F470146
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 622 | 259 | 596 | 471 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_554_c1|nmdc:mga00v17_554_c1_556_1983 |
| Length | 460 |
| Sequence | MLEKTYPLYVANRPETPNTDLDVLDKYSGEVATRVAMADAATIERAIQAAVDAAPTMAALPAYKRQAILEHCVRRFRERAEELALALCIEAGKPIKDARGEVTRLIDTFRIAAEEAVRIEGQTVDLEISERGSGYRGIWKRVPIGPCSFITPFNFPLNLVAHKVAPAIAAGCPFVLKPAAKTPVGALIIAEVLAETDLPKGAFSVFACNNEDAAPLIEDDRIKLLSFTGGLVGWDFKARAGRKKVTLELGGNAACIVDGDQAGKLDHVVDRLAFGAYYQSGQSCISVQRILVHDTFVCGDPKDEATFIGPVIDEAAAKKIEGWIGAARDAGASVLAGGGRDGNMLQPALLEHVPRDAELQRQEAFAPVALLERFSDFDKALATVNDSDFGLQAGVFTDSLAHAMQAWDRLEVGGVIVGDVPSFRMDNMPYGGVKDSGLGREGVKFAIEDMSEVRLLVLKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 3 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 4 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 5 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 6 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 7 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 8 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 9 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 10 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 11 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 12 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 13 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 14 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 15 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 16 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 17 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 18 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 19 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 20 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 21 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 22 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 23 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 24 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 25 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 26 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 27 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 28 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 29 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 30 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 31 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 32 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 33 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 34 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 35 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 36 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 39 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 40 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 96 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 155 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 156 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 161 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 162 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 163 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 166 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 167 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 173 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 174 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 175 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 176 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 177 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 210 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 214 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 215 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 216 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 219 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 220 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 221 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 222 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 223 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 252 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 253 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 254 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 255 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 256 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 258 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.37 |
| Metatranscriptomes | 1.45 |
| Isolates | 4.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.27 |
| Nodule | 0 |
| Rhizoplane | 2.89 |
| Rhizosphere | 69.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000296 | 3300001915 | Bacteria | 15024 |
| 2 | JGI24741J21665_1001236 | 3300001915 | Bacteria | 7521 |
| 3 | JGI24741J21665_1004269 | 3300001915 | Bacteria | 3203 |
| 4 | JGI24741J21665_1006936 | 3300001915 | Bacteria | 2232 |
| 5 | JGI24740J21852_10001743 | 3300001979 | Bacteria | 10000 |
| 6 | JGI24737J22298_10010146 | 3300001990 | Bacteria | 3120 |
| 7 | JGI24735J21928_10014002 | 3300002067 | Bacteria | 2515 |
| 8 | JGI25156J39149_1004679 | 3300002705 | Bacteria | 4110 |
| 9 | JGI25156J39149_1004804 | 3300002705 | Bacteria | 4036 |
| 10 | JGI25162J39368_1000018 | 3300002737 | Bacteria | 277875 |
| 11 | JGI25162J39368_1000988 | 3300002737 | Bacteria | 17990 |
| 12 | JGI25162J39368_1001244 | 3300002737 | Bacteria | 14623 |
| 13 | JGI25157J39369_1000274 | 3300002741 | Bacteria | 37731 |
| 14 | JGI25157J39369_1000749 | 3300002741 | Bacteria | 17079 |
| 15 | JGI25157J39369_1000780 | 3300002741 | Bacteria | 16346 |
| 16 | JGI25157J39369_1002943 | 3300002741 | Bacteria | 3768 |
| 17 | JGI25163J39215_1000566 | 3300002771 | Bacteria | 10519 |
| 18 | JGI25164J39214_1000007 | 3300002772 | Bacteria | 312507 |
| 19 | JGI25164J39214_1000372 | 3300002772 | Bacteria | 26710 |
| 20 | JGI25164J39214_1000612 | 3300002772 | Bacteria | 15250 |
| 21 | JGI25164J39214_1000635 | 3300002772 | Bacteria | 14623 |
| 22 | JGI25165J46597_1000029 | 3300003214 | Bacteria | 312507 |
| 23 | JGI25165J46597_1001233 | 3300003214 | Bacteria | 15193 |
| 24 | JGI25165J46597_1001700 | 3300003214 | Bacteria | 9902 |
| 25 | JGI25165J46597_1002214 | 3300003214 | Bacteria | 6819 |
| 26 | JGI25153J46596_10026221 | 3300003215 | Bacteria | 2067 |
| 27 | rootH2_10016448 | 3300003320 | Bacteria | 31308 |
| 28 | Ga0006562J51391_1059408 | 3300003578 | Bacteria | 2500 |
| 29 | Ga0006562J51391_1086826 | 3300003578 | Bacteria | 4430 |
| 30 | Ga0055539_1001371 | 3300003752 | Bacteria | 4636 |
| 31 | Ga0055525_1000211 | 3300003759 | Bacteria | 65308 |
| 32 | Ga0055527_1000257 | 3300003760 | Bacteria | 32518 |
| 33 | Ga0055527_1000263 | 3300003760 | Bacteria | 31815 |
| 34 | Ga0055527_1002299 | 3300003760 | Bacteria | 3309 |
| 35 | Ga0055535_1000103 | 3300003761 | Bacteria | 91199 |
| 36 | Ga0055535_1000541 | 3300003761 | Bacteria | 32518 |
| 37 | Ga0055535_1000679 | 3300003761 | Bacteria | 26491 |
| 38 | Ga0055535_1003025 | 3300003761 | Bacteria | 5128 |
| 39 | Ga0055542_1000024 | 3300003762 | Bacteria | 277875 |
| 40 | Ga0055542_1000222 | 3300003762 | Bacteria | 68762 |
| 41 | Ga0055542_1000476 | 3300003762 | Bacteria | 37344 |
| 42 | Ga0055542_1000567 | 3300003762 | Bacteria | 32518 |
| 43 | Ga0055542_1000578 | 3300003762 | Bacteria | 31815 |
| 44 | Ga0055542_1000584 | 3300003762 | Bacteria | 31631 |
| 45 | Ga0055529_1000029 | 3300003763 | Bacteria | 277978 |
| 46 | Ga0055529_1000110 | 3300003763 | Bacteria | 120255 |
| 47 | Ga0055529_1000426 | 3300003763 | Bacteria | 43142 |
| 48 | Ga0055529_1000538 | 3300003763 | Bacteria | 32518 |
| 49 | Ga0065165_1000157 | 3300005262 | Bacteria | 118005 |
| 50 | Ga0065165_1008011 | 3300005262 | Bacteria | 5051 |
| 51 | Ga0070658_10001514 | 3300005327 | Bacteria | 19725 |
| 52 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 53 | Ga0070680_100000370 | 3300005336 | Bacteria | 30250 |
| 54 | Ga0070680_100000773 | 3300005336 | Bacteria | 22446 |
| 55 | Ga0070680_100040055 | 3300005336 | Bacteria | 3792 |
| 56 | Ga0070682_100003689 | 3300005337 | Bacteria | 8507 |
| 57 | Ga0070682_100052049 | 3300005337 | Bacteria | 2562 |
| 58 | Ga0070660_100018173 | 3300005339 | Bacteria | 5133 |
| 59 | Ga0070660_100026133 | 3300005339 | Bacteria | 4346 |
| 60 | Ga0070660_100034190 | 3300005339 | Bacteria | 3838 |
| 61 | Ga0070660_100072406 | 3300005339 | Bacteria | 2693 |
| 62 | Ga0070689_100001746 | 3300005340 | Bacteria | 13911 |
| 63 | Ga0070691_10004165 | 3300005341 | Bacteria | 6569 |
| 64 | Ga0070661_100003938 | 3300005344 | Bacteria | 10218 |
| 65 | Ga0070661_100072385 | 3300005344 | Bacteria | 2536 |
| 66 | Ga0070661_100130420 | 3300005344 | Bacteria | 1887 |
| 67 | Ga0070659_100069623 | 3300005366 | Bacteria | 2793 |
| 68 | Ga0070659_100130940 | 3300005366 | Bacteria | 2037 |
| 69 | Ga0070667_100000125 | 3300005367 | Bacteria | 97665 |
| 70 | Ga0070667_100035235 | 3300005367 | Bacteria | 4192 |
| 71 | Ga0070714_100099976 | 3300005435 | Bacteria | 2554 |
| 72 | Ga0070663_100000058 | 3300005455 | Bacteria | 48647 |
| 73 | Ga0070663_100001587 | 3300005455 | Bacteria | 12518 |
| 74 | Ga0070663_100031254 | 3300005455 | Bacteria | 3658 |
| 75 | Ga0070663_100074034 | 3300005455 | Bacteria | 2486 |
| 76 | Ga0070663_100097110 | 3300005455 | Bacteria | 2193 |
| 77 | Ga0070663_100130511 | 3300005455 | Bacteria | 1908 |
| 78 | Ga0070662_100021005 | 3300005457 | Bacteria | 4454 |
| 79 | Ga0070681_10000047 | 3300005458 | Bacteria | 83504 |
| 80 | Ga0070681_10006318 | 3300005458 | Bacteria | 11522 |
| 81 | Ga0070681_10007696 | 3300005458 | Bacteria | 10534 |
| 82 | Ga0070681_10011591 | 3300005458 | Bacteria | 8727 |
| 83 | Ga0070681_10024625 | 3300005458 | Bacteria | 6055 |
| 84 | Ga0070685_10016080 | 3300005466 | Bacteria | 3981 |
| 85 | Ga0070679_100000903 | 3300005530 | Bacteria | 25743 |
| 86 | Ga0070679_100002174 | 3300005530 | Bacteria | 17690 |
| 87 | Ga0070679_100064911 | 3300005530 | Bacteria | 3639 |
| 88 | Ga0068853_100001149 | 3300005539 | Bacteria | 18771 |
| 89 | Ga0068853_100017321 | 3300005539 | Bacteria | 5948 |
| 90 | Ga0068853_100029539 | 3300005539 | Bacteria | 4622 |
| 91 | Ga0068853_100041196 | 3300005539 | Bacteria | 3943 |
| 92 | Ga0068853_100052919 | 3300005539 | Bacteria | 3496 |
| 93 | Ga0070696_100005439 | 3300005546 | Bacteria | 8493 |
| 94 | Ga0070696_100007708 | 3300005546 | Bacteria | 7190 |
| 95 | Ga0070696_100062880 | 3300005546 | Bacteria | 2599 |
| 96 | Ga0070693_100002616 | 3300005547 | Bacteria | 8289 |
| 97 | Ga0070693_100011824 | 3300005547 | Bacteria | 4403 |
| 98 | Ga0070693_100019975 | 3300005547 | Bacteria | 3524 |
| 99 | Ga0070665_100009457 | 3300005548 | Bacteria | 9865 |
| 100 | Ga0070665_100011171 | 3300005548 | Bacteria | 9079 |
| 101 | Ga0070665_100062035 | 3300005548 | Bacteria | 3748 |
| 102 | Ga0068855_100004282 | 3300005563 | Bacteria | 17432 |
| 103 | Ga0068855_100017031 | 3300005563 | Bacteria | 8742 |
| 104 | Ga0068855_100040293 | 3300005563 | Bacteria | 5544 |
| 105 | Ga0068855_100144867 | 3300005563 | Bacteria | 2705 |
| 106 | Ga0068855_100168268 | 3300005563 | Bacteria | 2483 |
| 107 | Ga0068855_100254637 | 3300005563 | Bacteria | 1957 |
| 108 | Ga0070664_100018499 | 3300005564 | Bacteria | 5725 |
| 109 | Ga0070664_100024847 | 3300005564 | Bacteria | 4962 |
| 110 | Ga0070664_100090503 | 3300005564 | Bacteria | 2648 |
| 111 | Ga0068857_100009902 | 3300005577 | Bacteria | 8274 |
| 112 | Ga0068857_100155808 | 3300005577 | Bacteria | 2071 |
| 113 | Ga0068854_100001291 | 3300005578 | Bacteria | 15082 |
| 114 | Ga0068854_100002151 | 3300005578 | Bacteria | 12098 |
| 115 | Ga0068854_100004749 | 3300005578 | Bacteria | 8568 |
| 116 | Ga0068854_100010198 | 3300005578 | Bacteria | 6090 |
| 117 | Ga0068854_100040288 | 3300005578 | Bacteria | 3296 |
| 118 | Ga0068856_100010189 | 3300005614 | Bacteria | 9139 |
| 119 | Ga0068856_100054927 | 3300005614 | Bacteria | 3930 |
| 120 | Ga0068852_100005537 | 3300005616 | Bacteria | 9054 |
| 121 | Ga0068852_100064233 | 3300005616 | Bacteria | 3199 |
| 122 | Ga0068851_10018070 | 3300005834 | Bacteria | 3395 |
| 123 | Ga0068858_100125991 | 3300005842 | Bacteria | 2399 |
| 124 | Ga0081540_1002730 | 3300005983 | Bacteria | 14362 |
| 125 | Ga0075364_10001321 | 3300006051 | Bacteria | 13342 |
| 126 | Ga0075369_10013197 | 3300006186 | Bacteria | 3273 |
| 127 | Ga0097621_100070341 | 3300006237 | Bacteria | 2890 |
| 128 | Ga0105240_10000127 | 3300009093 | Bacteria | 156461 |
| 129 | Ga0105240_10005795 | 3300009093 | Bacteria | 18320 |
| 130 | Ga0105240_10045390 | 3300009093 | Bacteria | 5575 |
| 131 | Ga0105240_10118550 | 3300009093 | Bacteria | 3189 |
| 132 | Ga0105240_10152464 | 3300009093 | Bacteria | 2751 |
| 133 | Ga0105247_10018803 | 3300009101 | Bacteria | 4148 |
| 134 | Ga0105248_10004329 | 3300009177 | Bacteria | 15699 |
| 135 | Ga0105237_10000023 | 3300009545 | Bacteria | 226144 |
| 136 | Ga0105237_10000250 | 3300009545 | Bacteria | 76317 |
| 137 | Ga0105237_10037279 | 3300009545 | Bacteria | 4916 |
| 138 | Ga0105238_10000702 | 3300009551 | Bacteria | 35000 |
| 139 | Ga0105238_10007169 | 3300009551 | Bacteria | 11150 |
| 140 | Ga0105249_10000648 | 3300009553 | Bacteria | 31755 |
| 141 | Ga0105239_10000933 | 3300010375 | Bacteria | 41307 |
| 142 | Ga0105239_10025206 | 3300010375 | Bacteria | 6548 |
| 143 | Ga0105239_10030681 | 3300010375 | Bacteria | 5913 |
| 144 | Ga0105239_10259470 | 3300010375 | Bacteria | 1953 |
| 145 | Ga0157373_10014773 | 3300013100 | Bacteria | 5719 |
| 146 | Ga0157373_10084755 | 3300013100 | Bacteria | 2233 |
| 147 | Ga0157371_10013621 | 3300013102 | Bacteria | 6172 |
| 148 | Ga0157371_10032905 | 3300013102 | Bacteria | 3729 |
| 149 | Ga0157371_10046238 | 3300013102 | Bacteria | 3096 |
| 150 | Ga0157370_10004562 | 3300013104 | Bacteria | 15855 |
| 151 | Ga0157369_10000080 | 3300013105 | Bacteria | 133011 |
| 152 | Ga0157369_10001525 | 3300013105 | Bacteria | 28397 |
| 153 | Ga0157369_10026321 | 3300013105 | Bacteria | 6454 |
| 154 | Ga0157374_10152766 | 3300013296 | Bacteria | 2245 |
| 155 | Ga0163162_10007139 | 3300013306 | Bacteria | 10842 |
| 156 | Ga0157372_10001386 | 3300013307 | Bacteria | 26144 |
| 157 | Ga0157372_10004029 | 3300013307 | Bacteria | 15755 |
| 158 | Ga0157372_10018077 | 3300013307 | Bacteria | 7578 |
| 159 | Ga0157372_10035474 | 3300013307 | Bacteria | 5491 |
| 160 | Ga0157372_10051509 | 3300013307 | Bacteria | 4582 |
| 161 | Ga0157372_10208500 | 3300013307 | Bacteria | 2264 |
| 162 | Ga0182008_10016313 | 3300014497 | Bacteria | 3860 |
| 163 | Ga0182006_1000140 | 3300015261 | Bacteria | 77650 |
| 164 | Ga0182006_1000222 | 3300015261 | Bacteria | 55421 |
| 165 | Ga0183369_1012 | 3300015685 | Bacteria | 251554 |
| 166 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 167 | Ga0206356_10107366 | 3300020070 | Bacteria | 2314 |
| 168 | Ga0206356_11377764 | 3300020070 | Bacteria | 12585 |
| 169 | Ga0206352_10454266 | 3300020078 | Bacteria | 2670 |
| 170 | Ga0206354_10822484 | 3300020081 | Bacteria | 9584 |
| 171 | Ga0206353_10744446 | 3300020082 | Bacteria | 2516 |
| 172 | Ga0154015_1110366 | 3300020610 | Bacteria | 1725 |
| 173 | Ga0224712_10017407 | 3300022467 | Bacteria | 2383 |
| 174 | Ga0209760_100349 | 3300025207 | Bacteria | 13209 |
| 175 | Ga0209784_100026 | 3300025224 | Bacteria | 371540 |
| 176 | Ga0209674_100016 | 3300025226 | Bacteria | 696756 |
| 177 | Ga0209674_100108 | 3300025226 | Bacteria | 150893 |
| 178 | Ga0209674_100473 | 3300025226 | Bacteria | 17588 |
| 179 | Ga0209674_101452 | 3300025226 | Bacteria | 6259 |
| 180 | Ga0209674_101601 | 3300025226 | Bacteria | 5689 |
| 181 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 182 | Ga0209672_100009 | 3300025228 | Bacteria | 883623 |
| 183 | Ga0209672_100106 | 3300025228 | Bacteria | 100509 |
| 184 | Ga0209672_100268 | 3300025228 | Bacteria | 38409 |
| 185 | Ga0209672_100863 | 3300025228 | Bacteria | 13890 |
| 186 | Ga0209563_100079 | 3300025230 | Bacteria | 203017 |
| 187 | Ga0207427_100023 | 3300025231 | Bacteria | 439725 |
| 188 | Ga0207427_100105 | 3300025231 | Bacteria | 118241 |
| 189 | Ga0207427_100107 | 3300025231 | Bacteria | 116422 |
| 190 | Ga0207427_100261 | 3300025231 | Bacteria | 41118 |
| 191 | Ga0207427_104067 | 3300025231 | Bacteria | 2645 |
| 192 | Ga0209437_100039 | 3300025233 | Bacteria | 448321 |
| 193 | Ga0209437_100069 | 3300025233 | Bacteria | 307733 |
| 194 | Ga0209437_100129 | 3300025233 | Bacteria | 184661 |
| 195 | Ga0209437_100252 | 3300025233 | Bacteria | 84185 |
| 196 | Ga0209437_100563 | 3300025233 | Bacteria | 24403 |
| 197 | Ga0209258_100011 | 3300025242 | Bacteria | 867542 |
| 198 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 199 | Ga0209258_100059 | 3300025242 | Bacteria | 324934 |
| 200 | Ga0209258_100155 | 3300025242 | Bacteria | 157847 |
| 201 | Ga0209258_100511 | 3300025242 | Bacteria | 37397 |
| 202 | Ga0209258_101052 | 3300025242 | Bacteria | 12139 |
| 203 | Ga0209646_1000392 | 3300025246 | Bacteria | 27054 |
| 204 | Ga0209026_1000036 | 3300025250 | Bacteria | 296607 |
| 205 | Ga0209026_1000051 | 3300025250 | Bacteria | 250792 |
| 206 | Ga0209026_1000194 | 3300025250 | Bacteria | 85950 |
| 207 | Ga0209026_1000234 | 3300025250 | Bacteria | 74634 |
| 208 | Ga0209026_1000635 | 3300025250 | Bacteria | 21860 |
| 209 | Ga0209026_1003202 | 3300025250 | Bacteria | 5536 |
| 210 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 211 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 212 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 213 | Ga0209148_1000084 | 3300025254 | Bacteria | 268147 |
| 214 | Ga0209148_1000220 | 3300025254 | Bacteria | 94901 |
| 215 | Ga0209148_1000533 | 3300025254 | Bacteria | 37397 |
| 216 | Ga0209148_1003283 | 3300025254 | Bacteria | 4577 |
| 217 | Ga0209759_1000300 | 3300025256 | Bacteria | 68198 |
| 218 | Ga0209759_1000442 | 3300025256 | Bacteria | 48456 |
| 219 | Ga0209759_1000901 | 3300025256 | Bacteria | 22183 |
| 220 | Ga0209759_1002380 | 3300025256 | Bacteria | 8348 |
| 221 | Ga0209759_1016040 | 3300025256 | Bacteria | 1909 |
| 222 | Ga0209129_1004409 | 3300025258 | Bacteria | 5502 |
| 223 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 224 | Ga0209233_1000224 | 3300025261 | Bacteria | 103605 |
| 225 | Ga0209233_1000227 | 3300025261 | Bacteria | 102833 |
| 226 | Ga0209233_1000300 | 3300025261 | Bacteria | 59294 |
| 227 | Ga0209233_1000364 | 3300025261 | Bacteria | 41118 |
| 228 | Ga0209233_1012560 | 3300025261 | Bacteria | 2452 |
| 229 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 230 | Ga0209455_1000012 | 3300025272 | Bacteria | 867234 |
| 231 | Ga0209455_1000020 | 3300025272 | Bacteria | 702259 |
| 232 | Ga0209455_1000077 | 3300025272 | Bacteria | 279165 |
| 233 | Ga0209455_1000922 | 3300025272 | Bacteria | 15165 |
| 234 | Ga0209455_1006643 | 3300025272 | Bacteria | 3390 |
| 235 | Ga0209758_1002866 | 3300025297 | Bacteria | 16735 |
| 236 | Ga0209758_1014061 | 3300025297 | Bacteria | 4297 |
| 237 | Ga0207426_1003878 | 3300025302 | Bacteria | 7705 |
| 238 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 239 | Ga0207647_10000099 | 3300025904 | Bacteria | 66290 |
| 240 | Ga0207647_10000716 | 3300025904 | Bacteria | 25997 |
| 241 | Ga0207647_10005371 | 3300025904 | Bacteria | 9418 |
| 242 | Ga0207647_10031625 | 3300025904 | Bacteria | 3404 |
| 243 | Ga0207705_10001564 | 3300025909 | Bacteria | 18182 |
| 244 | Ga0207705_10001744 | 3300025909 | Bacteria | 17217 |
| 245 | Ga0207705_10002617 | 3300025909 | Bacteria | 13797 |
| 246 | Ga0207705_10003215 | 3300025909 | Bacteria | 12441 |
| 247 | Ga0207705_10003650 | 3300025909 | Bacteria | 11716 |
| 248 | Ga0207707_10000083 | 3300025912 | Bacteria | 95462 |
| 249 | Ga0207707_10000093 | 3300025912 | Bacteria | 89975 |
| 250 | Ga0207707_10000214 | 3300025912 | Bacteria | 61954 |
| 251 | Ga0207707_10000273 | 3300025912 | Bacteria | 55671 |
| 252 | Ga0207707_10000516 | 3300025912 | Bacteria | 39572 |
| 253 | Ga0207707_10004435 | 3300025912 | Bacteria | 12370 |
| 254 | Ga0207707_10004941 | 3300025912 | Bacteria | 11719 |
| 255 | Ga0207695_10000907 | 3300025913 | Bacteria | 53347 |
| 256 | Ga0207695_10001809 | 3300025913 | Bacteria | 33712 |
| 257 | Ga0207695_10004302 | 3300025913 | Bacteria | 19518 |
| 258 | Ga0207695_10004792 | 3300025913 | Bacteria | 18304 |
| 259 | Ga0207695_10006439 | 3300025913 | Bacteria | 15246 |
| 260 | Ga0207695_10007245 | 3300025913 | Bacteria | 14168 |
| 261 | Ga0207695_10014060 | 3300025913 | Bacteria | 9504 |
| 262 | Ga0207695_10070435 | 3300025913 | Bacteria | 3575 |
| 263 | Ga0207695_10116716 | 3300025913 | Bacteria | 2643 |
| 264 | Ga0207695_10192414 | 3300025913 | Bacteria | 1957 |
| 265 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 266 | Ga0207671_10000033 | 3300025914 | Bacteria | 245869 |
| 267 | Ga0207671_10000116 | 3300025914 | Bacteria | 122775 |
| 268 | Ga0207671_10009215 | 3300025914 | Bacteria | 8277 |
| 269 | Ga0207693_10041506 | 3300025915 | Bacteria | 3622 |
| 270 | Ga0207663_10101291 | 3300025916 | Bacteria | 1935 |
| 271 | Ga0207660_10000690 | 3300025917 | Bacteria | 22578 |
| 272 | Ga0207660_10000954 | 3300025917 | Bacteria | 19144 |
| 273 | Ga0207660_10001280 | 3300025917 | Bacteria | 16882 |
| 274 | Ga0207660_10001400 | 3300025917 | Bacteria | 16210 |
| 275 | Ga0207660_10003995 | 3300025917 | Bacteria | 9613 |
| 276 | Ga0207657_10001271 | 3300025919 | Bacteria | 26893 |
| 277 | Ga0207657_10004595 | 3300025919 | Bacteria | 14588 |
| 278 | Ga0207657_10073111 | 3300025919 | Bacteria | 2899 |
| 279 | Ga0207657_10078493 | 3300025919 | Bacteria | 2780 |
| 280 | Ga0207649_10000779 | 3300025920 | Bacteria | 20674 |
| 281 | Ga0207649_10002975 | 3300025920 | Bacteria | 9336 |
| 282 | Ga0207652_10000038 | 3300025921 | Bacteria | 133467 |
| 283 | Ga0207652_10000125 | 3300025921 | Bacteria | 82619 |
| 284 | Ga0207652_10000257 | 3300025921 | Bacteria | 55336 |
| 285 | Ga0207694_10001036 | 3300025924 | Bacteria | 24194 |
| 286 | Ga0207664_10094704 | 3300025929 | Bacteria | 2455 |
| 287 | Ga0207644_10009468 | 3300025931 | Bacteria | 6397 |
| 288 | Ga0207690_10000689 | 3300025932 | Bacteria | 21712 |
| 289 | Ga0207690_10000793 | 3300025932 | Bacteria | 20362 |
| 290 | Ga0207690_10019317 | 3300025932 | Bacteria | 4194 |
| 291 | Ga0207670_10001642 | 3300025936 | Bacteria | 11672 |
| 292 | Ga0207704_10102029 | 3300025938 | Bacteria | 1915 |
| 293 | Ga0207711_10004901 | 3300025941 | Bacteria | 11362 |
| 294 | Ga0207661_10005487 | 3300025944 | Bacteria | 8946 |
| 295 | Ga0207661_10007193 | 3300025944 | Bacteria | 7908 |
| 296 | Ga0207661_10104260 | 3300025944 | Bacteria | 2387 |
| 297 | Ga0207679_10012988 | 3300025945 | Bacteria | 5449 |
| 298 | Ga0207667_10000130 | 3300025949 | Bacteria | 115321 |
| 299 | Ga0207667_10000169 | 3300025949 | Bacteria | 95977 |
| 300 | Ga0207667_10002427 | 3300025949 | Bacteria | 23337 |
| 301 | Ga0207667_10006312 | 3300025949 | Bacteria | 14377 |
| 302 | Ga0207667_10008956 | 3300025949 | Bacteria | 11838 |
| 303 | Ga0207667_10019459 | 3300025949 | Bacteria | 7579 |
| 304 | Ga0207667_10025291 | 3300025949 | Bacteria | 6501 |
| 305 | Ga0207667_10027857 | 3300025949 | Bacteria | 6143 |
| 306 | Ga0207667_10070830 | 3300025949 | Bacteria | 3628 |
| 307 | Ga0207712_10000972 | 3300025961 | Bacteria | 20638 |
| 308 | Ga0207640_10000144 | 3300025981 | Bacteria | 51999 |
| 309 | Ga0207640_10000939 | 3300025981 | Bacteria | 16269 |
| 310 | Ga0207640_10002085 | 3300025981 | Bacteria | 10766 |
| 311 | Ga0207640_10004146 | 3300025981 | Bacteria | 7833 |
| 312 | Ga0207640_10025104 | 3300025981 | Bacteria | 3603 |
| 313 | Ga0207640_10070526 | 3300025981 | Bacteria | 2351 |
| 314 | Ga0207640_10084219 | 3300025981 | Bacteria | 2183 |
| 315 | Ga0207658_10000050 | 3300025986 | Bacteria | 129714 |
| 316 | Ga0207658_10032798 | 3300025986 | Bacteria | 3700 |
| 317 | Ga0207658_10033246 | 3300025986 | Bacteria | 3678 |
| 318 | Ga0207639_10000601 | 3300026041 | Bacteria | 24806 |
| 319 | Ga0207639_10000690 | 3300026041 | Bacteria | 23246 |
| 320 | Ga0207639_10002797 | 3300026041 | Bacteria | 11719 |
| 321 | Ga0207639_10006067 | 3300026041 | Bacteria | 8202 |
| 322 | Ga0207639_10011089 | 3300026041 | Bacteria | 6251 |
| 323 | Ga0207639_10030268 | 3300026041 | Bacteria | 3969 |
| 324 | Ga0207678_10000916 | 3300026067 | Bacteria | 26995 |
| 325 | Ga0207678_10001375 | 3300026067 | Bacteria | 22403 |
| 326 | Ga0207678_10004494 | 3300026067 | Bacteria | 12538 |
| 327 | Ga0207678_10004831 | 3300026067 | Bacteria | 12098 |
| 328 | Ga0207678_10006700 | 3300026067 | Bacteria | 10215 |
| 329 | Ga0207678_10006710 | 3300026067 | Bacteria | 10210 |
| 330 | Ga0207678_10017667 | 3300026067 | Bacteria | 6262 |
| 331 | Ga0207678_10018220 | 3300026067 | Bacteria | 6167 |
| 332 | Ga0207678_10030490 | 3300026067 | Bacteria | 4707 |
| 333 | Ga0207678_10153390 | 3300026067 | Bacteria | 1967 |
| 334 | Ga0207702_10000384 | 3300026078 | Bacteria | 50456 |
| 335 | Ga0207702_10005697 | 3300026078 | Bacteria | 10861 |
| 336 | Ga0207702_10006665 | 3300026078 | Bacteria | 9930 |
| 337 | Ga0207702_10009006 | 3300026078 | Bacteria | 8404 |
| 338 | Ga0207702_10022182 | 3300026078 | Bacteria | 5262 |
| 339 | Ga0207702_10195859 | 3300026078 | Bacteria | 1870 |
| 340 | Ga0207641_10063680 | 3300026088 | Bacteria | 3150 |
| 341 | Ga0207674_10001362 | 3300026116 | Bacteria | 31632 |
| 342 | Ga0207674_10001719 | 3300026116 | Bacteria | 28008 |
| 343 | Ga0207674_10002346 | 3300026116 | Bacteria | 23934 |
| 344 | Ga0207674_10067093 | 3300026116 | Bacteria | 3612 |
| 345 | Ga0207674_10183884 | 3300026116 | Bacteria | 2040 |
| 346 | Ga0207698_10001087 | 3300026142 | Bacteria | 15802 |
| 347 | Ga0207698_10005570 | 3300026142 | Bacteria | 7787 |
| 348 | Ga0207698_10283241 | 3300026142 | Bacteria | 1534 |
| 349 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 350 | Ga0268266_10016237 | 3300028379 | Bacteria | 6365 |
| 351 | Ga0268265_10034462 | 3300028380 | Bacteria | 3691 |
| 352 | Ga0268264_10164805 | 3300028381 | Bacteria | 2000 |
| 353 | Ga0307412_10000773 | 3300031911 | Bacteria | 18455 |
| 354 | Ga0307510_10000577 | 3300033180 | Bacteria | 36999 |
| 355 | Ga0395899_0000460 | 3300037312 | Bacteria | 46114 |
| 356 | Ga0395899_0006509 | 3300037312 | Bacteria | 9050 |
| 357 | Ga0395899_0038376 | 3300037312 | Bacteria | 3587 |
| 358 | Ga0395900_0000051 | 3300037418 | Bacteria | 224228 |
| 359 | Ga0395900_0005345 | 3300037418 | Bacteria | 13457 |
| 360 | Ga0395900_0012146 | 3300037418 | Bacteria | 8800 |
| 361 | Ga0395900_0035069 | 3300037418 | Bacteria | 5167 |
| 362 | Ga0395898_0000034 | 3300037466 | Bacteria | 356745 |
| 363 | Ga0395898_0000363 | 3300037466 | Bacteria | 99698 |
| 364 | Ga0395901_0001129 | 3300038443 | Bacteria | 28299 |
| 365 | Ga0439436_0000011 | 3300041404 | Bacteria | 100668 |
| 366 | Ga0439465_0000292 | 3300041413 | Bacteria | 14130 |
| 367 | Ga0451793_0322512 | 3300041452 | Bacteria | 3437 |
| 368 | Ga0451793_1765168 | 3300041452 | Bacteria | 3064 |
| 369 | Ga0451802_1844544 | 3300041460 | Bacteria | 2647 |
| 370 | Ga0451807_1050170 | 3300041486 | Bacteria | 1917 |
| 371 | Ga0451853_0156874 | 3300041512 | Bacteria | 2950 |
| 372 | Ga0439448_0018831 | 3300042005 | Bacteria | 2120 |
| 373 | Ga0450908_000023 | 3300042184 | Bacteria | 36671 |
| 374 | Ga0466972_0027965 | 3300044658 | Bacteria | 2786 |
| 375 | Ga0466972_0028135 | 3300044658 | Bacteria | 2775 |
| 376 | Ga0466982_0000020 | 3300044672 | Bacteria | 99164 |
| 377 | Ga0466982_0000036 | 3300044672 | Bacteria | 43109 |
| 378 | Ga0466966_0045502 | 3300044684 | Bacteria | 2805 |
| 379 | Ga0466961_0003216 | 3300044693 | Bacteria | 10165 |
| 380 | Ga0466964_0007589 | 3300044706 | Bacteria | 4058 |
| 381 | Ga0466971_0006011 | 3300044719 | Bacteria | 5283 |
| 382 | Ga0466968_0001311 | 3300044735 | Bacteria | 8891 |
| 383 | Ga0466968_0005485 | 3300044735 | Bacteria | 4746 |
| 384 | Ga0466970_0001722 | 3300044765 | Bacteria | 10533 |
| 385 | Ga0466970_0015845 | 3300044765 | Bacteria | 3880 |
| 386 | Ga0466957_0001506 | 3300044842 | Bacteria | 12229 |
| 387 | Ga0466959_0001256 | 3300045049 | Bacteria | 15326 |
| 388 | Ga0466959_0014169 | 3300045049 | Bacteria | 5787 |
| 389 | Ga0466967_0130553 | 3300045976 | Bacteria | 2332 |
| 390 | Ga0495617_000921 | 3300046452 | Bacteria | 13691 |
| 391 | Ga0495590_0017038 | 3300046457 | Bacteria | 2620 |
| 392 | Ga0495638_0000069 | 3300046460 | Bacteria | 167503 |
| 393 | Ga0495638_0000078 | 3300046460 | Bacteria | 157545 |
| 394 | Ga0495638_0000166 | 3300046460 | Bacteria | 102926 |
| 395 | Ga0495638_0000516 | 3300046460 | Bacteria | 45213 |
| 396 | Ga0495638_0018029 | 3300046460 | Bacteria | 4697 |
| 397 | Ga0495650_0000220 | 3300046471 | Bacteria | 119197 |
| 398 | Ga0495650_0000452 | 3300046471 | Bacteria | 65082 |
| 399 | Ga0495650_0000686 | 3300046471 | Bacteria | 43752 |
| 400 | Ga0495584_0006849 | 3300046491 | Bacteria | 5956 |
| 401 | Ga0495585_0000080 | 3300046492 | Bacteria | 99617 |
| 402 | Ga0495585_0001139 | 3300046492 | Bacteria | 21767 |
| 403 | Ga0495607_0000144 | 3300046501 | Bacteria | 74813 |
| 404 | Ga0495607_0000954 | 3300046501 | Bacteria | 26747 |
| 405 | Ga0495607_0003306 | 3300046501 | Bacteria | 12380 |
| 406 | Ga0495583_0008258 | 3300046506 | Bacteria | 6384 |
| 407 | Ga0495606_0000050 | 3300046507 | Bacteria | 203375 |
| 408 | Ga0495606_0000227 | 3300046507 | Bacteria | 99782 |
| 409 | Ga0495606_0011999 | 3300046507 | Bacteria | 6997 |
| 410 | Ga0495610_0001128 | 3300046512 | Bacteria | 24366 |
| 411 | Ga0495616_0000036 | 3300046513 | Bacteria | 128264 |
| 412 | Ga0495616_0010735 | 3300046513 | Bacteria | 5283 |
| 413 | Ga0495631_0000017 | 3300046518 | Bacteria | 98047 |
| 414 | Ga0495631_0001740 | 3300046518 | Bacteria | 12930 |
| 415 | Ga0495632_0000004 | 3300046519 | Bacteria | 381372 |
| 416 | Ga0495632_0000786 | 3300046519 | Bacteria | 28264 |
| 417 | Ga0495632_0027855 | 3300046519 | Bacteria | 2954 |
| 418 | Ga0495648_0005309 | 3300046524 | Bacteria | 10747 |
| 419 | Ga0495648_0024157 | 3300046524 | Bacteria | 4148 |
| 420 | Ga0495609_0014457 | 3300046538 | Bacteria | 3708 |
| 421 | Ga0495668_0009877 | 3300046616 | Bacteria | 5821 |
| 422 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 423 | Ga0495611_0000022 | 3300046648 | Bacteria | 122452 |
| 424 | Ga0495625_0016987 | 3300046660 | Bacteria | 5706 |
| 425 | Ga0495661_0000657 | 3300046665 | Bacteria | 34630 |
| 426 | Ga0495670_0013676 | 3300046691 | Bacteria | 3991 |
| 427 | Ga0495649_0004268 | 3300046694 | Bacteria | 9375 |
| 428 | Ga0495589_0000053 | 3300046794 | Bacteria | 111458 |
| 429 | Ga0495660_0000233 | 3300046810 | Bacteria | 54493 |
| 430 | Ga0495679_000004 | 3300047446 | Bacteria | 748056 |
| 431 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 432 | Ga0495673_0000048 | 3300047469 | Bacteria | 265950 |
| 433 | Ga0495673_0000644 | 3300047469 | Bacteria | 34268 |
| 434 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 435 | Ga0495686_0000295 | 3300047472 | Bacteria | 86824 |
| 436 | Ga0495686_0003885 | 3300047472 | Bacteria | 12612 |
| 437 | Ga0495686_0026907 | 3300047472 | Bacteria | 3760 |
| 438 | Ga0495686_0040185 | 3300047472 | Bacteria | 2984 |
| 439 | Ga0496100_0004368 | 3300048903 | Bacteria | 7487 |
| 440 | Ga0496101_0005402 | 3300048904 | Bacteria | 8141 |
| 441 | Ga0496101_0103684 | 3300048904 | Bacteria | 2132 |
| 442 | Ga0496104_0276585 | 3300048907 | Bacteria | 1592 |
| 443 | Ga0496105_0006103 | 3300048908 | Bacteria | 9222 |
| 444 | Ga0496106_0010355 | 3300048909 | Bacteria | 6891 |
| 445 | Ga0496106_0172547 | 3300048909 | Bacteria | 1714 |
| 446 | Ga0496108_0050537 | 3300048911 | Bacteria | 3480 |
| 447 | Ga0496113_0006783 | 3300048916 | Bacteria | 7297 |
| 448 | Ga0496115_0000039 | 3300048918 | Bacteria | 124044 |
| 449 | Ga0496115_0000180 | 3300048918 | Bacteria | 59336 |
| 450 | Ga0496115_0008559 | 3300048918 | Bacteria | 7575 |
| 451 | Ga0496115_0022001 | 3300048918 | Bacteria | 4932 |
| 452 | Ga0496115_0034830 | 3300048918 | Bacteria | 3979 |
| 453 | Ga0496117_0005946 | 3300048920 | Bacteria | 12582 |
| 454 | Ga0496117_0021175 | 3300048920 | Bacteria | 5272 |
| 455 | Ga0496117_0024598 | 3300048920 | Bacteria | 4758 |
| 456 | Ga0496118_0000413 | 3300048921 | Bacteria | 71305 |
| 457 | Ga0496118_0000645 | 3300048921 | Bacteria | 57218 |
| 458 | Ga0496118_0000805 | 3300048921 | Bacteria | 50087 |
| 459 | Ga0496118_0008916 | 3300048921 | Bacteria | 10240 |
| 460 | Ga0496118_0011703 | 3300048921 | Bacteria | 8528 |
| 461 | Ga0496118_0012593 | 3300048921 | Bacteria | 8096 |
| 462 | Ga0496119_0000868 | 3300048922 | Bacteria | 39828 |
| 463 | Ga0496119_0008515 | 3300048922 | Bacteria | 8995 |
| 464 | Ga0496119_0026697 | 3300048922 | Bacteria | 3994 |
| 465 | Ga0496120_0001056 | 3300048923 | Bacteria | 36468 |
| 466 | Ga0496120_0001816 | 3300048923 | Bacteria | 23877 |
| 467 | Ga0496121_0000372 | 3300048924 | Bacteria | 92348 |
| 468 | Ga0496121_0001970 | 3300048924 | Bacteria | 32682 |
| 469 | Ga0496121_0004478 | 3300048924 | Bacteria | 18747 |
| 470 | Ga0496121_0013350 | 3300048924 | Bacteria | 8837 |
| 471 | Ga0496121_0022568 | 3300048924 | Bacteria | 6099 |
| 472 | Ga0496121_0024061 | 3300048924 | Bacteria | 5836 |
| 473 | Ga0496122_0003660 | 3300048925 | Bacteria | 19965 |
| 474 | Ga0496122_0027095 | 3300048925 | Bacteria | 4912 |
| 475 | Ga0496122_0075011 | 3300048925 | Bacteria | 2389 |
| 476 | Ga0496123_0002907 | 3300048926 | Bacteria | 20040 |
| 477 | Ga0496123_0016637 | 3300048926 | Bacteria | 5957 |
| 478 | Ga0496123_0026568 | 3300048926 | Bacteria | 4332 |
| 479 | Ga0496124_0000289 | 3300048927 | Bacteria | 95056 |
| 480 | Ga0496125_0000344 | 3300048928 | Bacteria | 88380 |
| 481 | Ga0496125_0010084 | 3300048928 | Bacteria | 9586 |
| 482 | Ga0496125_0022927 | 3300048928 | Bacteria | 5784 |
| 483 | Ga0496126_0009400 | 3300048929 | Bacteria | 10387 |
| 484 | Ga0496126_0017325 | 3300048929 | Bacteria | 7180 |
| 485 | Ga0496126_0023281 | 3300048929 | Bacteria | 6002 |
| 486 | Ga0496126_0026524 | 3300048929 | Bacteria | 5554 |
| 487 | Ga0496126_0036929 | 3300048929 | Bacteria | 4564 |
| 488 | Ga0495678_000276 | 3300049459 | Bacteria | 56670 |
| 489 | Ga0495682_0001190 | 3300049460 | Bacteria | 14806 |
| 490 | Ga0501031_0000386 | 3300049568 | Bacteria | 25889 |
| 491 | Ga0501031_0014850 | 3300049568 | Bacteria | 5061 |
| 492 | Ga0501032_0008566 | 3300049569 | Bacteria | 7457 |
| 493 | Ga0501033_0000238 | 3300049570 | Bacteria | 52874 |
| 494 | Ga0501033_0001455 | 3300049570 | Bacteria | 20987 |
| 495 | Ga0501033_0012400 | 3300049570 | Bacteria | 6505 |
| 496 | Ga0501033_0023636 | 3300049570 | Bacteria | 4635 |
| 497 | Ga0501033_0141135 | 3300049570 | Bacteria | 1741 |
| 498 | Ga0501034_0010160 | 3300049571 | Bacteria | 9821 |
| 499 | Ga0501034_0091388 | 3300049571 | Bacteria | 3041 |
| 500 | Ga0501036_0034507 | 3300049572 | Bacteria | 4279 |
| 501 | Ga0501037_0001617 | 3300049573 | Bacteria | 16362 |
| 502 | Ga0501037_0004498 | 3300049573 | Bacteria | 10135 |
| 503 | Ga0501037_0013086 | 3300049573 | Bacteria | 6117 |
| 504 | Ga0501037_0044700 | 3300049573 | Bacteria | 3252 |
| 505 | Ga0501037_0108977 | 3300049573 | Bacteria | 1996 |
| 506 | Ga0501037_0151966 | 3300049573 | Bacteria | 1654 |
| 507 | Ga0501038_0000102 | 3300049574 | Bacteria | 72409 |
| 508 | Ga0501038_0021857 | 3300049574 | Bacteria | 5737 |
| 509 | Ga0501038_0076890 | 3300049574 | Bacteria | 2819 |
| 510 | Ga0501038_0110282 | 3300049574 | Bacteria | 2280 |
| 511 | Ga0501038_0146823 | 3300049574 | Bacteria | 1925 |
| 512 | Ga0501038_0190116 | 3300049574 | Bacteria | 1652 |
| 513 | Ga0501039_0013117 | 3300049575 | Bacteria | 6336 |
| 514 | Ga0501039_0039581 | 3300049575 | Bacteria | 3640 |
| 515 | Ga0501039_0199689 | 3300049575 | Bacteria | 1572 |
| 516 | Ga0501042_0025452 | 3300049578 | Bacteria | 4157 |
| 517 | Ga0501043_0090751 | 3300049579 | Bacteria | 2402 |
| 518 | Ga0501043_0109102 | 3300049579 | Bacteria | 2173 |
| 519 | Ga0501043_0122673 | 3300049579 | Bacteria | 2038 |
| 520 | Ga0501046_0002342 | 3300049580 | Bacteria | 17858 |
| 521 | Ga0501046_0005065 | 3300049580 | Bacteria | 11814 |
| 522 | Ga0501046_0006985 | 3300049580 | Bacteria | 9944 |
| 523 | Ga0501047_0001387 | 3300049581 | Bacteria | 23760 |
| 524 | Ga0501047_0002444 | 3300049581 | Bacteria | 17736 |
| 525 | Ga0501047_0006853 | 3300049581 | Bacteria | 10706 |
| 526 | Ga0501047_0038457 | 3300049581 | Bacteria | 4629 |
| 527 | Ga0501047_0064041 | 3300049581 | Bacteria | 3547 |
| 528 | Ga0501047_0097471 | 3300049581 | Bacteria | 2818 |
| 529 | Ga0501047_0178231 | 3300049581 | Bacteria | 1992 |
| 530 | Ga0501047_0217607 | 3300049581 | Bacteria | 1767 |
| 531 | Ga0501047_0230405 | 3300049581 | Bacteria | 1706 |
| 532 | Ga0501048_0015772 | 3300049582 | Bacteria | 5576 |
| 533 | Ga0501048_0034651 | 3300049582 | Bacteria | 3640 |
| 534 | Ga0501048_0126060 | 3300049582 | Bacteria | 1810 |
| 535 | Ga0501069_0004418 | 3300049585 | Bacteria | 7261 |
| 536 | Ga0501069_0008197 | 3300049585 | Bacteria | 5487 |
| 537 | Ga0501069_0034028 | 3300049585 | Bacteria | 2807 |
| 538 | Ga0501069_0035806 | 3300049585 | Bacteria | 2735 |
| 539 | Ga0501070_0004912 | 3300049586 | Bacteria | 11416 |
| 540 | Ga0501070_0011269 | 3300049586 | Bacteria | 7552 |
| 541 | Ga0501070_0013787 | 3300049586 | Bacteria | 6807 |
| 542 | Ga0501070_0014708 | 3300049586 | Bacteria | 6583 |
| 543 | Ga0501070_0024306 | 3300049586 | Bacteria | 5081 |
| 544 | Ga0501070_0036419 | 3300049586 | Bacteria | 4108 |
| 545 | Ga0501070_0044037 | 3300049586 | Bacteria | 3714 |
| 546 | Ga0501070_0077685 | 3300049586 | Bacteria | 2747 |
| 547 | Ga0501071_0002502 | 3300049587 | Bacteria | 11180 |
| 548 | Ga0501071_0016751 | 3300049587 | Bacteria | 5041 |
| 549 | Ga0501072_0014581 | 3300049588 | Bacteria | 6023 |
| 550 | Ga0501073_0002707 | 3300049589 | Bacteria | 13269 |
| 551 | Ga0501073_0003684 | 3300049589 | Bacteria | 11502 |
| 552 | Ga0501073_0058417 | 3300049589 | Bacteria | 2695 |
| 553 | Ga0501073_0060276 | 3300049589 | Bacteria | 2648 |
| 554 | Ga0501074_0003853 | 3300049590 | Bacteria | 10679 |
| 555 | Ga0501074_0027420 | 3300049590 | Bacteria | 4130 |
| 556 | Ga0501074_0033587 | 3300049590 | Bacteria | 3718 |
| 557 | Ga0501074_0066901 | 3300049590 | Bacteria | 2584 |
| 558 | Ga0501077_0086504 | 3300049593 | Bacteria | 1987 |
| 559 | Ga0501079_0014047 | 3300049741 | Bacteria | 6105 |
| 560 | Ga0501080_0009969 | 3300049742 | Bacteria | 8683 |
| 561 | Ga0501080_0021387 | 3300049742 | Bacteria | 5988 |
| 562 | Ga0501080_0037362 | 3300049742 | Bacteria | 4535 |
| 563 | Ga0501080_0065677 | 3300049742 | Bacteria | 3375 |
| 564 | Ga0501080_0074806 | 3300049742 | Bacteria | 3151 |
| 565 | Ga0501083_0001689 | 3300049744 | Bacteria | 15046 |
| 566 | Ga0501035_0001523 | 3300049822 | Bacteria | 23664 |
| 567 | Ga0501035_0019597 | 3300049822 | Bacteria | 6215 |
| 568 | Ga0501035_0021435 | 3300049822 | Bacteria | 5940 |
| 569 | Ga0501035_0061562 | 3300049822 | Bacteria | 3340 |
| 570 | Ga0501035_0061783 | 3300049822 | Bacteria | 3333 |
| 571 | Ga0501035_0093654 | 3300049822 | Bacteria | 2643 |
| 572 | Ga0501044_0002052 | 3300049823 | Bacteria | 23242 |
| 573 | Ga0501044_0008967 | 3300049823 | Bacteria | 10937 |
| 574 | Ga0501044_0012187 | 3300049823 | Bacteria | 9308 |
| 575 | Ga0501044_0015321 | 3300049823 | Bacteria | 8257 |
| 576 | Ga0501044_0026174 | 3300049823 | Bacteria | 6177 |
| 577 | Ga0501044_0042412 | 3300049823 | Bacteria | 4732 |
| 578 | Ga0501044_0046404 | 3300049823 | Bacteria | 4498 |
| 579 | Ga0501044_0054069 | 3300049823 | Bacteria | 4129 |
| 580 | Ga0501044_0054456 | 3300049823 | Bacteria | 4111 |
| 581 | Ga0501044_0103064 | 3300049823 | Bacteria | 2868 |
| 582 | Ga0501044_0182554 | 3300049823 | Bacteria | 2064 |
| 583 | nmdc:mga00v17_554_c1 | 3300050491 | Bacteria | 20868 |
| 584 | Ga0500610_0002210 | 3300053079 | Bacteria | 7039 |
| 585 | Ga0500643_000888 | 3300053087 | Bacteria | 18939 |
| 586 | Ga0500597_000045 | 3300053120 | Bacteria | 23880 |
| 587 | Ga0500568_0000665 | 3300053139 | Bacteria | 24861 |
| 588 | Ga0500645_000391 | 3300053730 | Bacteria | 30650 |
| 589 | Ga0501084_0043300 | 3300054114 | Bacteria | 3766 |
| 590 | Ga0501084_0049115 | 3300054114 | Bacteria | 3532 |
| 591 | Ga0500661_004961 | 3300055283 | Bacteria | 2494 |
| 592 | Ga0501082_0001868 | 3300060353 | Bacteria | 18525 |
| 593 | Ga0501082_0038278 | 3300060353 | Bacteria | 4137 |
| 594 | Ga0466962_0004865 | 3300061719 | Bacteria | 6465 |
| 595 | Ga0466962_0005997 | 3300061719 | Bacteria | 5840 |
| 596 | Ga0466962_0031299 | 3300061719 | Bacteria | 2547 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009545 | Ga0105237_10000023 | Ga0105237_1000002385 | 414 |
| 2 | 3300049581 | Ga0501047_0217607 | Ga0501047_0217607_418_1737 | 416 |
| 3 | 3300001990 | JGI24737J22298_10010146 | JGI24737J22298_100101463 | 417 |
| 4 | 3300048909 | Ga0496106_0172547 | Ga0496106_0172547_10_1338 | 417 |
| 5 | 3300049573 | Ga0501037_0108977 | Ga0501037_0108977_697_1959 | 417 |
| 6 | 3300006051 | Ga0075364_10001321 | Ga0075364_1000132111 | 430 |
| 7 | 3300050491 | nmdc:mga00v17_554_c1 | nmdc:mga00v17_554_c1_556_1983 | 430 |
| 8 | 3300025936 | Ga0207670_10001642 | Ga0207670_1000164210 | 435 |
| 9 | iso_pu_bacteria | 2895498888 | 2895504054 | 441 |
| 10 | iso_pu_bacteria | 2895511927 | 2895515408 | 441 |
| 11 | iso_pu_bacteria | 2895522137 | 2895525081 | 441 |
| 12 | iso_pu_bacteria | 2895525241 | 2895527817 | 441 |
| 13 | iso_pu_bacteria | 2537561836 | 2538832712 | 442 |
| 14 | iso_pu_bacteria | 2593339238 | 2595446884 | 442 |
| 15 | iso_pu_bacteria | 2593339239 | 2595449647 | 442 |
| 16 | iso_pu_bacteria | 2643221562 | 2643830193 | 442 |
| 17 | iso_pu_bacteria | 2643221577 | 2643894762 | 442 |
| 18 | iso_pu_bacteria | 2643221685 | 2644476920 | 442 |
| 19 | iso_pu_bacteria | 2687453130 | 2687582996 | 442 |
| 20 | iso_pu_bacteria | 2734482264 | 2735833572 | 442 |
| 21 | iso_pu_bacteria | 2738543009 | 2739229700 | 442 |
| 22 | iso_pu_bacteria | 2739367700 | 2739730927 | 442 |
| 23 | iso_pu_bacteria | 2818991440 | 2819564038 | 442 |
| 24 | iso_pu_bacteria | 2842914999 | 2842917589 | 442 |
| 25 | iso_pu_bacteria | 2884411467 | 2884412377 | 442 |
| 26 | iso_pu_bacteria | 2895395659 | 2895398455 | 442 |
| 27 | iso_pu_bacteria | 2904463128 | 2904464674 | 442 |
| 28 | iso_pu_bacteria | 2919404418 | 2919406170 | 442 |
| 29 | iso_pu_bacteria | 2928963466 | 2928964004 | 442 |
| 30 | iso_pu_bacteria | 2939611941 | 2939614728 | 442 |
| 31 | iso_pu_bacteria | 2941471342 | 2941473007 | 442 |
| 32 | 3300048907 | Ga0496104_0276585 | Ga0496104_0276585_81_1505 | 444 |
| 33 | iso_pu_bacteria | 2884338543 | 2884341564 | 444 |
| 34 | 3300005547 | Ga0070693_100011824 | Ga0070693_1000118243 | 445 |
| 35 | 3300005547 | Ga0070693_100019975 | Ga0070693_1000199752 | 445 |
| 36 | 3300005563 | Ga0068855_100144867 | Ga0068855_1001448672 | 445 |
| 37 | 3300005614 | Ga0068856_100010189 | Ga0068856_1000101896 | 445 |
| 38 | 3300009093 | Ga0105240_10005795 | Ga0105240_1000579511 | 445 |
| 39 | 3300009545 | Ga0105237_10000250 | Ga0105237_1000025029 | 445 |
| 40 | 3300013105 | Ga0157369_10026321 | Ga0157369_100263215 | 445 |
| 41 | 3300022467 | Ga0224712_10017407 | Ga0224712_100174072 | 445 |
| 42 | 3300025250 | Ga0209026_1000234 | Ga0209026_100023443 | 445 |
| 43 | 3300025256 | Ga0209759_1016040 | Ga0209759_10160402 | 445 |
| 44 | 3300025272 | Ga0209455_1000922 | Ga0209455_10009227 | 445 |
| 45 | 3300025913 | Ga0207695_10001809 | Ga0207695_1000180921 | 445 |
| 46 | 3300025913 | Ga0207695_10004792 | Ga0207695_1000479211 | 445 |
| 47 | 3300025914 | Ga0207671_10000116 | Ga0207671_1000011613 | 445 |
| 48 | 3300025931 | Ga0207644_10009468 | Ga0207644_100094683 | 445 |
| 49 | 3300026067 | Ga0207678_10004494 | Ga0207678_100044945 | 445 |
| 50 | 3300026078 | Ga0207702_10000384 | Ga0207702_1000038450 | 445 |
| 51 | 3300048904 | Ga0496101_0103684 | Ga0496101_0103684_681_2108 | 445 |
| 52 | 3300048911 | Ga0496108_0050537 | Ga0496108_0050537_1754_3181 | 445 |
| 53 | 3300049568 | Ga0501031_0000386 | Ga0501031_0000386_24107_25534 | 445 |
| 54 | 3300049573 | Ga0501037_0001617 | Ga0501037_0001617_12470_13897 | 445 |
| 55 | 3300049574 | Ga0501038_0000102 | Ga0501038_0000102_35694_37121 | 445 |
| 56 | 3300049574 | Ga0501038_0076890 | Ga0501038_0076890_606_2033 | 445 |
| 57 | 3300049575 | Ga0501039_0013117 | Ga0501039_0013117_4316_5743 | 445 |
| 58 | 3300049580 | Ga0501046_0002342 | Ga0501046_0002342_5001_6428 | 445 |
| 59 | 3300049581 | Ga0501047_0001387 | Ga0501047_0001387_20528_21955 | 445 |
| 60 | 3300049582 | Ga0501048_0126060 | Ga0501048_0126060_309_1736 | 445 |
| 61 | 3300049589 | Ga0501073_0003684 | Ga0501073_0003684_715_2142 | 445 |
| 62 | 3300049742 | Ga0501080_0009969 | Ga0501080_0009969_6145_7572 | 445 |
| 63 | 3300049823 | Ga0501044_0002052 | Ga0501044_0002052_2746_4173 | 445 |
| 64 | 3300002067 | JGI24735J21928_10014002 | JGI24735J21928_100140022 | 446 |
| 65 | 3300002705 | JGI25156J39149_1004679 | JGI25156J39149_10046792 | 446 |
| 66 | 3300002705 | JGI25156J39149_1004804 | JGI25156J39149_10048042 | 446 |
| 67 | 3300002737 | JGI25162J39368_1000018 | JGI25162J39368_1000018232 | 446 |
| 68 | 3300002737 | JGI25162J39368_1000988 | JGI25162J39368_10009884 | 446 |
| 69 | 3300002737 | JGI25162J39368_1001244 | JGI25162J39368_10012444 | 446 |
| 70 | 3300002741 | JGI25157J39369_1000274 | JGI25157J39369_100027433 | 446 |
| 71 | 3300002741 | JGI25157J39369_1000749 | JGI25157J39369_10007493 | 446 |
| 72 | 3300002741 | JGI25157J39369_1000780 | JGI25157J39369_10007803 | 446 |
| 73 | 3300002741 | JGI25157J39369_1002943 | JGI25157J39369_10029431 | 446 |
| 74 | 3300002771 | JGI25163J39215_1000566 | JGI25163J39215_10005667 | 446 |
| 75 | 3300002772 | JGI25164J39214_1000007 | JGI25164J39214_1000007232 | 446 |
| 76 | 3300002772 | JGI25164J39214_1000372 | JGI25164J39214_10003722 | 446 |
| 77 | 3300002772 | JGI25164J39214_1000612 | JGI25164J39214_10006124 | 446 |
| 78 | 3300002772 | JGI25164J39214_1000635 | JGI25164J39214_10006359 | 446 |
| 79 | 3300003214 | JGI25165J46597_1000029 | JGI25165J46597_100002957 | 446 |
| 80 | 3300003214 | JGI25165J46597_1001233 | JGI25165J46597_10012339 | 446 |
| 81 | 3300003214 | JGI25165J46597_1001700 | JGI25165J46597_10017007 | 446 |
| 82 | 3300003214 | JGI25165J46597_1002214 | JGI25165J46597_10022144 | 446 |
| 83 | 3300003215 | JGI25153J46596_10026221 | JGI25153J46596_100262211 | 446 |
| 84 | 3300003320 | rootH2_10016448 | rootH2_100164485 | 446 |
| 85 | 3300003578 | Ga0006562J51391_1059408 | Ga0006562J51391_10594081 | 446 |
| 86 | 3300003578 | Ga0006562J51391_1086826 | Ga0006562J51391_10868262 | 446 |
| 87 | 3300003752 | Ga0055539_1001371 | Ga0055539_10013714 | 446 |
| 88 | 3300003759 | Ga0055525_1000211 | Ga0055525_100021138 | 446 |
| 89 | 3300003760 | Ga0055527_1000257 | Ga0055527_10002578 | 446 |
| 90 | 3300003760 | Ga0055527_1000263 | Ga0055527_10002637 | 446 |
| 91 | 3300003760 | Ga0055527_1002299 | Ga0055527_10022992 | 446 |
| 92 | 3300003761 | Ga0055535_1000103 | Ga0055535_100010362 | 446 |
| 93 | 3300003761 | Ga0055535_1000541 | Ga0055535_100054121 | 446 |
| 94 | 3300003761 | Ga0055535_1000679 | Ga0055535_100067917 | 446 |
| 95 | 3300003761 | Ga0055535_1003025 | Ga0055535_10030253 | 446 |
| 96 | 3300003762 | Ga0055542_1000024 | Ga0055542_1000024232 | 446 |
| 97 | 3300003762 | Ga0055542_1000222 | Ga0055542_100022221 | 446 |
| 98 | 3300003762 | Ga0055542_1000476 | Ga0055542_10004763 | 446 |
| 99 | 3300003762 | Ga0055542_1000567 | Ga0055542_100056721 | 446 |
| 100 | 3300003762 | Ga0055542_1000578 | Ga0055542_10005787 | 446 |
| 101 | 3300003762 | Ga0055542_1000584 | Ga0055542_10005848 | 446 |
| 102 | 3300003763 | Ga0055529_1000029 | Ga0055529_1000029232 | 446 |
| 103 | 3300003763 | Ga0055529_1000110 | Ga0055529_100011096 | 446 |
| 104 | 3300003763 | Ga0055529_1000426 | Ga0055529_100042620 | 446 |
| 105 | 3300003763 | Ga0055529_1000538 | Ga0055529_100053821 | 446 |
| 106 | 3300005262 | Ga0065165_1000157 | Ga0065165_100015739 | 446 |
| 107 | 3300005262 | Ga0065165_1008011 | Ga0065165_10080113 | 446 |
| 108 | 3300005327 | Ga0070658_10001514 | Ga0070658_1000151413 | 446 |
| 109 | 3300005335 | Ga0070666_10000003 | Ga0070666_10000003407 | 446 |
| 110 | 3300005336 | Ga0070680_100040055 | Ga0070680_1000400551 | 446 |
| 111 | 3300005337 | Ga0070682_100052049 | Ga0070682_1000520492 | 446 |
| 112 | 3300005339 | Ga0070660_100072406 | Ga0070660_1000724062 | 446 |
| 113 | 3300005340 | Ga0070689_100001746 | Ga0070689_1000017464 | 446 |
| 114 | 3300005344 | Ga0070661_100130420 | Ga0070661_1001304201 | 446 |
| 115 | 3300005366 | Ga0070659_100130940 | Ga0070659_1001309401 | 446 |
| 116 | 3300005367 | Ga0070667_100000125 | Ga0070667_10000012562 | 446 |
| 117 | 3300005367 | Ga0070667_100035235 | Ga0070667_1000352353 | 446 |
| 118 | 3300005435 | Ga0070714_100099976 | Ga0070714_1000999762 | 446 |
| 119 | 3300005455 | Ga0070663_100000058 | Ga0070663_1000000589 | 446 |
| 120 | 3300005455 | Ga0070663_100074034 | Ga0070663_1000740342 | 446 |
| 121 | 3300005455 | Ga0070663_100130511 | Ga0070663_1001305111 | 446 |
| 122 | 3300005466 | Ga0070685_10016080 | Ga0070685_100160802 | 446 |
| 123 | 3300005530 | Ga0070679_100064911 | Ga0070679_1000649113 | 446 |
| 124 | 3300005539 | Ga0068853_100001149 | Ga0068853_1000011499 | 446 |
| 125 | 3300005539 | Ga0068853_100029539 | Ga0068853_1000295394 | 446 |
| 126 | 3300005539 | Ga0068853_100041196 | Ga0068853_1000411962 | 446 |
| 127 | 3300005546 | Ga0070696_100007708 | Ga0070696_1000077083 | 446 |
| 128 | 3300005546 | Ga0070696_100062880 | Ga0070696_1000628802 | 446 |
| 129 | 3300005548 | Ga0070665_100009457 | Ga0070665_1000094572 | 446 |
| 130 | 3300005548 | Ga0070665_100011171 | Ga0070665_1000111715 | 446 |
| 131 | 3300005548 | Ga0070665_100062035 | Ga0070665_1000620352 | 446 |
| 132 | 3300005563 | Ga0068855_100004282 | Ga0068855_10000428215 | 446 |
| 133 | 3300005563 | Ga0068855_100040293 | Ga0068855_1000402933 | 446 |
| 134 | 3300005563 | Ga0068855_100254637 | Ga0068855_1002546372 | 446 |
| 135 | 3300005564 | Ga0070664_100018499 | Ga0070664_1000184996 | 446 |
| 136 | 3300005577 | Ga0068857_100009902 | Ga0068857_1000099026 | 446 |
| 137 | 3300005578 | Ga0068854_100001291 | Ga0068854_10000129111 | 446 |
| 138 | 3300005578 | Ga0068854_100004749 | Ga0068854_1000047493 | 446 |
| 139 | 3300005578 | Ga0068854_100040288 | Ga0068854_1000402883 | 446 |
| 140 | 3300005614 | Ga0068856_100054927 | Ga0068856_1000549274 | 446 |
| 141 | 3300005834 | Ga0068851_10018070 | Ga0068851_100180703 | 446 |
| 142 | 3300005842 | Ga0068858_100125991 | Ga0068858_1001259912 | 446 |
| 143 | 3300005983 | Ga0081540_1002730 | Ga0081540_10027302 | 446 |
| 144 | 3300006186 | Ga0075369_10013197 | Ga0075369_100131972 | 446 |
| 145 | 3300006237 | Ga0097621_100070341 | Ga0097621_1000703414 | 446 |
| 146 | 3300009093 | Ga0105240_10000127 | Ga0105240_100001271 | 446 |
| 147 | 3300009093 | Ga0105240_10045390 | Ga0105240_100453902 | 446 |
| 148 | 3300009093 | Ga0105240_10118550 | Ga0105240_101185503 | 446 |
| 149 | 3300009093 | Ga0105240_10152464 | Ga0105240_101524642 | 446 |
| 150 | 3300009101 | Ga0105247_10018803 | Ga0105247_100188032 | 446 |
| 151 | 3300009177 | Ga0105248_10004329 | Ga0105248_100043297 | 446 |
| 152 | 3300009551 | Ga0105238_10000702 | Ga0105238_1000070212 | 446 |
| 153 | 3300010375 | Ga0105239_10000933 | Ga0105239_100009331 | 446 |
| 154 | 3300010375 | Ga0105239_10025206 | Ga0105239_100252067 | 446 |
| 155 | 3300010375 | Ga0105239_10030681 | Ga0105239_100306813 | 446 |
| 156 | 3300010375 | Ga0105239_10259470 | Ga0105239_102594701 | 446 |
| 157 | 3300013105 | Ga0157369_10000080 | Ga0157369_1000008041 | 446 |
| 158 | 3300013296 | Ga0157374_10152766 | Ga0157374_101527662 | 446 |
| 159 | 3300013307 | Ga0157372_10018077 | Ga0157372_100180775 | 446 |
| 160 | 3300013307 | Ga0157372_10035474 | Ga0157372_100354744 | 446 |
| 161 | 3300013307 | Ga0157372_10051509 | Ga0157372_100515092 | 446 |
| 162 | 3300015261 | Ga0182006_1000140 | Ga0182006_100014018 | 446 |
| 163 | 3300015261 | Ga0182006_1000222 | Ga0182006_100022237 | 446 |
| 164 | 3300015685 | Ga0183369_1012 | Ga0183369_101282 | 446 |
| 165 | 3300015687 | Ga0183368_1004 | Ga0183368_1004400 | 446 |
| 166 | 3300025207 | Ga0209760_100349 | Ga0209760_1003499 | 446 |
| 167 | 3300025224 | Ga0209784_100026 | Ga0209784_100026214 | 446 |
| 168 | 3300025226 | Ga0209674_100016 | Ga0209674_100016232 | 446 |
| 169 | 3300025226 | Ga0209674_100108 | Ga0209674_10010844 | 446 |
| 170 | 3300025226 | Ga0209674_100473 | Ga0209674_1004736 | 446 |
| 171 | 3300025226 | Ga0209674_101452 | Ga0209674_1014524 | 446 |
| 172 | 3300025226 | Ga0209674_101601 | Ga0209674_1016015 | 446 |
| 173 | 3300025228 | Ga0209672_100007 | Ga0209672_100007310 | 446 |
| 174 | 3300025228 | Ga0209672_100009 | Ga0209672_10000934 | 446 |
| 175 | 3300025228 | Ga0209672_100106 | Ga0209672_10010621 | 446 |
| 176 | 3300025228 | Ga0209672_100268 | Ga0209672_10026816 | 446 |
| 177 | 3300025228 | Ga0209672_100863 | Ga0209672_10086311 | 446 |
| 178 | 3300025230 | Ga0209563_100079 | Ga0209563_100079176 | 446 |
| 179 | 3300025231 | Ga0207427_100023 | Ga0207427_100023214 | 446 |
| 180 | 3300025231 | Ga0207427_100105 | Ga0207427_10010556 | 446 |
| 181 | 3300025231 | Ga0207427_100107 | Ga0207427_10010746 | 446 |
| 182 | 3300025231 | Ga0207427_100261 | Ga0207427_1002611 | 446 |
| 183 | 3300025231 | Ga0207427_104067 | Ga0207427_1040672 | 446 |
| 184 | 3300025233 | Ga0209437_100039 | Ga0209437_10003967 | 446 |
| 185 | 3300025233 | Ga0209437_100069 | Ga0209437_10006948 | 446 |
| 186 | 3300025233 | Ga0209437_100129 | Ga0209437_100129120 | 446 |
| 187 | 3300025233 | Ga0209437_100252 | Ga0209437_10025233 | 446 |
| 188 | 3300025233 | Ga0209437_100563 | Ga0209437_1005632 | 446 |
| 189 | 3300025242 | Ga0209258_100011 | Ga0209258_100011608 | 446 |
| 190 | 3300025242 | Ga0209258_100046 | Ga0209258_10004627 | 446 |
| 191 | 3300025242 | Ga0209258_100059 | Ga0209258_100059214 | 446 |
| 192 | 3300025242 | Ga0209258_100155 | Ga0209258_100155135 | 446 |
| 193 | 3300025242 | Ga0209258_100511 | Ga0209258_1005113 | 446 |
| 194 | 3300025242 | Ga0209258_101052 | Ga0209258_1010526 | 446 |
| 195 | 3300025246 | Ga0209646_1000392 | Ga0209646_100039223 | 446 |
| 196 | 3300025250 | Ga0209026_1000036 | Ga0209026_100003639 | 446 |
| 197 | 3300025250 | Ga0209026_1000051 | Ga0209026_100005150 | 446 |
| 198 | 3300025250 | Ga0209026_1000194 | Ga0209026_10001948 | 446 |
| 199 | 3300025250 | Ga0209026_1000635 | Ga0209026_100063518 | 446 |
| 200 | 3300025250 | Ga0209026_1003202 | Ga0209026_10032023 | 446 |
| 201 | 3300025254 | Ga0209148_1000002 | Ga0209148_10000022117 | 446 |
| 202 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010213 | 446 |
| 203 | 3300025254 | Ga0209148_1000013 | Ga0209148_1000013608 | 446 |
| 204 | 3300025254 | Ga0209148_1000084 | Ga0209148_1000084103 | 446 |
| 205 | 3300025254 | Ga0209148_1000220 | Ga0209148_100022021 | 446 |
| 206 | 3300025254 | Ga0209148_1000533 | Ga0209148_100053332 | 446 |
| 207 | 3300025254 | Ga0209148_1003283 | Ga0209148_10032834 | 446 |
| 208 | 3300025256 | Ga0209759_1000300 | Ga0209759_100030017 | 446 |
| 209 | 3300025256 | Ga0209759_1000442 | Ga0209759_100044240 | 446 |
| 210 | 3300025256 | Ga0209759_1000901 | Ga0209759_10009017 | 446 |
| 211 | 3300025256 | Ga0209759_1002380 | Ga0209759_10023803 | 446 |
| 212 | 3300025258 | Ga0209129_1004409 | Ga0209129_10044093 | 446 |
| 213 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009958 | 446 |
| 214 | 3300025261 | Ga0209233_1000224 | Ga0209233_100022446 | 446 |
| 215 | 3300025261 | Ga0209233_1000227 | Ga0209233_100022732 | 446 |
| 216 | 3300025261 | Ga0209233_1000300 | Ga0209233_100030035 | 446 |
| 217 | 3300025261 | Ga0209233_1000364 | Ga0209233_10003641 | 446 |
| 218 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010310 | 446 |
| 219 | 3300025272 | Ga0209455_1000012 | Ga0209455_1000012608 | 446 |
| 220 | 3300025272 | Ga0209455_1000020 | Ga0209455_1000020390 | 446 |
| 221 | 3300025272 | Ga0209455_1000077 | Ga0209455_100007721 | 446 |
| 222 | 3300025272 | Ga0209455_1006643 | Ga0209455_10066433 | 446 |
| 223 | 3300025297 | Ga0209758_1002866 | Ga0209758_10028662 | 446 |
| 224 | 3300025297 | Ga0209758_1014061 | Ga0209758_10140613 | 446 |
| 225 | 3300025302 | Ga0207426_1003878 | Ga0207426_10038787 | 446 |
| 226 | 3300025903 | Ga0207680_10000006 | Ga0207680_10000006553 | 446 |
| 227 | 3300025904 | Ga0207647_10000099 | Ga0207647_100000996 | 446 |
| 228 | 3300025904 | Ga0207647_10031625 | Ga0207647_100316252 | 446 |
| 229 | 3300025909 | Ga0207705_10003215 | Ga0207705_100032156 | 446 |
| 230 | 3300025913 | Ga0207695_10000907 | Ga0207695_1000090723 | 446 |
| 231 | 3300025913 | Ga0207695_10006439 | Ga0207695_100064391 | 446 |
| 232 | 3300025913 | Ga0207695_10116716 | Ga0207695_101167162 | 446 |
| 233 | 3300025913 | Ga0207695_10192414 | Ga0207695_101924142 | 446 |
| 234 | 3300025914 | Ga0207671_10000020 | Ga0207671_10000020150 | 446 |
| 235 | 3300025914 | Ga0207671_10000033 | Ga0207671_10000033105 | 446 |
| 236 | 3300025914 | Ga0207671_10009215 | Ga0207671_100092158 | 446 |
| 237 | 3300025915 | Ga0207693_10041506 | Ga0207693_100415063 | 446 |
| 238 | 3300025916 | Ga0207663_10101291 | Ga0207663_101012911 | 446 |
| 239 | 3300025919 | Ga0207657_10073111 | Ga0207657_100731112 | 446 |
| 240 | 3300025924 | Ga0207694_10001036 | Ga0207694_1000103617 | 446 |
| 241 | 3300025929 | Ga0207664_10094704 | Ga0207664_100947042 | 446 |
| 242 | 3300025932 | Ga0207690_10019317 | Ga0207690_100193172 | 446 |
| 243 | 3300025938 | Ga0207704_10102029 | Ga0207704_101020291 | 446 |
| 244 | 3300025941 | Ga0207711_10004901 | Ga0207711_100049017 | 446 |
| 245 | 3300025949 | Ga0207667_10000130 | Ga0207667_1000013038 | 446 |
| 246 | 3300025949 | Ga0207667_10000169 | Ga0207667_1000016956 | 446 |
| 247 | 3300025949 | Ga0207667_10019459 | Ga0207667_100194595 | 446 |
| 248 | 3300025961 | Ga0207712_10000972 | Ga0207712_100009726 | 446 |
| 249 | 3300025981 | Ga0207640_10000144 | Ga0207640_1000014416 | 446 |
| 250 | 3300025981 | Ga0207640_10070526 | Ga0207640_100705262 | 446 |
| 251 | 3300025981 | Ga0207640_10084219 | Ga0207640_100842192 | 446 |
| 252 | 3300025986 | Ga0207658_10000050 | Ga0207658_1000005065 | 446 |
| 253 | 3300025986 | Ga0207658_10032798 | Ga0207658_100327982 | 446 |
| 254 | 3300025986 | Ga0207658_10033246 | Ga0207658_100332462 | 446 |
| 255 | 3300026041 | Ga0207639_10000690 | Ga0207639_100006904 | 446 |
| 256 | 3300026041 | Ga0207639_10002797 | Ga0207639_100027972 | 446 |
| 257 | 3300026041 | Ga0207639_10011089 | Ga0207639_100110892 | 446 |
| 258 | 3300026067 | Ga0207678_10004831 | Ga0207678_100048313 | 446 |
| 259 | 3300026067 | Ga0207678_10017667 | Ga0207678_100176676 | 446 |
| 260 | 3300026067 | Ga0207678_10153390 | Ga0207678_101533902 | 446 |
| 261 | 3300026078 | Ga0207702_10005697 | Ga0207702_100056977 | 446 |
| 262 | 3300026078 | Ga0207702_10195859 | Ga0207702_101958592 | 446 |
| 263 | 3300026088 | Ga0207641_10063680 | Ga0207641_100636802 | 446 |
| 264 | 3300026116 | Ga0207674_10001719 | Ga0207674_100017199 | 446 |
| 265 | 3300026116 | Ga0207674_10067093 | Ga0207674_100670933 | 446 |
| 266 | 3300026142 | Ga0207698_10283241 | Ga0207698_102832411 | 446 |
| 267 | 3300028379 | Ga0268266_10000021 | Ga0268266_10000021258 | 446 |
| 268 | 3300028379 | Ga0268266_10016237 | Ga0268266_100162373 | 446 |
| 269 | 3300028380 | Ga0268265_10034462 | Ga0268265_100344622 | 446 |
| 270 | 3300028381 | Ga0268264_10164805 | Ga0268264_101648051 | 446 |
| 271 | 3300031911 | Ga0307412_10000773 | Ga0307412_100007736 | 446 |
| 272 | 3300033180 | Ga0307510_10000577 | Ga0307510_1000057728 | 446 |
| 273 | 3300037312 | Ga0395899_0000460 | Ga0395899_0000460_13081_14511 | 446 |
| 274 | 3300037312 | Ga0395899_0006509 | Ga0395899_0006509_6731_8164 | 446 |
| 275 | 3300037312 | Ga0395899_0038376 | Ga0395899_0038376_373_1806 | 446 |
| 276 | 3300037418 | Ga0395900_0005345 | Ga0395900_0005345_9542_10975 | 446 |
| 277 | 3300037466 | Ga0395898_0000034 | Ga0395898_0000034_340336_341766 | 446 |
| 278 | 3300041452 | Ga0451793_0322512 | Ga0451793_0322512_386_1828 | 446 |
| 279 | 3300041452 | Ga0451793_1765168 | Ga0451793_1765168_1119_2627 | 446 |
| 280 | 3300041460 | Ga0451802_1844544 | Ga0451802_1844544_56_1486 | 446 |
| 281 | 3300041512 | Ga0451853_0156874 | Ga0451853_0156874_108_1550 | 446 |
| 282 | 3300042005 | Ga0439448_0018831 | Ga0439448_0018831_453_1883 | 446 |
| 283 | 3300042184 | Ga0450908_000023 | Ga0450908_000023_20406_21839 | 446 |
| 284 | 3300044658 | Ga0466972_0027965 | Ga0466972_0027965_118_1548 | 446 |
| 285 | 3300044672 | Ga0466982_0000020 | Ga0466982_0000020_2500_3930 | 446 |
| 286 | 3300044684 | Ga0466966_0045502 | Ga0466966_0045502_138_1568 | 446 |
| 287 | 3300044693 | Ga0466961_0003216 | Ga0466961_0003216_6900_8330 | 446 |
| 288 | 3300044706 | Ga0466964_0007589 | Ga0466964_0007589_110_1540 | 446 |
| 289 | 3300044719 | Ga0466971_0006011 | Ga0466971_0006011_2065_3495 | 446 |
| 290 | 3300044735 | Ga0466968_0001311 | Ga0466968_0001311_6933_8363 | 446 |
| 291 | 3300044765 | Ga0466970_0001722 | Ga0466970_0001722_3587_5017 | 446 |
| 292 | 3300044765 | Ga0466970_0015845 | Ga0466970_0015845_557_1987 | 446 |
| 293 | 3300044842 | Ga0466957_0001506 | Ga0466957_0001506_9342_10772 | 446 |
| 294 | 3300045049 | Ga0466959_0001256 | Ga0466959_0001256_6041_7471 | 446 |
| 295 | 3300045049 | Ga0466959_0014169 | Ga0466959_0014169_431_1861 | 446 |
| 296 | 3300045976 | Ga0466967_0130553 | Ga0466967_0130553_177_1607 | 446 |
| 297 | 3300046452 | Ga0495617_000921 | Ga0495617_000921_1480_2910 | 446 |
| 298 | 3300046457 | Ga0495590_0017038 | Ga0495590_0017038_580_2010 | 446 |
| 299 | 3300046460 | Ga0495638_0000078 | Ga0495638_0000078_146999_148429 | 446 |
| 300 | 3300046460 | Ga0495638_0000166 | Ga0495638_0000166_22333_23763 | 446 |
| 301 | 3300046460 | Ga0495638_0000516 | Ga0495638_0000516_24795_26225 | 446 |
| 302 | 3300046460 | Ga0495638_0018029 | Ga0495638_0018029_2083_3513 | 446 |
| 303 | 3300046471 | Ga0495650_0000220 | Ga0495650_0000220_77272_78702 | 446 |
| 304 | 3300046471 | Ga0495650_0000686 | Ga0495650_0000686_28165_29595 | 446 |
| 305 | 3300046491 | Ga0495584_0006849 | Ga0495584_0006849_807_2237 | 446 |
| 306 | 3300046492 | Ga0495585_0000080 | Ga0495585_0000080_29391_30821 | 446 |
| 307 | 3300046492 | Ga0495585_0001139 | Ga0495585_0001139_1802_3232 | 446 |
| 308 | 3300046501 | Ga0495607_0000144 | Ga0495607_0000144_64931_66361 | 446 |
| 309 | 3300046501 | Ga0495607_0000954 | Ga0495607_0000954_15950_17380 | 446 |
| 310 | 3300046501 | Ga0495607_0003306 | Ga0495607_0003306_9392_10822 | 446 |
| 311 | 3300046506 | Ga0495583_0008258 | Ga0495583_0008258_1845_3275 | 446 |
| 312 | 3300046507 | Ga0495606_0000050 | Ga0495606_0000050_62879_64309 | 446 |
| 313 | 3300046507 | Ga0495606_0000227 | Ga0495606_0000227_28434_29864 | 446 |
| 314 | 3300046507 | Ga0495606_0011999 | Ga0495606_0011999_5338_6768 | 446 |
| 315 | 3300046512 | Ga0495610_0001128 | Ga0495610_0001128_4038_5468 | 446 |
| 316 | 3300046513 | Ga0495616_0000036 | Ga0495616_0000036_66344_67774 | 446 |
| 317 | 3300046513 | Ga0495616_0010735 | Ga0495616_0010735_1177_2607 | 446 |
| 318 | 3300046518 | Ga0495631_0000017 | Ga0495631_0000017_63607_65037 | 446 |
| 319 | 3300046518 | Ga0495631_0001740 | Ga0495631_0001740_8309_9739 | 446 |
| 320 | 3300046519 | Ga0495632_0000004 | Ga0495632_0000004_69064_70494 | 446 |
| 321 | 3300046519 | Ga0495632_0000786 | Ga0495632_0000786_8507_9937 | 446 |
| 322 | 3300046519 | Ga0495632_0027855 | Ga0495632_0027855_119_1549 | 446 |
| 323 | 3300046524 | Ga0495648_0005309 | Ga0495648_0005309_8752_10182 | 446 |
| 324 | 3300046524 | Ga0495648_0024157 | Ga0495648_0024157_300_1730 | 446 |
| 325 | 3300046538 | Ga0495609_0014457 | Ga0495609_0014457_1137_2567 | 446 |
| 326 | 3300046616 | Ga0495668_0009877 | Ga0495668_0009877_3660_5090 | 446 |
| 327 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_2258057_2259487 | 446 |
| 328 | 3300046648 | Ga0495611_0000022 | Ga0495611_0000022_58686_60116 | 446 |
| 329 | 3300046660 | Ga0495625_0016987 | Ga0495625_0016987_1399_2829 | 446 |
| 330 | 3300046665 | Ga0495661_0000657 | Ga0495661_0000657_24693_26123 | 446 |
| 331 | 3300046691 | Ga0495670_0013676 | Ga0495670_0013676_2073_3503 | 446 |
| 332 | 3300046694 | Ga0495649_0004268 | Ga0495649_0004268_5363_6793 | 446 |
| 333 | 3300046794 | Ga0495589_0000053 | Ga0495589_0000053_36602_38032 | 446 |
| 334 | 3300046810 | Ga0495660_0000233 | Ga0495660_0000233_25780_27210 | 446 |
| 335 | 3300047446 | Ga0495679_000004 | Ga0495679_000004_368829_370259 | 446 |
| 336 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_208024_209454 | 446 |
| 337 | 3300047469 | Ga0495673_0000048 | Ga0495673_0000048_170731_172161 | 446 |
| 338 | 3300047469 | Ga0495673_0000644 | Ga0495673_0000644_8840_10270 | 446 |
| 339 | 3300047472 | Ga0495686_0000295 | Ga0495686_0000295_51228_52658 | 446 |
| 340 | 3300047472 | Ga0495686_0026907 | Ga0495686_0026907_167_1597 | 446 |
| 341 | 3300047472 | Ga0495686_0040185 | Ga0495686_0040185_108_1538 | 446 |
| 342 | 3300048908 | Ga0496105_0006103 | Ga0496105_0006103_1027_2457 | 446 |
| 343 | 3300048909 | Ga0496106_0010355 | Ga0496106_0010355_3958_5388 | 446 |
| 344 | 3300048916 | Ga0496113_0006783 | Ga0496113_0006783_4830_6260 | 446 |
| 345 | 3300048918 | Ga0496115_0000039 | Ga0496115_0000039_43463_44893 | 446 |
| 346 | 3300048918 | Ga0496115_0000180 | Ga0496115_0000180_37475_38905 | 446 |
| 347 | 3300048918 | Ga0496115_0008559 | Ga0496115_0008559_1757_3187 | 446 |
| 348 | 3300048918 | Ga0496115_0022001 | Ga0496115_0022001_488_1918 | 446 |
| 349 | 3300048918 | Ga0496115_0034830 | Ga0496115_0034830_2018_3448 | 446 |
| 350 | 3300048920 | Ga0496117_0005946 | Ga0496117_0005946_5741_7171 | 446 |
| 351 | 3300048920 | Ga0496117_0021175 | Ga0496117_0021175_1770_3200 | 446 |
| 352 | 3300048920 | Ga0496117_0024598 | Ga0496117_0024598_2880_4310 | 446 |
| 353 | 3300048921 | Ga0496118_0000413 | Ga0496118_0000413_13325_14755 | 446 |
| 354 | 3300048921 | Ga0496118_0000805 | Ga0496118_0000805_27776_29206 | 446 |
| 355 | 3300048921 | Ga0496118_0008916 | Ga0496118_0008916_2088_3518 | 446 |
| 356 | 3300048921 | Ga0496118_0012593 | Ga0496118_0012593_4889_6319 | 446 |
| 357 | 3300048922 | Ga0496119_0000868 | Ga0496119_0000868_31636_33066 | 446 |
| 358 | 3300048922 | Ga0496119_0008515 | Ga0496119_0008515_7440_8870 | 446 |
| 359 | 3300048922 | Ga0496119_0026697 | Ga0496119_0026697_189_1619 | 446 |
| 360 | 3300048923 | Ga0496120_0001056 | Ga0496120_0001056_151_1581 | 446 |
| 361 | 3300048923 | Ga0496120_0001816 | Ga0496120_0001816_17755_19185 | 446 |
| 362 | 3300048924 | Ga0496121_0000372 | Ga0496121_0000372_41159_42589 | 446 |
| 363 | 3300048924 | Ga0496121_0001970 | Ga0496121_0001970_10805_12235 | 446 |
| 364 | 3300048924 | Ga0496121_0004478 | Ga0496121_0004478_4768_6198 | 446 |
| 365 | 3300048924 | Ga0496121_0013350 | Ga0496121_0013350_3622_5052 | 446 |
| 366 | 3300048924 | Ga0496121_0022568 | Ga0496121_0022568_1545_2975 | 446 |
| 367 | 3300048925 | Ga0496122_0027095 | Ga0496122_0027095_2054_3484 | 446 |
| 368 | 3300048925 | Ga0496122_0075011 | Ga0496122_0075011_853_2283 | 446 |
| 369 | 3300048926 | Ga0496123_0016637 | Ga0496123_0016637_1324_2754 | 446 |
| 370 | 3300048926 | Ga0496123_0026568 | Ga0496123_0026568_2053_3483 | 446 |
| 371 | 3300048927 | Ga0496124_0000289 | Ga0496124_0000289_19638_21068 | 446 |
| 372 | 3300048928 | Ga0496125_0000344 | Ga0496125_0000344_2358_3788 | 446 |
| 373 | 3300048928 | Ga0496125_0010084 | Ga0496125_0010084_16_1446 | 446 |
| 374 | 3300048928 | Ga0496125_0022927 | Ga0496125_0022927_890_2341 | 446 |
| 375 | 3300048929 | Ga0496126_0009400 | Ga0496126_0009400_2204_3634 | 446 |
| 376 | 3300048929 | Ga0496126_0017325 | Ga0496126_0017325_1481_2911 | 446 |
| 377 | 3300048929 | Ga0496126_0023281 | Ga0496126_0023281_1635_3065 | 446 |
| 378 | 3300048929 | Ga0496126_0026524 | Ga0496126_0026524_1330_2760 | 446 |
| 379 | 3300048929 | Ga0496126_0036929 | Ga0496126_0036929_1678_3129 | 446 |
| 380 | 3300049459 | Ga0495678_000276 | Ga0495678_000276_14862_16292 | 446 |
| 381 | 3300049460 | Ga0495682_0001190 | Ga0495682_0001190_10121_11551 | 446 |
| 382 | 3300049568 | Ga0501031_0014850 | Ga0501031_0014850_1833_3263 | 446 |
| 383 | 3300049569 | Ga0501032_0008566 | Ga0501032_0008566_3734_5164 | 446 |
| 384 | 3300049570 | Ga0501033_0000238 | Ga0501033_0000238_10932_12362 | 446 |
| 385 | 3300049570 | Ga0501033_0012400 | Ga0501033_0012400_4299_5729 | 446 |
| 386 | 3300049570 | Ga0501033_0023636 | Ga0501033_0023636_1561_2994 | 446 |
| 387 | 3300049571 | Ga0501034_0010160 | Ga0501034_0010160_5710_7140 | 446 |
| 388 | 3300049572 | Ga0501036_0034507 | Ga0501036_0034507_2798_4228 | 446 |
| 389 | 3300049573 | Ga0501037_0004498 | Ga0501037_0004498_6412_7842 | 446 |
| 390 | 3300049573 | Ga0501037_0013086 | Ga0501037_0013086_2003_3433 | 446 |
| 391 | 3300049574 | Ga0501038_0021857 | Ga0501038_0021857_1300_2730 | 446 |
| 392 | 3300049574 | Ga0501038_0110282 | Ga0501038_0110282_41_1474 | 446 |
| 393 | 3300049574 | Ga0501038_0190116 | Ga0501038_0190116_156_1586 | 446 |
| 394 | 3300049575 | Ga0501039_0039581 | Ga0501039_0039581_1563_2993 | 446 |
| 395 | 3300049578 | Ga0501042_0025452 | Ga0501042_0025452_1040_2470 | 446 |
| 396 | 3300049579 | Ga0501043_0090751 | Ga0501043_0090751_395_1828 | 446 |
| 397 | 3300049579 | Ga0501043_0109102 | Ga0501043_0109102_581_2011 | 446 |
| 398 | 3300049580 | Ga0501046_0005065 | Ga0501046_0005065_1994_3424 | 446 |
| 399 | 3300049580 | Ga0501046_0006985 | Ga0501046_0006985_7334_8764 | 446 |
| 400 | 3300049581 | Ga0501047_0006853 | Ga0501047_0006853_6114_7544 | 446 |
| 401 | 3300049581 | Ga0501047_0064041 | Ga0501047_0064041_1580_3022 | 446 |
| 402 | 3300049581 | Ga0501047_0097471 | Ga0501047_0097471_578_2011 | 446 |
| 403 | 3300049581 | Ga0501047_0230405 | Ga0501047_0230405_163_1596 | 446 |
| 404 | 3300049582 | Ga0501048_0015772 | Ga0501048_0015772_2555_3985 | 446 |
| 405 | 3300049582 | Ga0501048_0034651 | Ga0501048_0034651_737_2167 | 446 |
| 406 | 3300049585 | Ga0501069_0004418 | Ga0501069_0004418_1647_3077 | 446 |
| 407 | 3300049585 | Ga0501069_0034028 | Ga0501069_0034028_1324_2757 | 446 |
| 408 | 3300049586 | Ga0501070_0036419 | Ga0501070_0036419_1111_2541 | 446 |
| 409 | 3300049586 | Ga0501070_0044037 | Ga0501070_0044037_208_1638 | 446 |
| 410 | 3300049586 | Ga0501070_0077685 | Ga0501070_0077685_271_1704 | 446 |
| 411 | 3300049587 | Ga0501071_0016751 | Ga0501071_0016751_1813_3243 | 446 |
| 412 | 3300049588 | Ga0501072_0014581 | Ga0501072_0014581_2394_3824 | 446 |
| 413 | 3300049589 | Ga0501073_0058417 | Ga0501073_0058417_846_2276 | 446 |
| 414 | 3300049590 | Ga0501074_0003853 | Ga0501074_0003853_3516_4946 | 446 |
| 415 | 3300049590 | Ga0501074_0027420 | Ga0501074_0027420_698_2128 | 446 |
| 416 | 3300049593 | Ga0501077_0086504 | Ga0501077_0086504_384_1814 | 446 |
| 417 | 3300049741 | Ga0501079_0014047 | Ga0501079_0014047_1825_3255 | 446 |
| 418 | 3300049742 | Ga0501080_0021387 | Ga0501080_0021387_3911_5341 | 446 |
| 419 | 3300049742 | Ga0501080_0065677 | Ga0501080_0065677_235_1668 | 446 |
| 420 | 3300049742 | Ga0501080_0074806 | Ga0501080_0074806_411_1853 | 446 |
| 421 | 3300049744 | Ga0501083_0001689 | Ga0501083_0001689_10386_11816 | 446 |
| 422 | 3300049822 | Ga0501035_0021435 | Ga0501035_0021435_2635_4065 | 446 |
| 423 | 3300049822 | Ga0501035_0061562 | Ga0501035_0061562_1229_2662 | 446 |
| 424 | 3300049823 | Ga0501044_0026174 | Ga0501044_0026174_1235_2677 | 446 |
| 425 | 3300049823 | Ga0501044_0042412 | Ga0501044_0042412_2883_4313 | 446 |
| 426 | 3300049823 | Ga0501044_0046404 | Ga0501044_0046404_250_1653 | 446 |
| 427 | 3300049823 | Ga0501044_0054069 | Ga0501044_0054069_1938_3368 | 446 |
| 428 | 3300049823 | Ga0501044_0054456 | Ga0501044_0054456_2276_3706 | 446 |
| 429 | 3300049823 | Ga0501044_0103064 | Ga0501044_0103064_1026_2459 | 446 |
| 430 | 3300049823 | Ga0501044_0182554 | Ga0501044_0182554_253_1683 | 446 |
| 431 | 3300053079 | Ga0500610_0002210 | Ga0500610_0002210_5499_6929 | 446 |
| 432 | 3300053139 | Ga0500568_0000665 | Ga0500568_0000665_15164_16594 | 446 |
| 433 | 3300053730 | Ga0500645_000391 | Ga0500645_000391_1181_2611 | 446 |
| 434 | 3300054114 | Ga0501084_0043300 | Ga0501084_0043300_647_2077 | 446 |
| 435 | 3300054114 | Ga0501084_0049115 | Ga0501084_0049115_505_1935 | 446 |
| 436 | 3300055283 | Ga0500661_004961 | Ga0500661_004961_331_1761 | 446 |
| 437 | 3300060353 | Ga0501082_0001868 | Ga0501082_0001868_13420_14850 | 446 |
| 438 | 3300060353 | Ga0501082_0038278 | Ga0501082_0038278_733_2163 | 446 |
| 439 | 3300061719 | Ga0466962_0004865 | Ga0466962_0004865_1166_2596 | 446 |
| 440 | 3300061719 | Ga0466962_0005997 | Ga0466962_0005997_1064_2494 | 446 |
| 441 | 3300061719 | Ga0466962_0031299 | Ga0466962_0031299_579_2009 | 446 |
| 442 | 3300005458 | Ga0070681_10000047 | Ga0070681_1000004720 | 447 |
| 443 | 3300005458 | Ga0070681_10024625 | Ga0070681_100246253 | 447 |
| 444 | 3300005563 | Ga0068855_100017031 | Ga0068855_1000170316 | 447 |
| 445 | 3300009545 | Ga0105237_10037279 | Ga0105237_100372792 | 447 |
| 446 | 3300009553 | Ga0105249_10000648 | Ga0105249_1000064828 | 447 |
| 447 | 3300025912 | Ga0207707_10000273 | Ga0207707_1000027345 | 447 |
| 448 | 3300025949 | Ga0207667_10025291 | Ga0207667_100252912 | 447 |
| 449 | 3300047472 | Ga0495686_0003885 | Ga0495686_0003885_2872_4305 | 447 |
| 450 | 3300048925 | Ga0496122_0003660 | Ga0496122_0003660_9113_10546 | 447 |
| 451 | 3300048926 | Ga0496123_0002907 | Ga0496123_0002907_9425_10858 | 447 |
| 452 | 3300053087 | Ga0500643_000888 | Ga0500643_000888_9135_10568 | 447 |
| 453 | 3300053120 | Ga0500597_000045 | Ga0500597_000045_1029_2462 | 447 |
| 454 | 3300037418 | Ga0395900_0000051 | Ga0395900_0000051_91869_93308 | 448 |
| 455 | 3300037418 | Ga0395900_0012146 | Ga0395900_0012146_5365_6804 | 448 |
| 456 | 3300037466 | Ga0395898_0000363 | Ga0395898_0000363_63685_65121 | 448 |
| 457 | 3300047472 | Ga0495686_0000017 | Ga0495686_0000017_289671_291107 | 448 |
| 458 | 3300048921 | Ga0496118_0011703 | Ga0496118_0011703_5635_7071 | 448 |
| 459 | 3300041486 | Ga0451807_1050170 | Ga0451807_1050170_363_1859 | 449 |
| 460 | 3300049570 | Ga0501033_0001455 | Ga0501033_0001455_3401_4918 | 450 |
| 461 | 3300049573 | Ga0501037_0151966 | Ga0501037_0151966_24_1598 | 450 |
| 462 | 3300049574 | Ga0501038_0146823 | Ga0501038_0146823_215_1789 | 450 |
| 463 | 3300049575 | Ga0501039_0199689 | Ga0501039_0199689_36_1559 | 450 |
| 464 | 3300049579 | Ga0501043_0122673 | Ga0501043_0122673_70_1644 | 450 |
| 465 | 3300049581 | Ga0501047_0178231 | Ga0501047_0178231_349_1899 | 450 |
| 466 | 3300001915 | JGI24741J21665_1000296 | JGI24741J21665_100029610 | 451 |
| 467 | 3300001915 | JGI24741J21665_1001236 | JGI24741J21665_10012365 | 451 |
| 468 | 3300001915 | JGI24741J21665_1004269 | JGI24741J21665_10042691 | 451 |
| 469 | 3300001915 | JGI24741J21665_1006936 | JGI24741J21665_10069362 | 451 |
| 470 | 3300001979 | JGI24740J21852_10001743 | JGI24740J21852_100017434 | 451 |
| 471 | 3300005336 | Ga0070680_100000370 | Ga0070680_10000037017 | 451 |
| 472 | 3300005336 | Ga0070680_100000773 | Ga0070680_10000077310 | 451 |
| 473 | 3300005337 | Ga0070682_100003689 | Ga0070682_1000036894 | 451 |
| 474 | 3300005339 | Ga0070660_100018173 | Ga0070660_1000181732 | 451 |
| 475 | 3300005339 | Ga0070660_100026133 | Ga0070660_1000261335 | 451 |
| 476 | 3300005339 | Ga0070660_100034190 | Ga0070660_1000341902 | 451 |
| 477 | 3300005341 | Ga0070691_10004165 | Ga0070691_100041654 | 451 |
| 478 | 3300005344 | Ga0070661_100003938 | Ga0070661_1000039384 | 451 |
| 479 | 3300005344 | Ga0070661_100072385 | Ga0070661_1000723852 | 451 |
| 480 | 3300005366 | Ga0070659_100069623 | Ga0070659_1000696232 | 451 |
| 481 | 3300005455 | Ga0070663_100001587 | Ga0070663_1000015872 | 451 |
| 482 | 3300005455 | Ga0070663_100031254 | Ga0070663_1000312542 | 451 |
| 483 | 3300005455 | Ga0070663_100097110 | Ga0070663_1000971102 | 451 |
| 484 | 3300005457 | Ga0070662_100021005 | Ga0070662_1000210052 | 451 |
| 485 | 3300005458 | Ga0070681_10006318 | Ga0070681_100063182 | 451 |
| 486 | 3300005458 | Ga0070681_10007696 | Ga0070681_100076962 | 451 |
| 487 | 3300005458 | Ga0070681_10011591 | Ga0070681_100115914 | 451 |
| 488 | 3300005530 | Ga0070679_100000903 | Ga0070679_10000090314 | 451 |
| 489 | 3300005530 | Ga0070679_100002174 | Ga0070679_10000217411 | 451 |
| 490 | 3300005539 | Ga0068853_100017321 | Ga0068853_1000173212 | 451 |
| 491 | 3300005539 | Ga0068853_100052919 | Ga0068853_1000529192 | 451 |
| 492 | 3300005546 | Ga0070696_100005439 | Ga0070696_1000054393 | 451 |
| 493 | 3300005547 | Ga0070693_100002616 | Ga0070693_1000026163 | 451 |
| 494 | 3300005563 | Ga0068855_100168268 | Ga0068855_1001682682 | 451 |
| 495 | 3300005564 | Ga0070664_100024847 | Ga0070664_1000248474 | 451 |
| 496 | 3300005564 | Ga0070664_100090503 | Ga0070664_1000905032 | 451 |
| 497 | 3300005577 | Ga0068857_100155808 | Ga0068857_1001558081 | 451 |
| 498 | 3300005578 | Ga0068854_100002151 | Ga0068854_1000021515 | 451 |
| 499 | 3300005578 | Ga0068854_100010198 | Ga0068854_1000101982 | 451 |
| 500 | 3300005616 | Ga0068852_100005537 | Ga0068852_1000055374 | 451 |
| 501 | 3300005616 | Ga0068852_100064233 | Ga0068852_1000642332 | 451 |
| 502 | 3300009551 | Ga0105238_10007169 | Ga0105238_100071694 | 451 |
| 503 | 3300013100 | Ga0157373_10014773 | Ga0157373_100147732 | 451 |
| 504 | 3300013100 | Ga0157373_10084755 | Ga0157373_100847552 | 451 |
| 505 | 3300013102 | Ga0157371_10013621 | Ga0157371_100136216 | 451 |
| 506 | 3300013102 | Ga0157371_10032905 | Ga0157371_100329052 | 451 |
| 507 | 3300013102 | Ga0157371_10046238 | Ga0157371_100462382 | 451 |
| 508 | 3300013104 | Ga0157370_10004562 | Ga0157370_1000456211 | 451 |
| 509 | 3300013105 | Ga0157369_10001525 | Ga0157369_1000152519 | 451 |
| 510 | 3300013306 | Ga0163162_10007139 | Ga0163162_100071398 | 451 |
| 511 | 3300013307 | Ga0157372_10001386 | Ga0157372_1000138611 | 451 |
| 512 | 3300013307 | Ga0157372_10004029 | Ga0157372_100040296 | 451 |
| 513 | 3300013307 | Ga0157372_10208500 | Ga0157372_102085001 | 451 |
| 514 | 3300014497 | Ga0182008_10016313 | Ga0182008_100163133 | 451 |
| 515 | 3300020070 | Ga0206356_10107366 | Ga0206356_101073662 | 451 |
| 516 | 3300020070 | Ga0206356_11377764 | Ga0206356_1137776412 | 451 |
| 517 | 3300020078 | Ga0206352_10454266 | Ga0206352_104542661 | 451 |
| 518 | 3300020081 | Ga0206354_10822484 | Ga0206354_108224844 | 451 |
| 519 | 3300020082 | Ga0206353_10744446 | Ga0206353_107444462 | 451 |
| 520 | 3300020610 | Ga0154015_1110366 | Ga0154015_11103661 | 451 |
| 521 | 3300025261 | Ga0209233_1012560 | Ga0209233_10125602 | 451 |
| 522 | 3300025904 | Ga0207647_10000716 | Ga0207647_1000071616 | 451 |
| 523 | 3300025904 | Ga0207647_10005371 | Ga0207647_100053719 | 451 |
| 524 | 3300025909 | Ga0207705_10001564 | Ga0207705_1000156411 | 451 |
| 525 | 3300025909 | Ga0207705_10001744 | Ga0207705_1000174410 | 451 |
| 526 | 3300025909 | Ga0207705_10002617 | Ga0207705_100026179 | 451 |
| 527 | 3300025909 | Ga0207705_10003650 | Ga0207705_100036502 | 451 |
| 528 | 3300025912 | Ga0207707_10000083 | Ga0207707_1000008368 | 451 |
| 529 | 3300025912 | Ga0207707_10000093 | Ga0207707_1000009312 | 451 |
| 530 | 3300025912 | Ga0207707_10000214 | Ga0207707_1000021426 | 451 |
| 531 | 3300025912 | Ga0207707_10000516 | Ga0207707_1000051613 | 451 |
| 532 | 3300025912 | Ga0207707_10004435 | Ga0207707_100044352 | 451 |
| 533 | 3300025912 | Ga0207707_10004941 | Ga0207707_100049414 | 451 |
| 534 | 3300025913 | Ga0207695_10004302 | Ga0207695_1000430216 | 451 |
| 535 | 3300025913 | Ga0207695_10007245 | Ga0207695_100072456 | 451 |
| 536 | 3300025913 | Ga0207695_10014060 | Ga0207695_100140603 | 451 |
| 537 | 3300025913 | Ga0207695_10070435 | Ga0207695_100704352 | 451 |
| 538 | 3300025917 | Ga0207660_10000690 | Ga0207660_100006904 | 451 |
| 539 | 3300025917 | Ga0207660_10000954 | Ga0207660_1000095411 | 451 |
| 540 | 3300025917 | Ga0207660_10001280 | Ga0207660_100012807 | 451 |
| 541 | 3300025917 | Ga0207660_10001400 | Ga0207660_100014003 | 451 |
| 542 | 3300025917 | Ga0207660_10003995 | Ga0207660_100039956 | 451 |
| 543 | 3300025919 | Ga0207657_10001271 | Ga0207657_1000127117 | 451 |
| 544 | 3300025919 | Ga0207657_10004595 | Ga0207657_100045953 | 451 |
| 545 | 3300025919 | Ga0207657_10078493 | Ga0207657_100784932 | 451 |
| 546 | 3300025920 | Ga0207649_10000779 | Ga0207649_1000077918 | 451 |
| 547 | 3300025920 | Ga0207649_10002975 | Ga0207649_100029753 | 451 |
| 548 | 3300025921 | Ga0207652_10000038 | Ga0207652_10000038117 | 451 |
| 549 | 3300025921 | Ga0207652_10000125 | Ga0207652_1000012544 | 451 |
| 550 | 3300025921 | Ga0207652_10000257 | Ga0207652_1000025710 | 451 |
| 551 | 3300025932 | Ga0207690_10000689 | Ga0207690_1000068910 | 451 |
| 552 | 3300025932 | Ga0207690_10000793 | Ga0207690_100007933 | 451 |
| 553 | 3300025944 | Ga0207661_10005487 | Ga0207661_100054873 | 451 |
| 554 | 3300025944 | Ga0207661_10007193 | Ga0207661_100071936 | 451 |
| 555 | 3300025944 | Ga0207661_10104260 | Ga0207661_101042602 | 451 |
| 556 | 3300025945 | Ga0207679_10012988 | Ga0207679_100129882 | 451 |
| 557 | 3300025949 | Ga0207667_10002427 | Ga0207667_100024279 | 451 |
| 558 | 3300025949 | Ga0207667_10006312 | Ga0207667_100063123 | 451 |
| 559 | 3300025949 | Ga0207667_10008956 | Ga0207667_100089569 | 451 |
| 560 | 3300025949 | Ga0207667_10027857 | Ga0207667_100278572 | 451 |
| 561 | 3300025949 | Ga0207667_10070830 | Ga0207667_100708302 | 451 |
| 562 | 3300025981 | Ga0207640_10000939 | Ga0207640_100009395 | 451 |
| 563 | 3300025981 | Ga0207640_10002085 | Ga0207640_100020852 | 451 |
| 564 | 3300025981 | Ga0207640_10004146 | Ga0207640_100041462 | 451 |
| 565 | 3300025981 | Ga0207640_10025104 | Ga0207640_100251042 | 451 |
| 566 | 3300026041 | Ga0207639_10000601 | Ga0207639_1000060110 | 451 |
| 567 | 3300026041 | Ga0207639_10006067 | Ga0207639_100060673 | 451 |
| 568 | 3300026041 | Ga0207639_10030268 | Ga0207639_100302682 | 451 |
| 569 | 3300026067 | Ga0207678_10000916 | Ga0207678_1000091617 | 451 |
| 570 | 3300026067 | Ga0207678_10001375 | Ga0207678_1000137510 | 451 |
| 571 | 3300026067 | Ga0207678_10006700 | Ga0207678_100067002 | 451 |
| 572 | 3300026067 | Ga0207678_10006710 | Ga0207678_100067109 | 451 |
| 573 | 3300026067 | Ga0207678_10018220 | Ga0207678_100182202 | 451 |
| 574 | 3300026067 | Ga0207678_10030490 | Ga0207678_100304902 | 451 |
| 575 | 3300026078 | Ga0207702_10006665 | Ga0207702_100066655 | 451 |
| 576 | 3300026078 | Ga0207702_10009006 | Ga0207702_100090062 | 451 |
| 577 | 3300026078 | Ga0207702_10022182 | Ga0207702_100221822 | 451 |
| 578 | 3300026116 | Ga0207674_10001362 | Ga0207674_1000136217 | 451 |
| 579 | 3300026116 | Ga0207674_10002346 | Ga0207674_1000234616 | 451 |
| 580 | 3300026116 | Ga0207674_10183884 | Ga0207674_101838841 | 451 |
| 581 | 3300026142 | Ga0207698_10001087 | Ga0207698_100010872 | 451 |
| 582 | 3300026142 | Ga0207698_10005570 | Ga0207698_100055702 | 451 |
| 583 | 3300037418 | Ga0395900_0035069 | Ga0395900_0035069_1657_3174 | 451 |
| 584 | 3300038443 | Ga0395901_0001129 | Ga0395901_0001129_22398_23915 | 451 |
| 585 | 3300041404 | Ga0439436_0000011 | Ga0439436_0000011_52838_54304 | 451 |
| 586 | 3300041413 | Ga0439465_0000292 | Ga0439465_0000292_5739_7205 | 451 |
| 587 | 3300044658 | Ga0466972_0028135 | Ga0466972_0028135_789_2237 | 451 |
| 588 | 3300044672 | Ga0466982_0000036 | Ga0466982_0000036_129_1586 | 451 |
| 589 | 3300044735 | Ga0466968_0005485 | Ga0466968_0005485_2892_4340 | 451 |
| 590 | 3300046460 | Ga0495638_0000069 | Ga0495638_0000069_24994_26448 | 451 |
| 591 | 3300046471 | Ga0495650_0000452 | Ga0495650_0000452_27490_28965 | 451 |
| 592 | 3300048903 | Ga0496100_0004368 | Ga0496100_0004368_4370_5842 | 451 |
| 593 | 3300048904 | Ga0496101_0005402 | Ga0496101_0005402_4246_5718 | 451 |
| 594 | 3300048921 | Ga0496118_0000645 | Ga0496118_0000645_41455_42957 | 451 |
| 595 | 3300048924 | Ga0496121_0024061 | Ga0496121_0024061_979_2481 | 451 |
| 596 | 3300049570 | Ga0501033_0141135 | Ga0501033_0141135_53_1501 | 451 |
| 597 | 3300049571 | Ga0501034_0091388 | Ga0501034_0091388_1445_2950 | 451 |
| 598 | 3300049573 | Ga0501037_0044700 | Ga0501037_0044700_834_2282 | 451 |
| 599 | 3300049581 | Ga0501047_0002444 | Ga0501047_0002444_3770_5218 | 451 |
| 600 | 3300049581 | Ga0501047_0038457 | Ga0501047_0038457_718_2166 | 451 |
| 601 | 3300049585 | Ga0501069_0008197 | Ga0501069_0008197_951_2399 | 451 |
| 602 | 3300049585 | Ga0501069_0035806 | Ga0501069_0035806_65_1513 | 451 |
| 603 | 3300049586 | Ga0501070_0004912 | Ga0501070_0004912_3017_4465 | 451 |
| 604 | 3300049586 | Ga0501070_0011269 | Ga0501070_0011269_139_1584 | 451 |
| 605 | 3300049586 | Ga0501070_0013787 | Ga0501070_0013787_5210_6658 | 451 |
| 606 | 3300049586 | Ga0501070_0014708 | Ga0501070_0014708_4959_6404 | 451 |
| 607 | 3300049586 | Ga0501070_0024306 | Ga0501070_0024306_2501_3949 | 451 |
| 608 | 3300049587 | Ga0501071_0002502 | Ga0501071_0002502_2428_3876 | 451 |
| 609 | 3300049589 | Ga0501073_0002707 | Ga0501073_0002707_834_2282 | 451 |
| 610 | 3300049589 | Ga0501073_0060276 | Ga0501073_0060276_762_2210 | 451 |
| 611 | 3300049590 | Ga0501074_0033587 | Ga0501074_0033587_278_1726 | 451 |
| 612 | 3300049590 | Ga0501074_0066901 | Ga0501074_0066901_1055_2503 | 451 |
| 613 | 3300049742 | Ga0501080_0037362 | Ga0501080_0037362_1556_3004 | 451 |
| 614 | 3300049822 | Ga0501035_0001523 | Ga0501035_0001523_3005_4453 | 451 |
| 615 | 3300049822 | Ga0501035_0019597 | Ga0501035_0019597_1692_3140 | 451 |
| 616 | 3300049822 | Ga0501035_0061783 | Ga0501035_0061783_896_2344 | 451 |
| 617 | 3300049822 | Ga0501035_0093654 | Ga0501035_0093654_252_1757 | 451 |
| 618 | 3300049823 | Ga0501044_0008967 | Ga0501044_0008967_3698_5146 | 451 |
| 619 | 3300049823 | Ga0501044_0012187 | Ga0501044_0012187_5899_7362 | 451 |
| 620 | 3300049823 | Ga0501044_0015321 | Ga0501044_0015321_725_2173 | 451 |
| 621 | iso_pu_bacteria | 2842918807 | 2842919959 | 451 |
| 622 | iso_pu_bacteria | 2953994433 | 2953995254 | 451 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j6b-assembly1.cif.gz_D | crystal structure of aldehyde dehydrogenase from burkholderia thailandensis in covelent complex with nadph | 0.9447 | 6 | 451 |
| 1uxv-assembly1.cif.gz_A | structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax | 0.944 | 32 | 449 |
| 1ky8-assembly1.cif.gz_A | crystal structure of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase | 0.9436 | 28 | 449 |
| 5kf0-assembly1.cif.gz_A | crystal structure of an aldedhyde dehydrogenase from burkholderia vietnamiensis | 0.9423 | 6 | 451 |
| 1uxn-assembly1.cif.gz_A | structural basis for allosteric regulation and substrate specificity of the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (gapn) from thermoproteus tenax | 0.942 | 32 | 449 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5j6bB02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9759 | 226 | 415 | 3.40.309.10 |
| 5j6bB02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9708 | 226 | 415 | 3.40.309.10 |
| 5mz5B02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9639 | 226 | 415 | 3.40.309.10 |
| 5mz5B02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.959 | 226 | 415 | 3.40.309.10 |
| 3k2wA02 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 | 0.9495 | 226 | 414 | 3.40.309.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C5K7N5-F1-model_v4 | NADP-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.9) (Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]) (Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase) (Triosephosphate dehydrogenase) | 0.9539 | 122 | 419 |
GO:0008911
|
| AF-A0A7C5YA24-F1-model_v4 | Aldehyde dehydrogenase | 0.9492 | 31 | 356 |
GO:0008911
|
| AF-A0A0K2RK11-F1-model_v4 | Putative aldehyde-dehydrogenase-like protein y4uC | 0.9433 | 150 | 427 |
GO:0008911
|
| AF-A0A658JNM1-F1-model_v4 | deleted | 0.9415 | 32 | 298 |
|
| AF-A0A7J6T3T6-F1-model_v4 | NADP-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.9) (Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]) (Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase) (Triosephosphate dehydrogenase) | 0.941 | 7 | 450 |
GO:0008911
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar