003214 JGI25165J46597_1001233 JGI25165J46597_10012339 446
81 3300003214 JGI25165J46597_1001700 JGI25165J46597_10017007 446
82 3300003214 JGI25165J46597_1002214 JGI25165J46597_10022144 446
83 3300003215 JGI25153J46596_10026221 JGI25153J46596_100262211 446
84 3300003320 rootH2_10016448 rootH2_100164485 446
85 3300003578 Ga0006562J51391_1059408 Ga0006562J51391_10594081 446
86 3300003578 Ga0006562J51391_1086826 Ga0006562J51391_10868262 446
87 3300003752 Ga0055539_1001371 Ga0055539_10013714 446
88 3300003759 Ga0055525_1000211 Ga0055525_100021138 446
89 3300003760 Ga0055527_1000257 Ga0055527_10002578 446
90 3300003760 Ga0055527_1000263 Ga0055527_10002637 446
91 3300003760 Ga0055527_1002299 Ga0055527_10022992 446
92 3300003761 Ga0055535_1000103 Ga0055535_100010362 446
93 3300003761 Ga0055535_1000541 Ga0055535_100054121 446
94 3300003761 Ga0055535_1000679 Ga0055535_100067917 446
95 3300003761 Ga0055535_1003025 Ga0055535_10030253 446
96 3300003762 Ga0055542_1000024 Ga0055542_1000024232 446
97 3300003762 Ga0055542_1000222 Ga0055542_100022221 446
98 3300003762 Ga0055542_1000476 Ga0055542_10004763 446
99 3300003762 Ga0055542_1000567 Ga0055542_100056721 446
100 3300003762 Ga0055542_1000578 Ga0055542_10005787 446
101 3300003762 Ga0055542_1000584 Ga0055542_10005848 446
102 3300003763 Ga0055529_1000029 Ga0055529_1000029232 446
103 3300003763 Ga0055529_1000110 Ga0055529_100011096 446
104 3300003763 Ga0055529_1000426 Ga0055529_100042620 446
105 3300003763 Ga0055529_1000538 Ga0055529_100053821 446
106 3300005262 Ga0065165_1000157 Ga0065165_100015739 446
107 3300005262 Ga0065165_1008011 Ga0065165_10080113 446
108 3300005327 Ga0070658_10001514 Ga0070658_1000151413 446
109 3300005335 Ga0070666_10000003 Ga0070666_10000003407 446
110 3300005336 Ga0070680_100040055 Ga0070680_1000400551 446
111 3300005337 Ga0070682_100052049 Ga0070682_1000520492 446
112 3300005339 Ga0070660_100072406 Ga0070660_1000724062 446
113 3300005340 Ga0070689_100001746 Ga0070689_1000017464 446
114 3300005344 Ga0070661_100130420 Ga0070661_1001304201 446
115 3300005366 Ga0070659_100130940 Ga0070659_1001309401 446
116 3300005367 Ga0070667_100000125 Ga0070667_10000012562 446
117 3300005367 Ga0070667_100035235 Ga0070667_1000352353 446
118 3300005435 Ga0070714_100099976 Ga0070714_1000999762 446
119 3300005455 Ga0070663_100000058 Ga0070663_1000000589 446
120 3300005455 Ga0070663_100074034 Ga0070663_1000740342 446
121 3300005455 Ga0070663_100130511 Ga0070663_1001305111 446
122 3300005466 Ga0070685_10016080 Ga0070685_100160802 446
123 3300005530 Ga0070679_100064911 Ga0070679_1000649113 446
124 3300005539 Ga0068853_100001149 Ga0068853_1000011499 446
125 3300005539 Ga0068853_100029539 Ga0068853_1000295394 446
126 3300005539 Ga0068853_100041196 Ga0068853_1000411962 446
127 3300005546 Ga0070696_100007708 Ga0070696_1000077083 446
128 3300005546 Ga0070696_100062880 Ga0070696_1000628802 446
129 3300005548 Ga0070665_100009457 Ga0070665_1000094572 446
130 3300005548 Ga0070665_100011171 Ga0070665_1000111715 446
131 3300005548 Ga0070665_100062035 Ga0070665_1000620352 446
132 3300005563 Ga0068855_100004282 Ga0068855_10000428215 446
133 3300005563 Ga0068855_100040293 Ga0068855_1000402933 446
134 3300005563 Ga0068855_100254637 Ga0068855_1002546372 446
135 3300005564 Ga0070664_100018499 Ga0070664_1000184996 446
136 3300005577 Ga0068857_100009902 Ga0068857_1000099026 446
137 3300005578 Ga0068854_100001291 Ga0068854_10000129111 446
138 3300005578 Ga0068854_100004749 Ga0068854_1000047493 446
139 3300005578 Ga0068854_100040288 Ga0068854_1000402883 446
140 3300005614 Ga0068856_100054927 Ga0068856_1000549274 446
141 3300005834 Ga0068851_10018070 Ga0068851_100180703 446
142 3300005842 Ga0068858_100125991 Ga0068858_1001259912 446
143 3300005983 Ga0081540_1002730 Ga0081540_10027302 446
144 3300006186 Ga0075369_10013197 Ga0075369_100131972 446
145 3300006237 Ga0097621_100070341 Ga0097621_1000703414 446
146 3300009093 Ga0105240_10000127 Ga0105240_100001271 446
147 3300009093 Ga0105240_10045390 Ga0105240_100453902 446
148 3300009093 Ga0105240_10118550 Ga0105240_101185503 446
149 3300009093 Ga0105240_10152464 Ga0105240_101524642 446
150 3300009101 Ga0105247_10018803 Ga0105247_100188032 446
151 3300009177 Ga0105248_10004329 Ga0105248_100043297 446
152 3300009551 Ga0105238_10000702 Ga0105238_1000070212 446
153 3300010375 Ga0105239_10000933 Ga0105239_100009331 446
154 3300010375 Ga0105239_10025206 Ga0105239_100252067 446
155 3300010375 Ga0105239_10030681 Ga0105239_100306813 446
156 3300010375 Ga0105239_10259470 Ga0105239_102594701 446
157 3300013105 Ga0157369_10000080 Ga0157369_1000008041 446
158 3300013296 Ga0157374_10152766 Ga0157374_101527662 446
159 3300013307 Ga0157372_10018077 Ga0157372_100180775 446
160 3300013307 Ga0157372_10035474 Ga0157372_100354744 446
161 3300013307 Ga0157372_10051509 Ga0157372_100515092 446
162 3300015261 Ga0182006_1000140 Ga0182006_100014018 446
163 3300015261 Ga0182006_1000222 Ga0182006_100022237 446
164 3300015685 Ga0183369_1012 Ga0183369_101282 446
165 3300015687 Ga0183368_1004 Ga0183368_1004400 446
166 3300025207 Ga0209760_100349 Ga0209760_1003499 446
167 3300025224 Ga0209784_100026 Ga0209784_100026214 446
168 3300025226 Ga0209674_100016 Ga0209674_100016232 446
169 3300025226 Ga0209674_100108 Ga0209674_10010844 446
170 3300025226 Ga0209674_100473 Ga0209674_1004736 446
171 3300025226 Ga0209674_101452 Ga0209674_1014524 446
172 3300025226 Ga0209674_101601 Ga0209674_1016015 446
173 3300025228 Ga0209672_100007 Ga0209672_100007310 446
174 3300025228 Ga0209672_100009 Ga0209672_10000934 446
175 3300025228 Ga0209672_100106 Ga0209672_10010621 446
176 3300025228 Ga0209672_100268 Ga0209672_10026816 446
177 3300025228 Ga0209672_100863 Ga0209672_10086311 446
178 3300025230 Ga0209563_100079 Ga0209563_100079176 446
179 3300025231 Ga0207427_100023 Ga0207427_100023214 446
180 3300025231 Ga0207427_100105 Ga0207427_10010556 446
181 3300025231 Ga0207427_100107 Ga0207427_10010746 446
182 3300025231 Ga0207427_100261 Ga0207427_1002611 446
183 3300025231 Ga0207427_104067 Ga0207427_1040672 446
184 3300025233 Ga0209437_100039 Ga0209437_10003967 446
185 3300025233 Ga0209437_100069 Ga0209437_10006948 446
186 3300025233 Ga0209437_100129 Ga0209437_100129120 446
187 3300025233 Ga0209437_100252 Ga0209437_10025233 446
188 3300025233 Ga0209437_100563 Ga0209437_1005632 446
189 3300025242 Ga0209258_100011 Ga0209258_100011608 446
190 3300025242 Ga0209258_100046 Ga0209258_10004627 446
191 3300025242 Ga0209258_100059 Ga0209258_100059214 446
192 3300025242 Ga0209258_100155 Ga0209258_100155135 446
193 3300025242 Ga0209258_100511 Ga0209258_1005113 446
194 3300025242 Ga0209258_101052 Ga0209258_1010526 446
195 3300025246 Ga0209646_1000392 Ga0209646_100039223 446
196 3300025250 Ga0209026_1000036 Ga0209026_100003639 446
197 3300025250 Ga0209026_1000051 Ga0209026_100005150 446
198 3300025250 Ga0209026_1000194 Ga0209026_10001948 446
199 3300025250 Ga0209026_1000635 Ga0209026_100063518 446
200 3300025250 Ga0209026_1003202 Ga0209026_10032023 446
201 3300025254 Ga0209148_1000002 Ga0209148_10000022117 446
202 3300025254 Ga0209148_1000010 Ga0209148_1000010213 446
203 3300025254 Ga0209148_1000013 Ga0209148_1000013608 446
204 3300025254 Ga0209148_1000084 Ga0209148_1000084103 446
205 3300025254 Ga0209148_1000220 Ga0209148_100022021 446
206 3300025254 Ga0209148_1000533 Ga0209148_100053332 446
207 3300025254 Ga0209148_1003283 Ga0209148_10032834 446
208 3300025256 Ga0209759_1000300 Ga0209759_100030017 446
209 3300025256 Ga0209759_1000442 Ga0209759_100044240 446
210 3300025256 Ga0209759_1000901 Ga0209759_10009017 446
211 3300025256 Ga0209759_1002380 Ga0209759_10023803 446
212 3300025258 Ga0209129_1004409 Ga0209129_10044093 446
213 3300025261 Ga0209233_1000009 Ga0209233_1000009958 446
214 3300025261 Ga0209233_1000224 Ga0209233_100022446 446
215 3300025261 Ga0209233_1000227 Ga0209233_100022732 446
216 3300025261 Ga0209233_1000300 Ga0209233_100030035 446
217 3300025261 Ga0209233_1000364 Ga0209233_10003641 446
218 3300025272 Ga0209455_1000010 Ga0209455_1000010310 446
219 3300025272 Ga0209455_1000012 Ga0209455_1000012608 446
220 3300025272 Ga0209455_1000020 Ga0209455_1000020390 446
221 3300025272 Ga0209455_1000077 Ga0209455_100007721 446
222 3300025272 Ga0209455_1006643 Ga0209455_10066433 446
223 3300025297 Ga0209758_1002866 Ga0209758_10028662 446
224 3300025297 Ga0209758_1014061 Ga0209758_10140613 446
225 3300025302 Ga0207426_1003878 Ga0207426_10038787 446
226 3300025903 Ga0207680_10000006 Ga0207680_10000006553 446
227 3300025904 Ga0207647_10000099 Ga0207647_100000996 446
228 3300025904 Ga0207647_10031625 Ga0207647_100316252 446
229 3300025909 Ga0207705_10003215 Ga0207705_100032156 446
230 3300025913 Ga0207695_10000907 Ga0207695_1000090723 446
231 3300025913 Ga0207695_10006439 Ga0207695_100064391 446
232 3300025913 Ga0207695_10116716 Ga0207695_101167162 446
233 3300025913 Ga0207695_10192414 Ga0207695_101924142 446
234 3300025914 Ga0207671_10000020 Ga0207671_10000020150 446
235 3300025914 Ga0207671_10000033 Ga0207671_10000033105 446
236 3300025914 Ga0207671_10009215 Ga0207671_100092158 446
237 3300025915 Ga0207693_10041506 Ga0207693_100415063 446
238 3300025916 Ga0207663_10101291 Ga0207663_101012911 446
239 3300025919 Ga0207657_10073111 Ga0207657_100731112 446
240 3300025924 Ga0207694_10001036 Ga0207694_1000103617 446
241 3300025929 Ga0207664_10094704 Ga0207664_100947042 446
242 3300025932 Ga0207690_10019317 Ga0207690_100193172 446
243 3300025938 Ga0207704_10102029 Ga0207704_101020291 446
244 3300025941 Ga0207711_10004901 Ga0207711_100049017 446
245 3300025949 Ga0207667_10000130 Ga0207667_1000013038 446
246 3300025949 Ga0207667_10000169 Ga0207667_1000016956 446
247 3300025949 Ga0207667_10019459 Ga0207667_100194595 446
248 3300025961 Ga0207712_10000972 Ga0207712_100009726 446
249 3300025981 Ga0207640_10000144 Ga0207640_1000014416 446
250 3300025981 Ga0207640_10070526 Ga0207640_100705262 446
251 3300025981 Ga0207640_10084219 Ga0207640_100842192 446
252 3300025986 Ga0207658_10000050 Ga0207658_1000005065 446
253 3300025986 Ga0207658_10032798 Ga0207658_100327982 446
254 3300025986 Ga0207658_10033246 Ga0207658_100332462 446
255 3300026041 Ga0207639_10000690 Ga0207639_100006904 446
256 3300026041 Ga0207639_10002797 Ga0207639_100027972 446
257 3300026041 Ga0207639_10011089 Ga0207639_100110892 446
258 3300026067 Ga0207678_10004831 Ga0207678_100048313 446
259 3300026067 Ga0207678_10017667 Ga0207678_100176676 446
260 3300026067 Ga0207678_10153390 Ga0207678_101533902 446
261 3300026078 Ga0207702_10005697 Ga0207702_100056977 446
262 3300026078 Ga0207702_10195859 Ga0207702_101958592 446
263 3300026088 Ga0207641_10063680 Ga0207641_100636802 446
264 3300026116 Ga0207674_10001719 Ga0207674_100017199 446
265 3300026116 Ga0207674_10067093 Ga0207674_100670933 446
266 3300026142 Ga0207698_10283241 Ga0207698_102832411 446
267 3300028379 Ga0268266_10000021 Ga0268266_10000021258 446
268 3300028379 Ga0268266_10016237 Ga0268266_100162373 446
269 3300028380 Ga0268265_10034462 Ga0268265_100344622 446
270 3300028381 Ga0268264_10164805 Ga0268264_101648051 446
271 3300031911 Ga0307412_10000773 Ga0307412_100007736 446
272 3300033180 Ga0307510_10000577 Ga0307510_1000057728 446
273 3300037312 Ga0395899_0000460 Ga0395899_0000460_13081_14511 446
274 3300037312 Ga0395899_0006509 Ga0395899_0006509_6731_8164 446
275 3300037312 Ga0395899_0038376 Ga0395899_0038376_373_1806 446
276 3300037418 Ga0395900_0005345 Ga0395900_0005345_9542_10975 446
277 3300037466 Ga0395898_0000034 Ga0395898_0000034_340336_341766 446
278 3300041452 Ga0451793_0322512 Ga0451793_0322512_386_1828 446
279 3300041452 Ga0451793_1765168 Ga0451793_1765168_1119_2627 446
280 3300041460 Ga0451802_1844544 Ga0451802_1844544_56_1486 446
281 3300041512 Ga0451853_0156874 Ga0451853_0156874_108_1550 446
282 3300042005 Ga0439448_0018831 Ga0439448_0018831_453_1883 446
283 3300042184 Ga0450908_000023 Ga0450908_000023_20406_21839 446
284 3300044658 Ga0466972_0027965 Ga0466972_0027965_118_1548 446
285 3300044672 Ga0466982_0000020 Ga0466982_0000020_2500_3930 446
286 3300044684 Ga0466966_0045502 Ga0466966_0045502_138_1568 446
287 3300044693 Ga0466961_0003216 Ga0466961_0003216_6900_8330 446
288 3300044706 Ga0466964_0007589 Ga0466964_0007589_110_1540 446
289 3300044719 Ga0466971_0006011 Ga0466971_0006011_2065_3495 446
290 3300044735 Ga0466968_0001311 Ga0466968_0001311_6933_8363 446
291 3300044765 Ga0466970_0001722 Ga0466970_0001722_3587_5017 446
292 3300044765 Ga0466970_0015845 Ga0466970_0015845_557_1987 446
293 3300044842 Ga0466957_0001506 Ga0466957_0001506_9342_10772 446
294 3300045049 Ga0466959_0001256 Ga0466959_0001256_6041_7471 446
295 3300045049 Ga0466959_0014169 Ga0466959_0014169_431_1861 446
296 3300045976 Ga0466967_0130553 Ga0466967_0130553_177_1607 446
297 3300046452 Ga0495617_000921 Ga0495617_000921_1480_2910 446
298 3300046457 Ga0495590_0017038 Ga0495590_0017038_580_2010 446
299 3300046460 Ga0495638_0000078 Ga0495638_0000078_146999_148429 446
300 3300046460 Ga0495638_0000166 Ga0495638_0000166_22333_23763 446
301 3300046460 Ga0495638_0000516 Ga0495638_0000516_24795_26225 446
302 3300046460 Ga0495638_0018029 Ga0495638_0018029_2083_3513 446
303 3300046471 Ga0495650_0000220 Ga0495650_0000220_77272_78702 446
304 3300046471 Ga0495650_0000686 Ga0495650_0000686_28165_29595 446
305 3300046491 Ga0495584_0006849 Ga0495584_0006849_807_2237 446
306 3300046492 Ga0495585_0000080 Ga0495585_0000080_29391_30821 446
307 3300046492 Ga0495585_0001139 Ga0495585_0001139_1802_3232 446
308 3300046501 Ga0495607_0000144 Ga0495607_0000144_64931_66361 446
309 3300046501 Ga0495607_0000954 Ga0495607_0000954_15950_17380 446
310 3300046501 Ga0495607_0003306 Ga0495607_0003306_9392_10822 446
311 3300046506 Ga0495583_0008258 Ga0495583_0008258_1845_3275 446
312 3300046507 Ga0495606_0000050 Ga0495606_0000050_62879_64309 446
313 3300046507 Ga0495606_0000227 Ga0495606_0000227_28434_29864 446
314 3300046507 Ga0495606_0011999 Ga0495606_0011999_5338_6768 446
315 3300046512 Ga0495610_0001128 Ga0495610_0001128_4038_5468 446
316 3300046513 Ga0495616_0000036 Ga0495616_0000036_66344_67774 446
317 3300046513 Ga0495616_0010735 Ga0495616_0010735_1177_2607 446
318 3300046518 Ga0495631_0000017 Ga0495631_0000017_63607_65037 446
319 3300046518 Ga0495631_0001740 Ga0495631_0001740_8309_9739 446
320 3300046519 Ga0495632_0000004 Ga0495632_0000004_69064_70494 446
321 3300046519 Ga0495632_0000786 Ga0495632_0000786_8507_9937 446
322 3300046519 Ga0495632_0027855 Ga0495632_0027855_119_1549 446
323 3300046524 Ga0495648_0005309 Ga0495648_0005309_8752_10182 446
324 3300046524 Ga0495648_0024157 Ga0495648_0024157_300_1730 446
325 3300046538 Ga0495609_0014457 Ga0495609_0014457_1137_2567 446
326 3300046616 Ga0495668_0009877 Ga0495668_0009877_3660_5090 446
327 3300046648 Ga0495611_0000001 Ga0495611_0000001_2258057_2259487 446
328 3300046648 Ga0495611_0000022 Ga0495611_0000022_58686_60116 446
329 3300046660 Ga0495625_0016987 Ga0495625_0016987_1399_2829 446
330 3300046665 Ga0495661_0000657 Ga0495661_0000657_24693_26123 446
331 3300046691 Ga0495670_0013676 Ga0495670_0013676_2073_3503 446
332 3300046694 Ga0495649_0004268 Ga0495649_0004268_5363_6793 446
333 3300046794 Ga0495589_0000053 Ga0495589_0000053_36602_38032 446
334 3300046810 Ga0495660_0000233 Ga0495660_0000233_25780_27210 446
335 3300047446 Ga0495679_000004 Ga0495679_000004_368829_370259 446
336 3300047469 Ga0495673_0000004 Ga0495673_0000004_208024_209454 446
337 3300047469 Ga0495673_0000048 Ga0495673_0000048_170731_172161 446
338 3300047469 Ga0495673_0000644 Ga0495673_0000644_8840_10270 446
339 3300047472 Ga0495686_0000295 Ga0495686_0000295_51228_52658 446
340 3300047472 Ga0495686_0026907 Ga0495686_0026907_167_1597 446
341 3300047472 Ga0495686_0040185 Ga0495686_0040185_108_1538 446
342 3300048908 Ga0496105_0006103 Ga0496105_0006103_1027_2457 446
343 3300048909 Ga0496106_0010355 Ga0496106_0010355_3958_5388 446
344 3300048916 Ga0496113_0006783 Ga0496113_0006783_4830_6260 446
345 3300048918 Ga0496115_0000039 Ga0496115_0000039_43463_44893 446
346 3300048918 Ga0496115_0000180 Ga0496115_0000180_37475_38905 446
347 3300048918 Ga0496115_0008559 Ga0496115_0008559_1757_3187 446
348 3300048918 Ga0496115_0022001 Ga0496115_0022001_488_1918 446
349 3300048918 Ga0496115_0034830 Ga0496115_0034830_2018_3448 446
350 3300048920 Ga0496117_0005946 Ga0496117_0005946_5741_7171 446
351 3300048920 Ga0496117_0021175 Ga0496117_0021175_1770_3200 446
352 3300048920 Ga0496117_0024598 Ga0496117_0024598_2880_4310 446
353 3300048921 Ga0496118_0000413 Ga0496118_0000413_13325_14755 446
354 3300048921 Ga0496118_0000805 Ga0496118_0000805_27776_29206 446
355 3300048921 Ga0496118_0008916 Ga0496118_0008916_2088_3518 446
356 3300048921 Ga0496118_0012593 Ga0496118_0012593_4889_6319 446
357 3300048922 Ga0496119_0000868 Ga0496119_0000868_31636_33066 446
358 3300048922 Ga0496119_0008515 Ga0496119_0008515_7440_8870 446
359 3300048922 Ga0496119_0026697 Ga0496119_0026697_189_1619 446
360 3300048923 Ga0496120_0001056 Ga0496120_0001056_151_1581 446
361 3300048923 Ga0496120_0001816 Ga0496120_0001816_17755_19185 446
362 3300048924 Ga0496121_0000372 Ga0496121_0000372_41159_42589 446
363 3300048924 Ga0496121_0001970 Ga0496121_0001970_10805_12235 446
364 3300048924 Ga0496121_0004478 Ga0496121_0004478_4768_6198 446
365 3300048924 Ga0496121_0013350 Ga0496121_0013350_3622_5052 446
366 3300048924 Ga0496121_0022568 Ga0496121_0022568_1545_2975 446
367 3300048925 Ga0496122_0027095 Ga0496122_0027095_2054_3484 446
368 3300048925 Ga0496122_0075011 Ga0496122_0075011_853_2283 446
369 3300048926 Ga0496123_0016637 Ga0496123_0016637_1324_2754 446
370 3300048926 Ga0496123_0026568 Ga0496123_0026568_2053_3483 446
371 3300048927 Ga0496124_0000289 Ga0496124_0000289_19638_21068 446
372 3300048928 Ga0496125_0000344 Ga0496125_0000344_2358_3788 446
373 3300048928 Ga0496125_0010084 Ga0496125_0010084_16_1446 446
374 3300048928 Ga0496125_0022927 Ga0496125_0022927_890_2341 446
375 3300048929 Ga0496126_0009400 Ga0496126_0009400_2204_3634 446
376 3300048929 Ga0496126_0017325 Ga0496126_0017325_1481_2911 446
377 3300048929 Ga0496126_0023281 Ga0496126_0023281_1635_3065 446
378 3300048929 Ga0496126_0026524 Ga0496126_0026524_1330_2760 446
379 3300048929 Ga0496126_0036929 Ga0496126_0036929_1678_3129 446
380 3300049459 Ga0495678_000276 Ga0495678_000276_14862_16292 446
381 3300049460 Ga0495682_0001190 Ga0495682_0001190_10121_11551 446
382 3300049568 Ga0501031_0014850 Ga0501031_0014850_1833_3263 446
383 3300049569 Ga0501032_0008566 Ga0501032_0008566_3734_5164 446
384 3300049570 Ga0501033_0000238 Ga0501033_0000238_10932_12362 446
385 3300049570 Ga0501033_0012400 Ga0501033_0012400_4299_5729 446
386 3300049570 Ga0501033_0023636 Ga0501033_0023636_1561_2994 446
387 3300049571 Ga0501034_0010160 Ga0501034_0010160_5710_7140 446
388 3300049572 Ga0501036_0034507 Ga0501036_0034507_2798_4228 446
389 3300049573 Ga0501037_0004498 Ga0501037_0004498_6412_7842 446
390 3300049573 Ga0501037_0013086 Ga0501037_0013086_2003_3433 446
391 3300049574 Ga0501038_0021857 Ga0501038_0021857_1300_2730 446
392 3300049574 Ga0501038_0110282 Ga0501038_0110282_41_1474 446
393 3300049574 Ga0501038_0190116 Ga0501038_0190116_156_1586 446
394 3300049575 Ga0501039_0039581 Ga0501039_0039581_1563_2993 446
395 3300049578 Ga0501042_0025452 Ga0501042_0025452_1040_2470 446
396 3300049579 Ga0501043_0090751 Ga0501043_0090751_395_1828 446
397 3300049579 Ga0501043_0109102 Ga0501043_0109102_581_2011 446
398 3300049580 Ga0501046_0005065 Ga0501046_0005065_1994_3424 446
399 3300049580 Ga0501046_0006985 Ga0501046_0006985_7334_8764 446
400 3300049581 Ga0501047_0006853 Ga0501047_0006853_6114_7544 446
401 3300049581 Ga0501047_0064041 Ga0501047_0064041_1580_3022 446
402 3300049581 Ga0501047_0097471 Ga0501047_0097471_578_2011 446
403 3300049581 Ga0501047_0230405 Ga0501047_0230405_163_1596 446
404 3300049582 Ga0501048_0015772 Ga0501048_0015772_2555_3985 446
405 3300049582 Ga0501048_0034651 Ga0501048_0034651_737_2167 446
406 3300049585 Ga0501069_0004418 Ga0501069_0004418_1647_3077 446
407 3300049585 Ga0501069_0034028 Ga0501069_0034028_1324_2757 446
408 3300049586 Ga0501070_0036419 Ga0501070_0036419_1111_2541 446
409 3300049586 Ga0501070_0044037 Ga0501070_0044037_208_1638 446
410 3300049586 Ga0501070_0077685 Ga0501070_0077685_271_1704 446
411 3300049587 Ga0501071_0016751 Ga0501071_0016751_1813_3243 446
412 3300049588 Ga0501072_0014581 Ga0501072_0014581_2394_3824 446
413 3300049589 Ga0501073_0058417 Ga0501073_0058417_846_2276 446
414 3300049590 Ga0501074_0003853 Ga0501074_0003853_3516_4946 446
415 3300049590 Ga0501074_0027420 Ga0501074_0027420_698_2128 446
416 3300049593 Ga0501077_0086504 Ga0501077_0086504_384_1814 446
417 3300049741 Ga0501079_0014047 Ga0501079_0014047_1825_3255 446
418 3300049742 Ga0501080_0021387 Ga0501080_0021387_3911_5341 446
419 3300049742 Ga0501080_0065677 Ga0501080_0065677_235_1668 446
420 3300049742 Ga0501080_0074806 Ga0501080_0074806_411_1853 446
421 3300049744 Ga0501083_0001689 Ga0501083_0001689_10386_11816 446
422 3300049822 Ga0501035_0021435 Ga0501035_0021435_2635_4065 446
423 3300049822 Ga0501035_0061562 Ga0501035_0061562_1229_2662 446
424 3300049823 Ga0501044_0026174 Ga0501044_0026174_1235_2677 446
425 3300049823 Ga0501044_0042412 Ga0501044_0042412_2883_4313 446
426 3300049823 Ga0501044_0046404 Ga0501044_0046404_250_1653 446
427 3300049823 Ga0501044_0054069 Ga0501044_0054069_1938_3368 446
428 3300049823 Ga0501044_0054456 Ga0501044_0054456_2276_3706 446
429 3300049823 Ga0501044_0103064 Ga0501044_0103064_1026_2459 446
430 3300049823 Ga0501044_0182554 Ga0501044_0182554_253_1683 446
431 3300053079 Ga0500610_0002210 Ga0500610_0002210_5499_6929 446
432 3300053139 Ga0500568_0000665 Ga0500568_0000665_15164_16594 446
433 3300053730 Ga0500645_000391 Ga0500645_000391_1181_2611 446
434 3300054114 Ga0501084_0043300 Ga0501084_0043300_647_2077 446
435 3300054114 Ga0501084_0049115 Ga0501084_0049115_505_1935 446
436 3300055283 Ga0500661_004961 Ga0500661_004961_331_1761 446
437 3300060353 Ga0501082_0001868 Ga0501082_0001868_13420_14850 446
438 3300060353 Ga0501082_0038278 Ga0501082_0038278_733_2163 446
439 3300061719 Ga0466962_0004865 Ga0466962_0004865_1166_2596 446
440 3300061719 Ga0466962_0005997 Ga0466962_0005997_1064_2494 446
441 3300061719 Ga0466962_0031299 Ga0466962_0031299_579_2009 446
442 3300005458 Ga0070681_10000047 Ga0070681_1000004720 447
443 3300005458 Ga0070681_10024625 Ga0070681_100246253 447
444 3300005563 Ga0068855_100017031 Ga0068855_1000170316 447
445 3300009545 Ga0105237_10037279 Ga0105237_100372792 447
446 3300009553 Ga0105249_10000648 Ga0105249_1000064828 447
447 3300025912 Ga0207707_10000273 Ga0207707_1000027345 447
448 3300025949 Ga0207667_10025291 Ga0207667_100252912 447
449 3300047472 Ga0495686_0003885 Ga0495686_0003885_2872_4305 447
450 3300048925 Ga0496122_0003660 Ga0496122_0003660_9113_10546 447
451 3300048926 Ga0496123_0002907 Ga0496123_0002907_9425_10858 447
452 3300053087 Ga0500643_000888 Ga0500643_000888_9135_10568 447
453 3300053120 Ga0500597_000045 Ga0500597_000045_1029_2462 447
454 3300037418 Ga0395900_0000051 Ga0395900_0000051_91869_93308 448
455 3300037418 Ga0395900_0012146 Ga0395900_0012146_5365_6804 448
456 3300037466 Ga0395898_0000363 Ga0395898_0000363_63685_65121 448
457 3300047472 Ga0495686_0000017 Ga0495686_0000017_289671_291107 448
458 3300048921 Ga0496118_0011703 Ga0496118_0011703_5635_7071 448
459 3300041486 Ga0451807_1050170 Ga0451807_1050170_363_1859 449
460 3300049570 Ga0501033_0001455 Ga0501033_0001455_3401_4918 450
461 3300049573 Ga0501037_0151966 Ga0501037_0151966_24_1598 450
462 3300049574 Ga0501038_0146823 Ga0501038_0146823_215_1789 450
463 3300049575 Ga0501039_0199689 Ga0501039_0199689_36_1559 450
464 3300049579 Ga0501043_0122673 Ga0501043_0122673_70_1644 450
465 3300049581 Ga0501047_0178231 Ga0501047_0178231_349_1899 450
466 3300001915 JGI24741J21665_1000296 JGI24741J21665_100029610 451
467 3300001915 JGI24741J21665_1001236 JGI24741J21665_10012365 451
468 3300001915 JGI24741J21665_1004269 JGI24741J21665_10042691 451
469 3300001915 JGI24741J21665_1006936 JGI24741J21665_10069362 451
470 3300001979 JGI24740J21852_10001743 JGI24740J21852_100017434 451
471 3300005336 Ga0070680_100000370 Ga0070680_10000037017 451
472 3300005336 Ga0070680_100000773 Ga0070680_10000077310 451
473 3300005337 Ga0070682_100003689 Ga0070682_1000036894 451
474 3300005339 Ga0070660_100018173 Ga0070660_1000181732 451
475 3300005339 Ga0070660_100026133 Ga0070660_1000261335 451
476 3300005339 Ga0070660_100034190 Ga0070660_1000341902 451
477 3300005341 Ga0070691_10004165 Ga0070691_100041654 451
478 3300005344 Ga0070661_100003938 Ga0070661_1000039384 451
479 3300005344 Ga0070661_100072385 Ga0070661_1000723852 451
480 3300005366 Ga0070659_100069623 Ga0070659_1000696232 451
481 3300005455 Ga0070663_100001587 Ga0070663_1000015872 451
482 3300005455 Ga0070663_100031254 Ga0070663_1000312542 451
483 3300005455 Ga0070663_100097110 Ga0070663_1000971102 451
484 3300005457 Ga0070662_100021005 Ga0070662_1000210052 451
485 3300005458 Ga0070681_10006318 Ga0070681_100063182 451
486 3300005458 Ga0070681_10007696 Ga0070681_100076962 451
487 3300005458 Ga0070681_10011591 Ga0070681_100115914 451
488 3300005530 Ga0070679_100000903 Ga0070679_10000090314 451
489 3300005530 Ga0070679_100002174 Ga0070679_10000217411 451
490 3300005539 Ga0068853_100017321 Ga0068853_1000173212 451
491 3300005539 Ga0068853_100052919 Ga0068853_1000529192 451
492 3300005546 Ga0070696_100005439 Ga0070696_1000054393 451
493 3300005547 Ga0070693_100002616 Ga0070693_1000026163 451
494 3300005563 Ga0068855_100168268 Ga0068855_1001682682 451
495 3300005564 Ga0070664_100024847 Ga0070664_1000248474 451
496 3300005564 Ga0070664_100090503 Ga0070664_1000905032 451
497 3300005577 Ga0068857_100155808 Ga0068857_1001558081 451
498 3300005578 Ga0068854_100002151 Ga0068854_1000021515 451
499 3300005578 Ga0068854_100010198 Ga0068854_1000101982 451
500 3300005616 Ga0068852_100005537 Ga0068852_1000055374 451
501 3300005616 Ga0068852_100064233 Ga0068852_1000642332 451
502 3300009551 Ga0105238_10007169 Ga0105238_100071694 451
503 3300013100 Ga0157373_10014773 Ga0157373_100147732 451
504 3300013100 Ga0157373_10084755 Ga0157373_100847552 451
505 3300013102 Ga0157371_10013621 Ga0157371_100136216 451
506 3300013102 Ga0157371_10032905 Ga0157371_100329052 451
507 3300013102 Ga0157371_10046238 Ga0157371_100462382 451
508 3300013104 Ga0157370_10004562 Ga0157370_1000456211 451
509 3300013105 Ga0157369_10001525 Ga0157369_1000152519 451
510 3300013306 Ga0163162_10007139 Ga0163162_100071398 451
511 3300013307 Ga0157372_10001386 Ga0157372_1000138611 451
512 3300013307 Ga0157372_10004029 Ga0157372_100040296 451
513 3300013307 Ga0157372_10208500 Ga0157372_102085001 451
514 3300014497 Ga0182008_10016313 Ga0182008_100163133 451
515 3300020070 Ga0206356_10107366 Ga0206356_101073662 451
516 3300020070 Ga0206356_11377764 Ga0206356_1137776412 451
517 3300020078 Ga0206352_10454266 Ga0206352_104542661 451
518 3300020081 Ga0206354_10822484 Ga0206354_108224844 451
519 3300020082 Ga0206353_10744446 Ga0206353_107444462 451
520 3300020610 Ga0154015_1110366 Ga0154015_11103661 451
521 3300025261 Ga0209233_1012560 Ga0209233_10125602 451
522 3300025904 Ga0207647_10000716 Ga0207647_1000071616 451
523 3300025904 Ga0207647_10005371 Ga0207647_100053719 451
524 3300025909 Ga0207705_10001564 Ga0207705_1000156411 451
525 3300025909 Ga0207705_10001744 Ga0207705_1000174410 451
526 3300025909 Ga0207705_10002617 Ga0207705_100026179 451
527 3300025909 Ga0207705_10003650 Ga0207705_100036502 451
528 3300025912 Ga0207707_10000083 Ga0207707_1000008368 451
529 3300025912 Ga0207707_10000093 Ga0207707_1000009312 451
530 3300025912 Ga0207707_10000214 Ga0207707_1000021426 451
531 3300025912 Ga0207707_10000516 Ga0207707_1000051613 451
532 3300025912 Ga0207707_10004435 Ga0207707_100044352 451
533 3300025912 Ga0207707_10004941 Ga0207707_100049414 451
534 3300025913 Ga0207695_10004302 Ga0207695_1000430216 451
535 3300025913 Ga0207695_10007245 Ga0207695_100072456 451
536 3300025913 Ga0207695_10014060 Ga0207695_100140603 451
537 3300025913 Ga0207695_10070435 Ga0207695_100704352 451
538 3300025917 Ga0207660_10000690 Ga0207660_100006904 451
539 3300025917 Ga0207660_10000954 Ga0207660_1000095411 451
540 3300025917 Ga0207660_10001280 Ga0207660_100012807 451
541 3300025917 Ga0207660_10001400 Ga0207660_100014003 451
542 3300025917 Ga0207660_10003995 Ga0207660_100039956 451
543 3300025919 Ga0207657_10001271 Ga0207657_1000127117 451
544 3300025919 Ga0207657_10004595 Ga0207657_100045953 451
545 3300025919 Ga0207657_10078493 Ga0207657_100784932 451
546 3300025920 Ga0207649_10000779 Ga0207649_1000077918 451
547 3300025920 Ga0207649_10002975 Ga0207649_100029753 451
548 3300025921 Ga0207652_10000038 Ga0207652_10000038117 451
549 3300025921 Ga0207652_10000125 Ga0207652_1000012544 451
550 3300025921 Ga0207652_10000257 Ga0207652_1000025710 451
551 3300025932 Ga0207690_10000689 Ga0207690_1000068910 451
552 3300025932 Ga0207690_10000793 Ga0207690_100007933 451
553 3300025944 Ga0207661_10005487 Ga0207661_100054873 451
554 3300025944 Ga0207661_10007193 Ga0207661_100071936 451
555 3300025944 Ga0207661_10104260 Ga0207661_101042602 451
556 3300025945 Ga0207679_10012988 Ga0207679_100129882 451
557 3300025949 Ga0207667_10002427 Ga0207667_100024279 451
558 3300025949 Ga0207667_10006312 Ga0207667_100063123 451
559 3300025949 Ga0207667_10008956 Ga0207667_100089569 451
560 3300025949 Ga0207667_10027857 Ga0207667_100278572 451
561 3300025949 Ga0207667_10070830 Ga0207667_100708302 451
562 3300025981 Ga0207640_10000939 Ga0207640_100009395 451
563 3300025981 Ga0207640_10002085 Ga0207640_100020852 451
564 3300025981 Ga0207640_10004146 Ga0207640_100041462 451
565 3300025981 Ga0207640_10025104 Ga0207640_100251042 451
566 3300026041 Ga0207639_10000601 Ga0207639_1000060110 451
567 3300026041 Ga0207639_10006067 Ga0207639_100060673 451
568 3300026041 Ga0207639_10030268 Ga0207639_100302682 451
569 3300026067 Ga0207678_10000916 Ga0207678_1000091617 451
570 3300026067 Ga0207678_10001375 Ga0207678_1000137510 451
571 3300026067 Ga0207678_10006700 Ga0207678_100067002 451
572 3300026067 Ga0207678_10006710 Ga0207678_100067109 451
573 3300026067 Ga0207678_10018220 Ga0207678_100182202 451
574 3300026067 Ga0207678_10030490 Ga0207678_100304902 451
575 3300026078 Ga0207702_10006665 Ga0207702_100066655 451
576 3300026078 Ga0207702_10009006 Ga0207702_100090062 451
577 3300026078 Ga0207702_10022182 Ga0207702_100221822 451
578 3300026116 Ga0207674_10001362 Ga0207674_1000136217 451
579 3300026116 Ga0207674_10002346 Ga0207674_1000234616 451
580 3300026116 Ga0207674_10183884 Ga0207674_101838841 451
581 3300026142 Ga0207698_10001087 Ga0207698_100010872 451
582 3300026142 Ga0207698_10005570 Ga0207698_100055702 451
583 3300037418 Ga0395900_0035069 Ga0395900_0035069_1657_3174 451
584 3300038443 Ga0395901_0001129 Ga0395901_0001129_22398_23915 451
585 3300041404 Ga0439436_0000011 Ga0439436_0000011_52838_54304 451
586 3300041413 Ga0439465_0000292 Ga0439465_0000292_5739_7205 451
587 3300044658 Ga0466972_0028135 Ga0466972_0028135_789_2237 451
588 3300044672 Ga0466982_0000036 Ga0466982_0000036_129_1586 451
589 3300044735 Ga0466968_0005485 Ga0466968_0005485_2892_4340 451
590 3300046460 Ga0495638_0000069 Ga0495638_0000069_24994_26448 451
591 3300046471 Ga0495650_0000452 Ga0495650_0000452_27490_28965 451
592 3300048903 Ga0496100_0004368 Ga0496100_0004368_4370_5842 451
593 3300048904 Ga0496101_0005402 Ga0496101_0005402_4246_5718 451
594 3300048921 Ga0496118_0000645 Ga0496118_0000645_41455_42957 451
595 3300048924 Ga0496121_0024061 Ga0496121_0024061_979_2481 451
596 3300049570 Ga0501033_0141135 Ga0501033_0141135_53_1501 451
597 3300049571 Ga0501034_0091388 Ga0501034_0091388_1445_2950 451
598 3300049573 Ga0501037_0044700 Ga0501037_0044700_834_2282 451
599 3300049581 Ga0501047_0002444 Ga0501047_0002444_3770_5218 451
600 3300049581 Ga0501047_0038457 Ga0501047_0038457_718_2166 451
601 3300049585 Ga0501069_0008197 Ga0501069_0008197_951_2399 451
602 3300049585 Ga0501069_0035806 Ga0501069_0035806_65_1513 451
603 3300049586 Ga0501070_0004912 Ga0501070_0004912_3017_4465 451
604 3300049586 Ga0501070_0011269 Ga0501070_0011269_139_1584 451
605 3300049586 Ga0501070_0013787 Ga0501070_0013787_5210_6658 451
606 3300049586 Ga0501070_0014708 Ga0501070_0014708_4959_6404 451
607 3300049586 Ga0501070_0024306 Ga0501070_0024306_2501_3949 451
608 3300049587 Ga0501071_0002502 Ga0501071_0002502_2428_3876 451
609 3300049589 Ga0501073_0002707 Ga0501073_0002707_834_2282 451
610 3300049589 Ga0501073_0060276 Ga0501073_0060276_762_2210 451
611 3300049590 Ga0501074_0033587 Ga0501074_0033587_278_1726 451
612 3300049590 Ga0501074_0066901 Ga0501074_0066901_1055_2503 451
613 3300049742 Ga0501080_0037362 Ga0501080_0037362_1556_3004 451
614 3300049822 Ga0501035_0001523 Ga0501035_0001523_3005_4453 451
615 3300049822 Ga0501035_0019597 Ga0501035_0019597_1692_3140 451
616 3300049822 Ga0501035_0061783 Ga0501035_0061783_896_2344 451
617 3300049822 Ga0501035_0093654 Ga0501035_0093654_252_1757 451
618 3300049823 Ga0501044_0008967 Ga0501044_0008967_3698_5146 451
619 3300049823 Ga0501044_0012187 Ga0501044_0012187_5899_7362 451
620 3300049823 Ga0501044_0015321 Ga0501044_0015321_725_2173 451
621 iso_pu_bacteria 2842918807 2842919959 451
622 iso_pu_bacteria 2953994433 2953995254 451

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

13

456

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6b-assembly1.cif.gz_D crystal structure of aldehyde dehydrogenase from burkholderia thailandensis in covelent complex with nadph 0.9447 6 451
1uxv-assembly1.cif.gz_A structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax 0.944 32 449
1ky8-assembly1.cif.gz_A crystal structure of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase 0.9436 28 449
5kf0-assembly1.cif.gz_A crystal structure of an aldedhyde dehydrogenase from burkholderia vietnamiensis 0.9423 6 451
1uxn-assembly1.cif.gz_A structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax 0.942 32 449
ID Description Score Start End Superfamily
5j6bB02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9759 226 415 3.40.309.10
5j6bB02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9708 226 415 3.40.309.10
5mz5B02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9639 226 415 3.40.309.10
5mz5B02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.959 226 415 3.40.309.10
3k2wA02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9495 226 414 3.40.309.10
ID Description Score Start End GO Terms
AF-C5K7N5-F1-model_v4 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.9) (Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]) (Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase) (Triosephosphate dehydrogenase) 0.9539 122 419 GO:0008911
AF-A0A7C5YA24-F1-model_v4 Aldehyde dehydrogenase 0.9492 31 356 GO:0008911
AF-A0A0K2RK11-F1-model_v4 Putative aldehyde-dehydrogenase-like protein y4uC 0.9433 150 427 GO:0008911
AF-A0A658JNM1-F1-model_v4 deleted 0.9415 32 298
AF-A0A7J6T3T6-F1-model_v4 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.9) (Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]) (Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase) (Triosephosphate dehydrogenase) 0.941 7 450 GO:0008911

Feature Viewer

pLDDT pTM Quality
76.79 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map