F470121

General Info

Members Datasets Scaffolds Average Seq Length
622 308 620 132

Family's Representative Sequence

Representative Sequence 3300041459|Ga0451800_0284904|Ga0451800_0284904_209_679
Length 156
Sequence MKVVTHAGVQARPARAIKQAITFKRLAMTIHLDHFIVSARDKVASARFLAELLGVPWAETTIGPFSAVYINEGLTLDFIDTDEKFPVEHFCFRVSEQEFDAILGRIQAAGIQYRSSVRGPMDMQVSTYLGGKGIYWNEPEGHQWEMLTVSYARQEG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
220 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
221 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
222 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
223 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
224 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
225 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
231 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
232 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
288 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
298 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
299 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
300 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
301 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
302 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
303 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
304 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.67
Nodule 0.32
Rhizoplane 1.61
Rhizosphere 81.99
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000028 3300002704 Bacteria 120158
2 JGI25156J39149_1000013 3300002705 Bacteria 189553
3 JGI25154J39366_1000032 3300002738 Bacteria 189265
4 JGI25157J39369_1000017 3300002741 Bacteria 189553
5 JGI25150J39212_1009990 3300002774 Bacteria 1785
6 JGI25150J39212_1018645 3300002774 Bacteria 1100
7 JGI25159J45721_1001154 3300002987 Bacteria 11274
8 JGI25159J45721_1001298 3300002987 Bacteria 10555
9 JGI25159J45721_1010161 3300002987 Bacteria 2423
10 rootH2_10346963 3300003320 Unclassified 1069
11 rootH1_10198405 3300003323 Bacteria 1195
12 JGI26128J50194_1003445 3300003347 Unclassified 1047
13 JGI25160J50197_1000178 3300003354 Bacteria 53751
14 JGI25160J50197_1040721 3300003354 Bacteria 1074
15 JGI26145J50221_1006004 3300003371 Unclassified 1010
16 JGI25161J50226_1000013 3300003374 Bacteria 199086
17 JGI26141J51220_1001960 3300003503 Unclassified 1257
18 Ga0055526_1021747 3300003771 Bacteria 2216
19 Ga0055526_1022857 3300003771 Bacteria 2109
20 Ga0055537_1000493 3300003773 Bacteria 24035
21 Ga0055537_1019105 3300003773 Bacteria 1074
22 Ga0055524_1000029 3300003775 Bacteria 201332
23 Ga0055524_1000145 3300003775 Bacteria 84202
24 Ga0055536_1051939 3300003781 Bacteria 896
25 Ga0055534_1005486 3300003784 Bacteria 3385
26 Ga0055528_1004710 3300003790 Bacteria 6510
27 Ga0055530_10000244 3300003791 Bacteria 49128
28 Ga0055540_1000237 3300003792 Bacteria 50309
29 Ga0055531_10021859 3300003794 Bacteria 2463
30 Ga0055543_1003481 3300004625 Bacteria 4624
31 Ga0065165_1012090 3300005262 Bacteria 3539
32 Ga0065707_10381511 3300005295 Bacteria 876
33 Ga0065707_11091181 3300005295 Unclassified 517
34 Ga0070658_10257964 3300005327 Bacteria 1480
35 Ga0070676_10029151 3300005328 Bacteria 3138
36 Ga0070676_10088778 3300005328 Bacteria 1889
37 Ga0070690_100028887 3300005330 Bacteria 3437
38 Ga0070670_100209553 3300005331 Bacteria 1694
39 Ga0070677_10014469 3300005333 Bacteria 2778
40 Ga0070677_10028949 3300005333 Bacteria 2097
41 Ga0068869_100000898 3300005334 Bacteria 17159
42 Ga0068869_100004925 3300005334 Bacteria 8353
43 Ga0068869_100077669 3300005334 Bacteria 2471
44 Ga0070666_10090973 3300005335 Bacteria 2096
45 Ga0068868_100104562 3300005338 Bacteria 2295
46 Ga0068868_100680555 3300005338 Bacteria 918
47 Ga0070660_100327803 3300005339 Unclassified 1259
48 Ga0070660_100368146 3300005339 Bacteria 1185
49 Ga0070689_100092728 3300005340 Bacteria 2383
50 Ga0070691_10027353 3300005341 Bacteria 2661
51 Ga0070687_100031882 3300005343 Bacteria 2589
52 Ga0070661_100005150 3300005344 Bacteria 9002
53 Ga0070661_100084042 3300005344 Bacteria 2352
54 Ga0070668_100007021 3300005347 Bacteria 8345
55 Ga0070669_100005971 3300005353 Bacteria 8784
56 Ga0070669_100093558 3300005353 Bacteria 2257
57 Ga0070669_100198605 3300005353 Bacteria 1577
58 Ga0070669_100444500 3300005353 Bacteria 1068
59 Ga0070669_100944654 3300005353 Bacteria 738
60 Ga0070675_100016335 3300005354 Bacteria 5889
61 Ga0070675_100196183 3300005354 Bacteria 1751
62 Ga0070675_100294979 3300005354 Bacteria 1427
63 Ga0070675_101249222 3300005354 Unclassified 684
64 Ga0070671_101026058 3300005355 Unclassified 723
65 Ga0070674_100006500 3300005356 Bacteria 6826
66 Ga0070674_100099807 3300005356 Bacteria 2113
67 Ga0070674_100160445 3300005356 Bacteria 1706
68 Ga0070674_100232026 3300005356 Bacteria 1441
69 Ga0070674_100999369 3300005356 Bacteria 734
70 Ga0070673_100110725 3300005364 Bacteria 2277
71 Ga0070673_101880003 3300005364 Bacteria 567
72 Ga0070659_100000722 3300005366 Bacteria 23972
73 Ga0070659_100117509 3300005366 Bacteria 2151
74 Ga0070667_100013827 3300005367 Bacteria 6673
75 Ga0070667_100979273 3300005367 Unclassified 789
76 Ga0070703_10457783 3300005406 Unclassified 566
77 Ga0070701_10182760 3300005438 Bacteria 1229
78 Ga0070694_100008315 3300005444 Bacteria 6346
79 Ga0070694_100008926 3300005444 Bacteria 6141
80 Ga0070694_100022552 3300005444 Bacteria 4035
81 Ga0070694_100822852 3300005444 Bacteria 763
82 Ga0070708_100000602 3300005445 Bacteria 27055
83 Ga0070708_100021577 3300005445 Bacteria 5448
84 Ga0070708_100063017 3300005445 Bacteria 3318
85 Ga0070708_100112100 3300005445 Bacteria 2508
86 Ga0070663_100183736 3300005455 Bacteria 1624
87 Ga0070678_100128356 3300005456 Bacteria 2010
88 Ga0070678_100575462 3300005456 Bacteria 1003
89 Ga0070678_101720572 3300005456 Unclassified 590
90 Ga0070662_100012608 3300005457 Bacteria 5607
91 Ga0070662_100026440 3300005457 Bacteria 4020
92 Ga0070662_100106638 3300005457 Bacteria 2129
93 Ga0070662_100592626 3300005457 Bacteria 932
94 Ga0068867_100003306 3300005459 Bacteria 11358
95 Ga0068867_100030156 3300005459 Bacteria 3912
96 Ga0068867_100446934 3300005459 Unclassified 1100
97 Ga0070706_100005973 3300005467 Bacteria 11518
98 Ga0070706_100034961 3300005467 Bacteria 4640
99 Ga0070706_100181709 3300005467 Unclassified 1964
100 Ga0070706_100326296 3300005467 Bacteria 1431
101 Ga0070706_100609017 3300005467 Bacteria 1015
102 Ga0070707_100062028 3300005468 Bacteria 3586
103 Ga0070698_100041080 3300005471 Bacteria 4750
104 Ga0070698_100468235 3300005471 Bacteria 1196
105 Ga0070698_100511538 3300005471 Bacteria 1139
106 Ga0070698_100880552 3300005471 Bacteria 841
107 Ga0070699_100004312 3300005518 Bacteria 12575
108 Ga0070699_100282221 3300005518 Bacteria 1488
109 Ga0070699_100284486 3300005518 Bacteria 1481
110 Ga0070699_100957521 3300005518 Bacteria 784
111 Ga0070697_100009950 3300005536 Bacteria 7419
112 Ga0070697_100093303 3300005536 Unclassified 2492
113 Ga0070697_100117793 3300005536 Bacteria 2219
114 Ga0070697_100892617 3300005536 Bacteria 788
115 Ga0070697_100999370 3300005536 Bacteria 744
116 Ga0068853_100750545 3300005539 Bacteria 932
117 Ga0070672_100007141 3300005543 Bacteria 7557
118 Ga0070672_100645710 3300005543 Bacteria 924
119 Ga0070672_101636288 3300005543 Unclassified 578
120 Ga0070686_100160724 3300005544 Bacteria 1582
121 Ga0070695_100007759 3300005545 Bacteria 6357
122 Ga0070695_100008268 3300005545 Bacteria 6173
123 Ga0070695_100008555 3300005545 Bacteria 6079
124 Ga0070696_100026544 3300005546 Bacteria 3941
125 Ga0070696_100214630 3300005546 Bacteria 1442
126 Ga0070696_100230751 3300005546 Bacteria 1392
127 Ga0070693_100031753 3300005547 Bacteria 2898
128 Ga0070693_100616067 3300005547 Unclassified 785
129 Ga0070665_100064377 3300005548 Bacteria 3677
130 Ga0070704_100348486 3300005549 Unclassified 1249
131 Ga0070704_101245891 3300005549 Unclassified 679
132 Ga0068855_100666291 3300005563 Bacteria 1116
133 Ga0070664_100029878 3300005564 Bacteria 4544
134 Ga0070664_100578050 3300005564 Unclassified 1041
135 Ga0070664_101641869 3300005564 Unclassified 609
136 Ga0068857_100682070 3300005577 Unclassified 975
137 Ga0068857_101117447 3300005577 Unclassified 761
138 Ga0068854_100116445 3300005578 Bacteria 2023
139 Ga0068854_100730738 3300005578 Bacteria 857
140 Ga0070702_100179570 3300005615 Bacteria 1384
141 Ga0070702_100779239 3300005615 Unclassified 737
142 Ga0068852_100013930 3300005616 Bacteria 6167
143 Ga0068852_100251947 3300005616 Bacteria 1692
144 Ga0068852_100637998 3300005616 Unclassified 1072
145 Ga0068852_102259936 3300005616 Bacteria 565
146 Ga0068859_100405292 3300005617 Bacteria 1460
147 Ga0068864_100190964 3300005618 Bacteria 1878
148 Ga0068864_100462589 3300005618 Bacteria 1215
149 Ga0068864_101608538 3300005618 Bacteria 654
150 Ga0068866_10003593 3300005718 Bacteria 6352
151 Ga0068866_10113195 3300005718 Unclassified 1517
152 Ga0068861_100005455 3300005719 Bacteria 8612
153 Ga0068861_100464198 3300005719 Bacteria 1137
154 Ga0068851_10386730 3300005834 Bacteria 821
155 Ga0068863_100002824 3300005841 Bacteria 17200
156 Ga0068863_101042109 3300005841 Unclassified 822
157 Ga0068858_100010674 3300005842 Bacteria 8689
158 Ga0068860_100007028 3300005843 Bacteria 11273
159 Ga0068860_100038436 3300005843 Bacteria 4578
160 Ga0068860_100102520 3300005843 Bacteria 2731
161 Ga0068860_100113610 3300005843 Bacteria 2589
162 Ga0068860_100257945 3300005843 Bacteria 1699
163 Ga0068860_100352507 3300005843 Bacteria 1448
164 Ga0068862_100013949 3300005844 Bacteria 6661
165 Ga0068862_100052009 3300005844 Bacteria 3504
166 Ga0068862_100071518 3300005844 Bacteria 2995
167 Ga0068862_100172908 3300005844 Unclassified 1935
168 Ga0068862_100507472 3300005844 Bacteria 1146
169 Ga0068862_101431658 3300005844 Bacteria 695
170 Ga0068862_101884837 3300005844 Unclassified 608
171 Ga0068862_102403276 3300005844 Bacteria 539
172 Ga0081455_10002385 3300005937 Bacteria 22426
173 Ga0075365_10425629 3300006038 Bacteria 937
174 Ga0075368_10078706 3300006042 Bacteria 1339
175 Ga0075363_100007329 3300006048 Bacteria 5061
176 Ga0075363_100245992 3300006048 Unclassified 1029
177 Ga0075364_10154203 3300006051 Bacteria 1549
178 Ga0075364_10287675 3300006051 Bacteria 1118
179 Ga0070716_100256549 3300006173 Unclassified 1194
180 Ga0075362_10001978 3300006177 Bacteria 6740
181 Ga0075362_10288032 3300006177 Archaea 813
182 Ga0075367_10022821 3300006178 Bacteria 3514
183 Ga0075369_10113087 3300006186 Bacteria 1224
184 Ga0075369_10124357 3300006186 Bacteria 1169
185 Ga0075366_10179092 3300006195 Bacteria 1287
186 Ga0075366_10437819 3300006195 Unclassified 806
187 Ga0097621_100066987 3300006237 Bacteria 2959
188 Ga0075370_10049853 3300006353 Bacteria 2374
189 Ga0068871_102062037 3300006358 Bacteria 543
190 Ga0075428_100051294 3300006844 Bacteria 4524
191 Ga0075428_100062294 3300006844 Bacteria 4084
192 Ga0075428_100358192 3300006844 Unclassified 1565
193 Ga0075428_100523903 3300006844 Bacteria 1268
194 Ga0075428_100643712 3300006844 Bacteria 1131
195 Ga0075430_100064814 3300006846 Bacteria 3070
196 Ga0075430_100092509 3300006846 Bacteria 2528
197 Ga0075430_100369136 3300006846 Bacteria 1185
198 Ga0075431_100010577 3300006847 Bacteria 9278
199 Ga0075431_100117952 3300006847 Bacteria 2738
200 Ga0075431_100172837 3300006847 Bacteria 2220
201 Ga0075433_10093981 3300006852 Bacteria 2653
202 Ga0075433_10141078 3300006852 Bacteria 2142
203 Ga0075433_10198431 3300006852 Bacteria 1784
204 Ga0075434_100035260 3300006871 Bacteria 4945
205 Ga0075434_100221611 3300006871 Bacteria 1911
206 Ga0075434_100278625 3300006871 Bacteria 1692
207 Ga0075434_100358456 3300006871 Bacteria 1479
208 Ga0075429_100008503 3300006880 Bacteria 8932
209 Ga0075429_100134337 3300006880 Bacteria 2165
210 Ga0068865_100021975 3300006881 Bacteria 4155
211 Ga0075436_100057203 3300006914 Bacteria 2693
212 Ga0075436_100575477 3300006914 Unclassified 828
213 Ga0075436_100704756 3300006914 Unclassified 748
214 Ga0097620_100405298 3300006931 Bacteria 1460
215 Ga0079104_1032445 3300006946 Unclassified 1287
216 Ga0075435_100010391 3300007076 Bacteria 6808
217 Ga0075435_100045364 3300007076 Bacteria 3523
218 Ga0075435_100054861 3300007076 Bacteria 3217
219 Ga0075435_100436624 3300007076 Bacteria 1128
220 Ga0099794_10033122 3300007265 Bacteria 2429
221 Ga0099794_10092677 3300007265 Bacteria 1501
222 Ga0111539_10011026 3300009094 Bacteria 11373
223 Ga0111539_10015091 3300009094 Bacteria 9628
224 Ga0111539_10151445 3300009094 Bacteria 2715
225 Ga0111539_11469757 3300009094 Bacteria 790
226 Ga0111539_11532973 3300009094 Bacteria 773
227 Ga0105245_10361313 3300009098 Bacteria 1441
228 Ga0105245_10404959 3300009098 Bacteria 1364
229 Ga0105247_10624041 3300009101 Bacteria 802
230 Ga0114129_10007626 3300009147 Bacteria 15396
231 Ga0114129_10056533 3300009147 Bacteria 5495
232 Ga0114129_10079993 3300009147 Bacteria 4544
233 Ga0114129_10081557 3300009147 Bacteria 4496
234 Ga0114129_10394839 3300009147 Bacteria 1824
235 Ga0114129_10427559 3300009147 Unclassified 1741
236 Ga0114129_10535554 3300009147 Bacteria 1525
237 Ga0105243_10016897 3300009148 Bacteria 5517
238 Ga0105243_10315268 3300009148 Bacteria 1423
239 Ga0105243_10800006 3300009148 Bacteria 929
240 Ga0105243_11547254 3300009148 Bacteria 688
241 Ga0105243_12434419 3300009148 Unclassified 562
242 Ga0105241_10102678 3300009174 Bacteria 2276
243 Ga0105242_10080707 3300009176 Bacteria 2719
244 Ga0105242_10161452 3300009176 Bacteria 1962
245 Ga0105242_11161427 3300009176 Bacteria 789
246 Ga0105248_10013164 3300009177 Bacteria 9108
247 Ga0105248_10407936 3300009177 Bacteria 1530
248 Ga0105248_10740922 3300009177 Bacteria 1109
249 Ga0105248_10809381 3300009177 Bacteria 1057
250 Ga0105248_11454080 3300009177 Bacteria 776
251 Ga0105248_12109876 3300009177 Bacteria 641
252 Ga0105238_10878268 3300009551 Bacteria 914
253 Ga0105249_10021446 3300009553 Bacteria 5783
254 Ga0105249_10074121 3300009553 Bacteria 3150
255 Ga0105249_11378937 3300009553 Bacteria 777
256 Ga0105249_11519218 3300009553 Bacteria 742
257 Ga0105249_12223686 3300009553 Bacteria 621
258 Ga0105239_10872097 3300010375 Unclassified 1033
259 Ga0157374_11458285 3300013296 Bacteria 707
260 Ga0157378_10032390 3300013297 Bacteria 4619
261 Ga0157378_10304496 3300013297 Bacteria 1544
262 Ga0157378_11068274 3300013297 Unclassified 843
263 Ga0157378_11431285 3300013297 Unclassified 735
264 Ga0163162_10007658 3300013306 Bacteria 10519
265 Ga0163162_10368365 3300013306 Bacteria 1570
266 Ga0163162_10692915 3300013306 Bacteria 1141
267 Ga0163162_11120272 3300013306 Bacteria 892
268 Ga0157375_10008662 3300013308 Bacteria 8913
269 Ga0157375_10144413 3300013308 Unclassified 2509
270 Ga0157375_13422303 3300013308 Bacteria 528
271 Ga0157380_10006484 3300014326 Bacteria 8247
272 Ga0157380_10454145 3300014326 Bacteria 1231
273 Ga0157380_10880134 3300014326 Bacteria 920
274 Ga0157380_10884997 3300014326 Bacteria 918
275 Ga0157379_10280311 3300014968 Bacteria 1517
276 Ga0157379_11150841 3300014968 Unclassified 745
277 Ga0157379_11731583 3300014968 Bacteria 613
278 Ga0157376_10006466 3300014969 Bacteria 8280
279 Ga0163161_10004917 3300017792 Bacteria 9299
280 Ga0209435_100003 3300025206 Bacteria 669534
281 Ga0207425_1002316 3300025245 Bacteria 6830
282 Ga0207425_1010907 3300025245 Bacteria 2192
283 Ga0209646_1000008 3300025246 Bacteria 669534
284 Ga0209026_1000007 3300025250 Bacteria 669534
285 Ga0209759_1000026 3300025256 Bacteria 311743
286 Ga0209129_1008850 3300025258 Bacteria 2737
287 Ga0209565_1000026 3300025263 Bacteria 365910
288 Ga0209565_1001771 3300025263 Bacteria 8773
289 Ga0209565_1003658 3300025263 Bacteria 4892
290 Ga0209673_1000009 3300025273 Bacteria 620735
291 Ga0209130_1000183 3300025284 Bacteria 87887
292 Ga0209130_1000863 3300025284 Bacteria 24942
293 Ga0209675_1000849 3300025291 Bacteria 19886
294 Ga0209675_1044783 3300025291 Bacteria 945
295 Ga0209676_1000013 3300025292 Bacteria 816080
296 Ga0209676_1015738 3300025292 Bacteria 2768
297 Ga0209025_1006038 3300025294 Bacteria 9583
298 Ga0209025_1021226 3300025294 Bacteria 3508
299 Ga0209025_1029879 3300025294 Bacteria 2624
300 Ga0209025_1034015 3300025294 Bacteria 2339
301 Ga0209564_1000243 3300025295 Bacteria 118066
302 Ga0209564_1000676 3300025295 Bacteria 50422
303 Ga0209564_1009676 3300025295 Bacteria 4549
304 Ga0209564_1016333 3300025295 Bacteria 2962
305 Ga0209758_1023858 3300025297 Bacteria 2748
306 Ga0209050_1000008 3300025298 Bacteria 1144179
307 Ga0209050_1004318 3300025298 Bacteria 9701
308 Ga0209256_1000003 3300025299 Bacteria 1661127
309 Ga0209256_1000013 3300025299 Bacteria 689442
310 Ga0209256_1051099 3300025299 Unclassified 999
311 Ga0207426_1000062 3300025302 Bacteria 362040
312 Ga0207426_1005424 3300025302 Bacteria 5821
313 Ga0209051_1000005 3300025303 Bacteria 1142353
314 Ga0209051_1067323 3300025303 Bacteria 1095
315 Ga0209257_1000048 3300025304 Bacteria 455536
316 Ga0209257_1022646 3300025304 Bacteria 2234
317 Ga0207697_10143720 3300025315 Unclassified 1036
318 Ga0207656_10330112 3300025321 Bacteria 759
319 Ga0207682_10038333 3300025893 Bacteria 1944
320 Ga0207642_10013253 3300025899 Bacteria 3004
321 Ga0207642_10427750 3300025899 Bacteria 798
322 Ga0207647_10203155 3300025904 Bacteria 1146
323 Ga0207645_10021628 3300025907 Bacteria 4192
324 Ga0207645_10064873 3300025907 Bacteria 2333
325 Ga0207645_10155536 3300025907 Bacteria 1494
326 Ga0207705_10383845 3300025909 Bacteria 1085
327 Ga0207684_10000546 3300025910 Bacteria 46386
328 Ga0207684_10001016 3300025910 Bacteria 31480
329 Ga0207684_10003757 3300025910 Bacteria 14679
330 Ga0207684_10019480 3300025910 Bacteria 5804
331 Ga0207684_10022188 3300025910 Bacteria 5422
332 Ga0207684_10055957 3300025910 Bacteria 3346
333 Ga0207684_10246497 3300025910 Bacteria 1541
334 Ga0207684_10289988 3300025910 Bacteria 1411
335 Ga0207684_10305655 3300025910 Bacteria 1371
336 Ga0207654_10046321 3300025911 Bacteria 2479
337 Ga0207662_10015828 3300025918 Bacteria 4248
338 Ga0207662_10933352 3300025918 Bacteria 615
339 Ga0207657_10166589 3300025919 Bacteria 1787
340 Ga0207657_10378630 3300025919 Bacteria 1115
341 Ga0207649_10220943 3300025920 Unclassified 1349
342 Ga0207649_10322642 3300025920 Bacteria 1135
343 Ga0207649_10919925 3300025920 Bacteria 686
344 Ga0207652_10296919 3300025921 Bacteria 1458
345 Ga0207646_10001810 3300025922 Bacteria 25862
346 Ga0207646_10058994 3300025922 Bacteria 3427
347 Ga0207646_10234950 3300025922 Bacteria 1656
348 Ga0207646_10927500 3300025922 Bacteria 772
349 Ga0207646_11046434 3300025922 Bacteria 720
350 Ga0207681_10003285 3300025923 Bacteria 10122
351 Ga0207681_10136881 3300025923 Bacteria 1819
352 Ga0207681_10233218 3300025923 Bacteria 1429
353 Ga0207694_10606665 3300025924 Bacteria 921
354 Ga0207650_10274037 3300025925 Bacteria 1372
355 Ga0207659_10339085 3300025926 Bacteria 1244
356 Ga0207659_10353097 3300025926 Bacteria 1220
357 Ga0207687_10053993 3300025927 Bacteria 2809
358 Ga0207690_10093922 3300025932 Bacteria 2127
359 Ga0207690_10195516 3300025932 Bacteria 1532
360 Ga0207706_10013686 3300025933 Bacteria 7363
361 Ga0207706_10017989 3300025933 Bacteria 6359
362 Ga0207706_10154981 3300025933 Unclassified 2015
363 Ga0207706_10593238 3300025933 Bacteria 952
364 Ga0207686_10061530 3300025934 Bacteria 2381
365 Ga0207686_10613648 3300025934 Unclassified 857
366 Ga0207709_10052084 3300025935 Bacteria 2512
367 Ga0207709_10095072 3300025935 Bacteria 1957
368 Ga0207709_10259143 3300025935 Bacteria 1274
369 Ga0207670_10380396 3300025936 Unclassified 1124
370 Ga0207669_10018238 3300025937 Bacteria 3622
371 Ga0207669_10047773 3300025937 Bacteria 2538
372 Ga0207704_10205129 3300025938 Bacteria 1446
373 Ga0207704_10230827 3300025938 Bacteria 1376
374 Ga0207665_10052296 3300025939 Bacteria 2752
375 Ga0207691_10004290 3300025940 Bacteria 13847
376 Ga0207691_10210807 3300025940 Bacteria 1687
377 Ga0207691_10503302 3300025940 Bacteria 1029
378 Ga0207691_10817299 3300025940 Unclassified 783
379 Ga0207711_10026819 3300025941 Bacteria 4836
380 Ga0207711_10160205 3300025941 Bacteria 2036
381 Ga0207711_10680072 3300025941 Bacteria 960
382 Ga0207689_10002311 3300025942 Bacteria 17851
383 Ga0207689_10003107 3300025942 Bacteria 15253
384 Ga0207689_10016669 3300025942 Bacteria 6218
385 Ga0207689_10174704 3300025942 Bacteria 1771
386 Ga0207689_10421561 3300025942 Bacteria 1114
387 Ga0207679_10009574 3300025945 Bacteria 6211
388 Ga0207679_10121170 3300025945 Bacteria 2082
389 Ga0207679_10152599 3300025945 Bacteria 1882
390 Ga0207651_10352495 3300025960 Bacteria 1240
391 Ga0207651_10580530 3300025960 Bacteria 978
392 Ga0207651_10854187 3300025960 Bacteria 809
393 Ga0207712_10044613 3300025961 Bacteria 3065
394 Ga0207712_10765210 3300025961 Bacteria 847
395 Ga0207668_10006717 3300025972 Bacteria 6805
396 Ga0207658_10040832 3300025986 Bacteria 3356
397 Ga0207658_12065207 3300025986 Unclassified 518
398 Ga0207677_10343701 3300026023 Bacteria 1248
399 Ga0207677_12234239 3300026023 Unclassified 509
400 Ga0207703_10004330 3300026035 Bacteria 11672
401 Ga0207703_10219485 3300026035 Bacteria 1699
402 Ga0207703_10509184 3300026035 Bacteria 1131
403 Ga0207639_11230928 3300026041 Bacteria 703
404 Ga0207708_10071102 3300026075 Bacteria 2665
405 Ga0207641_10005332 3300026088 Bacteria 10982
406 Ga0207641_10763218 3300026088 Unclassified 955
407 Ga0207641_10956933 3300026088 Unclassified 852
408 Ga0207641_11128472 3300026088 Bacteria 783
409 Ga0207648_10006184 3300026089 Bacteria 11924
410 Ga0207648_10064744 3300026089 Bacteria 3186
411 Ga0207648_10208699 3300026089 Bacteria 1733
412 Ga0207648_10377461 3300026089 Bacteria 1282
413 Ga0207648_10587761 3300026089 Unclassified 1025
414 Ga0207648_12204687 3300026089 Bacteria 512
415 Ga0207676_11793955 3300026095 Bacteria 612
416 Ga0207674_11453302 3300026116 Bacteria 655
417 Ga0207675_100011271 3300026118 Bacteria 8372
418 Ga0207675_100039997 3300026118 Bacteria 4376
419 Ga0207675_100111477 3300026118 Bacteria 2581
420 Ga0207675_100187271 3300026118 Bacteria 1984
421 Ga0207683_10104945 3300026121 Bacteria 2526
422 Ga0207683_10116115 3300026121 Unclassified 2399
423 Ga0207683_10235133 3300026121 Bacteria 1671
424 Ga0207698_10030718 3300026142 Bacteria 3868
425 Ga0207698_10526931 3300026142 Bacteria 1154
426 Ga0209281_1014949 3300027111 Bacteria 1630
427 Ga0209996_1002811 3300027395 Bacteria 2166
428 Ga0210000_1002988 3300027462 Bacteria 2419
429 Ga0209968_1012920 3300027526 Bacteria 1305
430 Ga0209999_1000254 3300027543 Bacteria 7719
431 Ga0209983_1000432 3300027665 Bacteria 9055
432 Ga0209588_1033754 3300027671 Bacteria 1642
433 Ga0209971_1000001 3300027682 Bacteria 149669
434 Ga0209966_1000049 3300027695 Bacteria 51282
435 Ga0209998_10000044 3300027717 Bacteria 50808
436 Ga0209974_10010678 3300027876 Bacteria 3097
437 Ga0207428_10033155 3300027907 Bacteria 4244
438 Ga0207428_10069498 3300027907 Bacteria 2769
439 Ga0207428_10750580 3300027907 Unclassified 695
440 Ga0268266_10100231 3300028379 Bacteria 2551
441 Ga0268265_10012563 3300028380 Bacteria 5741
442 Ga0268265_10020791 3300028380 Bacteria 4587
443 Ga0268265_10098334 3300028380 Bacteria 2357
444 Ga0268265_10257232 3300028380 Bacteria 1550
445 Ga0268265_11418123 3300028380 Bacteria 697
446 Ga0268264_10001473 3300028381 Bacteria 21971
447 Ga0268264_10017747 3300028381 Bacteria 5827
448 Ga0268264_11835220 3300028381 Bacteria 616
449 Ga0307511_10001127 3300030521 Bacteria 28466
450 Ga0307408_100002845 3300031548 Bacteria 12005
451 Ga0307516_10578578 3300031730 Bacteria 777
452 Ga0307413_11883238 3300031824 Bacteria 537
453 Ga0307406_11376292 3300031901 Unclassified 618
454 Ga0307412_11495392 3300031911 Unclassified 614
455 Ga0307409_100310733 3300031995 Bacteria 1471
456 Ga0307416_102285742 3300032002 Unclassified 641
457 Ga0307411_10135132 3300032005 Bacteria 1809
458 Ga0307415_101932838 3300032126 Bacteria 573
459 Ga0451787_375204 3300041441 Bacteria 673
460 Ga0451789_0044157 3300041443 Bacteria 621
461 Ga0451791_1367803 3300041451 Bacteria 556
462 Ga0451791_1527958 3300041451 Bacteria 533
463 Ga0451793_1569421 3300041452 Bacteria 615
464 Ga0451795_1572657 3300041456 Bacteria 527
465 Ga0451800_0284904 3300041459 Unclassified 703
466 Ga0451807_1834078 3300041486 Bacteria 945
467 Ga0451853_0031700 3300041512 Bacteria 2029
468 Ga0451853_3958630 3300041512 Unclassified 535
469 Ga0439448_0042699 3300042005 Bacteria 1470
470 Ga0450919_001422 3300042121 Bacteria 3116
471 Ga0439434_0282696 3300042435 Unclassified 571
472 Ga0439435_0072766 3300042436 Bacteria 1020
473 Ga0439460_0001532 3300042461 Bacteria 5433
474 Ga0450918_000280 3300042531 Bacteria 11555
475 Ga0451577_0053258 3300042876 Bacteria 3612
476 Ga0451577_0075119 3300042876 Bacteria 3014
477 Ga0451577_0301869 3300042876 Bacteria 1451
478 Ga0453683_0223815 3300044673 Unclassified 1197
479 Ga0453683_0636413 3300044673 Bacteria 697
480 Ga0453684_0066299 3300044712 Bacteria 4598
481 Ga0453684_1040859 3300044712 Bacteria 868
482 Ga0451576_0022999 3300045051 Bacteria 6755
483 Ga0451576_0158110 3300045051 Bacteria 2364
484 Ga0451576_0651378 3300045051 Bacteria 1107
485 Ga0451576_0963395 3300045051 Unclassified 894
486 Ga0451576_1708614 3300045051 Bacteria 652
487 Ga0495603_0133576 3300046455 Unclassified 1445
488 Ga0495603_0165742 3300046455 Bacteria 1281
489 Ga0495580_0041159 3300046472 Bacteria 3296
490 Ga0495585_0489270 3300046492 Bacteria 585
491 Ga0495594_0177545 3300046499 Bacteria 1212
492 Ga0495607_0032621 3300046501 Bacteria 3177
493 Ga0495583_0000141 3300046506 Bacteria 121899
494 Ga0495583_0032113 3300046506 Bacteria 2537
495 Ga0495606_0001448 3300046507 Bacteria 31815
496 Ga0495606_0547986 3300046507 Unclassified 576
497 Ga0495598_0150332 3300046537 Bacteria 812
498 Ga0495598_0230105 3300046537 Unclassified 680
499 Ga0495609_0150682 3300046538 Bacteria 989
500 Ga0495633_0045070 3300046558 Bacteria 2089
501 Ga0495656_0117759 3300046615 Bacteria 1250
502 Ga0495611_0532183 3300046648 Unclassified 533
503 Ga0495588_0188988 3300046674 Unclassified 1088
504 Ga0495670_0018727 3300046691 Bacteria 3410
505 Ga0495671_0018740 3300046692 Unclassified 3669
506 Ga0495671_0428424 3300046692 Bacteria 633
507 Ga0495636_0198395 3300047318 Unclassified 916
508 Ga0495673_0088257 3300047469 Bacteria 1271
509 Ga0495626_0024909 3300048091 Bacteria 2930
510 Ga0496100_1402119 3300048903 Unclassified 552
511 Ga0496108_0422753 3300048911 Bacteria 1164
512 Ga0501032_0070553 3300049569 Bacteria 2330
513 Ga0501033_0084559 3300049570 Bacteria 2325
514 Ga0501036_0551725 3300049572 Unclassified 957
515 Ga0501036_1110413 3300049572 Bacteria 646
516 Ga0501037_0049366 3300049573 Bacteria 3082
517 Ga0501037_0261650 3300049573 Bacteria 1208
518 Ga0501038_0104578 3300049574 Bacteria 2353
519 Ga0501038_0404925 3300049574 Bacteria 1055
520 Ga0501039_0035784 3300049575 Bacteria 3832
521 Ga0501040_0021676 3300049576 Bacteria 4294
522 Ga0501040_0067079 3300049576 Bacteria 2472
523 Ga0501041_0011996 3300049577 Bacteria 5128
524 Ga0501042_0035058 3300049578 Bacteria 3560
525 Ga0501042_0239934 3300049578 Bacteria 1308
526 Ga0501043_0310889 3300049579 Bacteria 1203
527 Ga0501046_0088951 3300049580 Bacteria 2378
528 Ga0501048_0011079 3300049582 Bacteria 6722
529 Ga0501048_0409819 3300049582 Bacteria 969
530 Ga0501048_1210598 3300049582 Unclassified 543
531 Ga0501067_0240937 3300049583 Bacteria 1006
532 Ga0501067_0241497 3300049583 Bacteria 1005
533 Ga0501068_0000140 3300049584 Bacteria 33214
534 Ga0501068_0098200 3300049584 Unclassified 1813
535 Ga0501068_0151229 3300049584 Bacteria 1459
536 Ga0501068_0156228 3300049584 Bacteria 1436
537 Ga0501069_0323837 3300049585 Bacteria 906
538 Ga0501071_0162774 3300049587 Bacteria 1668
539 Ga0501073_0002458 3300049589 Bacteria 13846
540 Ga0501074_0053356 3300049590 Bacteria 2916
541 Ga0501074_0671869 3300049590 Bacteria 731
542 Ga0501075_0021077 3300049591 Bacteria 4750
543 Ga0501075_0246977 3300049591 Bacteria 1360
544 Ga0501075_0368149 3300049591 Bacteria 1095
545 Ga0501076_0268658 3300049592 Bacteria 1397
546 Ga0501077_0005676 3300049593 Bacteria 7609
547 Ga0501077_0133035 3300049593 Bacteria 1577
548 Ga0501079_0005459 3300049741 Bacteria 9469
549 Ga0501079_0008777 3300049741 Bacteria 7660
550 Ga0501079_0394864 3300049741 Bacteria 1085
551 Ga0501079_0954997 3300049741 Unclassified 675
552 Ga0501080_0002063 3300049742 Bacteria 17411
553 Ga0501080_0239367 3300049742 Bacteria 1657
554 Ga0501080_0456334 3300049742 Bacteria 1145
555 Ga0501081_0003706 3300049743 Bacteria 9785
556 Ga0501081_0023584 3300049743 Bacteria 4124
557 Ga0501081_0271718 3300049743 Bacteria 1240
558 Ga0501081_0272854 3300049743 Bacteria 1237
559 Ga0501081_1315351 3300049743 Bacteria 548
560 Ga0501083_0048580 3300049744 Bacteria 2864
561 Ga0501083_0078918 3300049744 Bacteria 2183
562 Ga0501035_0171413 3300049822 Bacteria 1875
563 Ga0501045_0000334 3300049824 Bacteria 27806
564 nmdc:mga03683_323177_c1 3300050489 Bacteria 727
565 nmdc:mga00v17_316372_c1 3300050491 Bacteria 1014
566 nmdc:mga00v17_364495_c1 3300050491 Bacteria 940
567 nmdc:mga06z11_51372_c1 3300050494 Bacteria 2111
568 nmdc:mga04h51_474697_c1 3300050495 Bacteria 532
569 nmdc:mga07m45_40941_c1 3300050496 Bacteria 2594
570 nmdc:mga05p37_12853_c1 3300050507 Bacteria 10011
571 nmdc:mga05p37_308500_c1 3300050507 Unclassified 1877
572 nmdc:mga05p37_32315_c1 3300050507 Bacteria 6400
573 nmdc:mga05p37_434067_c1 3300050507 Bacteria 1525
574 nmdc:mga05p37_471425_c1 3300050507 Unclassified 1448
575 nmdc:mga09592_296722_c1 3300050508 Bacteria 1401
576 nmdc:mga09592_57125_c1 3300050508 Bacteria 3298
577 nmdc:mga09592_98309_c1 3300050508 Bacteria 2505
578 nmdc:mga0qj67_446861_c1 3300050509 Unclassified 1041
579 nmdc:mga0qj67_84826_c1 3300050509 Bacteria 2540
580 nmdc:mga06r32_22654_c1 3300050510 Bacteria 5809
581 nmdc:mga06r32_9868_c1 3300050510 Bacteria 8616
582 nmdc:mga08y16_13509_c1 3300050511 Bacteria 8592
583 nmdc:mga08y16_162719_c1 3300050511 Bacteria 2319
584 nmdc:mga08y16_204863_c1 3300050511 Bacteria 2044
585 nmdc:mga08y16_939691_c1 3300050511 Bacteria 848
586 nmdc:mga0n895_194764_c1 3300050512 Bacteria 2058
587 nmdc:mga0n895_247767_c1 3300050512 Bacteria 1808
588 nmdc:mga0n895_47512_c1 3300050512 Bacteria 4197
589 nmdc:mga0n895_62885_c1 3300050512 Bacteria 3670
590 nmdc:mga0n895_63633_c1 3300050512 Bacteria 3647
591 nmdc:mga0rr50_141489_c1 3300050513 Unclassified 1936
592 nmdc:mga0rr50_14691_c1 3300050513 Bacteria 5146
593 nmdc:mga0rr50_512192_c1 3300050513 Bacteria 1021
594 nmdc:mga0rr50_74369_c1 3300050513 Bacteria 2601
595 nmdc:mga0a205_231271_c1 3300050515 Bacteria 1732
596 nmdc:mga0a205_51835_c1 3300050515 Bacteria 3962
597 nmdc:mga0a205_7653_c1 3300050515 Bacteria 9798
598 nmdc:mga0a205_97130_c1 3300050515 Bacteria 2845
599 Ga0500583_0078581 3300053092 Unclassified 1590
600 Ga0500660_173438 3300053100 Bacteria 793
601 Ga0500594_0093976 3300053118 Unclassified 914
602 Ga0500642_0374176 3300053130 Bacteria 627
603 Ga0500655_061823 3300053133 Bacteria 755
604 Ga0500568_0100211 3300053139 Bacteria 1087
605 Ga0500604_0004279 3300053151 Bacteria 3789
606 Ga0500604_0006975 3300053151 Bacteria 2991
607 Ga0500596_027066 3300053735 Bacteria 880
608 Ga0501084_0003207 3300054114 Bacteria 13245
609 Ga0501084_0061229 3300054114 Bacteria 3151
610 Ga0501084_0114165 3300054114 Bacteria 2271
611 Ga0501084_0120784 3300054114 Bacteria 2203
612 Ga0500661_000943 3300055283 Bacteria 5444
613 Ga0501082_0042073 3300060353 Bacteria 3939
614 Ga0501082_0098200 3300060353 Bacteria 2532
615 Ga0501082_1923454 3300060353 Unclassified 516
616 Ga0530510_0056715 3300061734 Bacteria 2830
617 Ga0530510_0094342 3300061734 Unclassified 2185
618 Ga0530510_0096888 3300061734 Bacteria 2156
619 Ga0530510_0128015 3300061734 Bacteria 1867
620 Ga0530510_0548408 3300061734 Bacteria 878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0271718 Ga0501081_0271718_306_704 107
2 3300049583 Ga0501067_0241497 Ga0501067_0241497_161_541 125
3 3300060353 Ga0501082_1923454 Ga0501082_1923454_82_462 125
4 iso_pu_bacteria 2511231002 2511243859 125
5 3300006195 Ga0075366_10437819 Ga0075366_104378192 126
6 3300006914 Ga0075436_100575477 Ga0075436_1005754772 126
7 3300007076 Ga0075435_100054861 Ga0075435_1000548615 126
8 3300009147 Ga0114129_10081557 Ga0114129_100815578 126
9 3300026116 Ga0207674_11453302 Ga0207674_114533021 126
10 3300030521 Ga0307511_10001127 Ga0307511_100011279 126
11 3300046501 Ga0495607_0032621 Ga0495607_0032621_2713_3093 126
12 3300046507 Ga0495606_0001448 Ga0495606_0001448_11006_11386 126
13 3300050507 nmdc:mga05p37_471425_c1 nmdc:mga05p37_471425_c1_969_1349 126
14 3300050513 nmdc:mga0rr50_141489_c1 nmdc:mga0rr50_141489_c1_835_1215 126
15 3300053130 Ga0500642_0374176 Ga0500642_0374176_209_589 126
16 3300053133 Ga0500655_061823 Ga0500655_061823_167_547 126
17 3300053139 Ga0500568_0100211 Ga0500568_0100211_35_415 126
18 3300053151 Ga0500604_0004279 Ga0500604_0004279_2631_3011 126
19 3300002987 JGI25159J45721_1001154 JGI25159J45721_100115411 127
20 3300002987 JGI25159J45721_1001298 JGI25159J45721_10012988 127
21 3300003354 JGI25160J50197_1000178 JGI25160J50197_100017824 127
22 3300003374 JGI25161J50226_1000013 JGI25161J50226_100001324 127
23 3300004625 Ga0055543_1003481 Ga0055543_10034812 127
24 3300005262 Ga0065165_1012090 Ga0065165_10120904 127
25 3300006048 Ga0075363_100245992 Ga0075363_1002459922 127
26 3300025284 Ga0209130_1000183 Ga0209130_100018350 127
27 3300025298 Ga0209050_1004318 Ga0209050_10043185 127
28 3300025302 Ga0207426_1000062 Ga0207426_100006284 127
29 3300031730 Ga0307516_10578578 Ga0307516_105785782 127
30 3300041441 Ga0451787_375204 Ga0451787_375204_143_526 127
31 3300041443 Ga0451789_0044157 Ga0451789_0044157_11_394 127
32 3300041451 Ga0451791_1527958 Ga0451791_1527958_98_481 127
33 3300041452 Ga0451793_1569421 Ga0451793_1569421_38_421 127
34 3300047469 Ga0495673_0088257 Ga0495673_0088257_306_689 127
35 3300053092 Ga0500583_0078581 Ga0500583_0078581_422_805 127
36 3300053100 Ga0500660_173438 Ga0500660_173438_284_667 127
37 3300053118 Ga0500594_0093976 Ga0500594_0093976_332_715 127
38 3300053151 Ga0500604_0006975 Ga0500604_0006975_1442_1825 127
39 3300055283 Ga0500661_000943 Ga0500661_000943_1241_1624 127
40 3300003320 rootH2_10346963 rootH2_103469631 128
41 3300006852 Ga0075433_10198431 Ga0075433_101984312 128
42 3300006871 Ga0075434_100221611 Ga0075434_1002216113 128
43 3300006871 Ga0075434_100358456 Ga0075434_1003584562 128
44 3300007076 Ga0075435_100045364 Ga0075435_1000453643 128
45 3300007076 Ga0075435_100436624 Ga0075435_1004366242 128
46 3300007265 Ga0099794_10033122 Ga0099794_100331222 128
47 3300013308 Ga0157375_13422303 Ga0157375_134223031 128
48 3300026041 Ga0207639_11230928 Ga0207639_112309281 128
49 3300026088 Ga0207641_10763218 Ga0207641_107632181 128
50 3300031824 Ga0307413_11883238 Ga0307413_118832381 128
51 3300031901 Ga0307406_11376292 Ga0307406_113762921 128
52 3300031911 Ga0307412_11495392 Ga0307412_114953921 128
53 3300031995 Ga0307409_100310733 Ga0307409_1003107333 128
54 3300032002 Ga0307416_102285742 Ga0307416_1022857421 128
55 3300046507 Ga0495606_0547986 Ga0495606_0547986_156_542 128
56 3300049569 Ga0501032_0070553 Ga0501032_0070553_46_432 128
57 3300049570 Ga0501033_0084559 Ga0501033_0084559_1630_2073 128
58 3300049572 Ga0501036_1110413 Ga0501036_1110413_112_498 128
59 3300049573 Ga0501037_0261650 Ga0501037_0261650_122_508 128
60 3300049576 Ga0501040_0067079 Ga0501040_0067079_1818_2261 128
61 3300049579 Ga0501043_0310889 Ga0501043_0310889_338_781 128
62 3300049583 Ga0501067_0240937 Ga0501067_0240937_37_423 128
63 3300049584 Ga0501068_0000140 Ga0501068_0000140_17487_17873 128
64 3300049585 Ga0501069_0323837 Ga0501069_0323837_340_726 128
65 3300049589 Ga0501073_0002458 Ga0501073_0002458_11789_12175 128
66 3300049590 Ga0501074_0053356 Ga0501074_0053356_2121_2507 128
67 3300049741 Ga0501079_0008777 Ga0501079_0008777_5033_5476 128
68 3300049742 Ga0501080_0002063 Ga0501080_0002063_11661_12047 128
69 3300049743 Ga0501081_0003706 Ga0501081_0003706_8319_8762 128
70 3300050512 nmdc:mga0n895_194764_c1 nmdc:mga0n895_194764_c1_440_844 128
71 3300050512 nmdc:mga0n895_62885_c1 nmdc:mga0n895_62885_c1_709_1113 128
72 3300050513 nmdc:mga0rr50_512192_c1 nmdc:mga0rr50_512192_c1_481_885 128
73 3300050513 nmdc:mga0rr50_74369_c1 nmdc:mga0rr50_74369_c1_908_1312 128
74 3300050515 nmdc:mga0a205_231271_c1 nmdc:mga0a205_231271_c1_177_581 128
75 3300054114 Ga0501084_0061229 Ga0501084_0061229_487_873 128
76 3300061734 Ga0530510_0548408 Ga0530510_0548408_64_507 128
77 3300002774 JGI25150J39212_1009990 JGI25150J39212_10099901 129
78 3300002774 JGI25150J39212_1018645 JGI25150J39212_10186452 129
79 3300002987 JGI25159J45721_1010161 JGI25159J45721_10101611 129
80 3300003354 JGI25160J50197_1040721 JGI25160J50197_10407212 129
81 3300003771 Ga0055526_1021747 Ga0055526_10217472 129
82 3300003771 Ga0055526_1022857 Ga0055526_10228572 129
83 3300003773 Ga0055537_1000493 Ga0055537_100049321 129
84 3300003773 Ga0055537_1019105 Ga0055537_10191052 129
85 3300003775 Ga0055524_1000145 Ga0055524_100014571 129
86 3300003781 Ga0055536_1051939 Ga0055536_10519391 129
87 3300003784 Ga0055534_1005486 Ga0055534_10054861 129
88 3300003790 Ga0055528_1004710 Ga0055528_10047104 129
89 3300003791 Ga0055530_10000244 Ga0055530_1000024422 129
90 3300003792 Ga0055540_1000237 Ga0055540_100023731 129
91 3300003794 Ga0055531_10021859 Ga0055531_100218592 129
92 3300005327 Ga0070658_10257964 Ga0070658_102579641 129
93 3300005328 Ga0070676_10088778 Ga0070676_100887783 129
94 3300005330 Ga0070690_100028887 Ga0070690_1000288878 129
95 3300005331 Ga0070670_100209553 Ga0070670_1002095533 129
96 3300005333 Ga0070677_10014469 Ga0070677_100144696 129
97 3300005333 Ga0070677_10028949 Ga0070677_100289493 129
98 3300005334 Ga0068869_100077669 Ga0068869_1000776691 129
99 3300005338 Ga0068868_100680555 Ga0068868_1006805552 129
100 3300005339 Ga0070660_100327803 Ga0070660_1003278031 129
101 3300005340 Ga0070689_100092728 Ga0070689_1000927285 129
102 3300005343 Ga0070687_100031882 Ga0070687_1000318823 129
103 3300005344 Ga0070661_100084042 Ga0070661_1000840425 129
104 3300005347 Ga0070668_100007021 Ga0070668_1000070214 129
105 3300005353 Ga0070669_100005971 Ga0070669_10000597110 129
106 3300005353 Ga0070669_100093558 Ga0070669_1000935583 129
107 3300005354 Ga0070675_100016335 Ga0070675_1000163357 129
108 3300005354 Ga0070675_100196183 Ga0070675_1001961832 129
109 3300005354 Ga0070675_100294979 Ga0070675_1002949791 129
110 3300005356 Ga0070674_100006500 Ga0070674_1000065008 129
111 3300005356 Ga0070674_100099807 Ga0070674_1000998073 129
112 3300005356 Ga0070674_100160445 Ga0070674_1001604452 129
113 3300005356 Ga0070674_100232026 Ga0070674_1002320262 129
114 3300005364 Ga0070673_101880003 Ga0070673_1018800031 129
115 3300005366 Ga0070659_100117509 Ga0070659_1001175093 129
116 3300005367 Ga0070667_100013827 Ga0070667_1000138274 129
117 3300005445 Ga0070708_100112100 Ga0070708_1001121002 129
118 3300005455 Ga0070663_100183736 Ga0070663_1001837362 129
119 3300005456 Ga0070678_100128356 Ga0070678_1001283563 129
120 3300005456 Ga0070678_100575462 Ga0070678_1005754622 129
121 3300005456 Ga0070678_101720572 Ga0070678_1017205721 129
122 3300005457 Ga0070662_100012608 Ga0070662_1000126081 129
123 3300005457 Ga0070662_100106638 Ga0070662_1001066384 129
124 3300005457 Ga0070662_100592626 Ga0070662_1005926261 129
125 3300005459 Ga0068867_100003306 Ga0068867_10000330611 129
126 3300005459 Ga0068867_100030156 Ga0068867_1000301568 129
127 3300005471 Ga0070698_100511538 Ga0070698_1005115382 129
128 3300005539 Ga0068853_100750545 Ga0068853_1007505452 129
129 3300005543 Ga0070672_100007141 Ga0070672_1000071414 129
130 3300005544 Ga0070686_100160724 Ga0070686_1001607243 129
131 3300005547 Ga0070693_100616067 Ga0070693_1006160671 129
132 3300005548 Ga0070665_100064377 Ga0070665_1000643773 129
133 3300005564 Ga0070664_100578050 Ga0070664_1005780502 129
134 3300005564 Ga0070664_101641869 Ga0070664_1016418691 129
135 3300005577 Ga0068857_101117447 Ga0068857_1011174471 129
136 3300005578 Ga0068854_100116445 Ga0068854_1001164453 129
137 3300005615 Ga0070702_100179570 Ga0070702_1001795702 129
138 3300005616 Ga0068852_100013930 Ga0068852_1000139303 129
139 3300005616 Ga0068852_100251947 Ga0068852_1002519472 129
140 3300005616 Ga0068852_100637998 Ga0068852_1006379982 129
141 3300005616 Ga0068852_102259936 Ga0068852_1022599361 129
142 3300005618 Ga0068864_100190964 Ga0068864_1001909643 129
143 3300005718 Ga0068866_10003593 Ga0068866_100035938 129
144 3300005719 Ga0068861_100005455 Ga0068861_1000054556 129
145 3300005719 Ga0068861_100464198 Ga0068861_1004641982 129
146 3300005834 Ga0068851_10386730 Ga0068851_103867301 129
147 3300005841 Ga0068863_100002824 Ga0068863_1000028244 129
148 3300005842 Ga0068858_100010674 Ga0068858_1000106749 129
149 3300005843 Ga0068860_100007028 Ga0068860_10000702812 129
150 3300005844 Ga0068862_100013949 Ga0068862_10001394910 129
151 3300005844 Ga0068862_101431658 Ga0068862_1014316581 129
152 3300006038 Ga0075365_10425629 Ga0075365_104256291 129
153 3300006042 Ga0075368_10078706 Ga0075368_100787062 129
154 3300006048 Ga0075363_100007329 Ga0075363_1000073298 129
155 3300006051 Ga0075364_10154203 Ga0075364_101542033 129
156 3300006051 Ga0075364_10287675 Ga0075364_102876752 129
157 3300006173 Ga0070716_100256549 Ga0070716_1002565492 129
158 3300006177 Ga0075362_10001978 Ga0075362_100019782 129
159 3300006178 Ga0075367_10022821 Ga0075367_100228216 129
160 3300006186 Ga0075369_10113087 Ga0075369_101130872 129
161 3300006186 Ga0075369_10124357 Ga0075369_101243572 129
162 3300006195 Ga0075366_10179092 Ga0075366_101790922 129
163 3300006353 Ga0075370_10049853 Ga0075370_100498533 129
164 3300006358 Ga0068871_102062037 Ga0068871_1020620371 129
165 3300006844 Ga0075428_100051294 Ga0075428_1000512944 129
166 3300006846 Ga0075430_100092509 Ga0075430_1000925092 129
167 3300006847 Ga0075431_100010577 Ga0075431_10001057712 129
168 3300006881 Ga0068865_100021975 Ga0068865_1000219756 129
169 3300006946 Ga0079104_1032445 Ga0079104_10324453 129
170 3300009094 Ga0111539_11532973 Ga0111539_115329732 129
171 3300009098 Ga0105245_10404959 Ga0105245_104049592 129
172 3300009147 Ga0114129_10079993 Ga0114129_100799936 129
173 3300009147 Ga0114129_10427559 Ga0114129_104275593 129
174 3300009148 Ga0105243_10016897 Ga0105243_100168977 129
175 3300009148 Ga0105243_10800006 Ga0105243_108000062 129
176 3300009176 Ga0105242_10080707 Ga0105242_100807074 129
177 3300009176 Ga0105242_11161427 Ga0105242_111614272 129
178 3300009177 Ga0105248_10740922 Ga0105248_107409221 129
179 3300009177 Ga0105248_10809381 Ga0105248_108093812 129
180 3300009551 Ga0105238_10878268 Ga0105238_108782682 129
181 3300009553 Ga0105249_10021446 Ga0105249_100214467 129
182 3300013297 Ga0157378_10032390 Ga0157378_100323907 129
183 3300013297 Ga0157378_10304496 Ga0157378_103044963 129
184 3300013306 Ga0163162_10007658 Ga0163162_1000765812 129
185 3300013306 Ga0163162_11120272 Ga0163162_111202722 129
186 3300013308 Ga0157375_10008662 Ga0157375_100086624 129
187 3300014326 Ga0157380_10006484 Ga0157380_100064849 129
188 3300014326 Ga0157380_10880134 Ga0157380_108801342 129
189 3300017792 Ga0163161_10004917 Ga0163161_100049179 129
190 3300025245 Ga0207425_1002316 Ga0207425_10023167 129
191 3300025245 Ga0207425_1010907 Ga0207425_10109072 129
192 3300025258 Ga0209129_1008850 Ga0209129_10088502 129
193 3300025263 Ga0209565_1000026 Ga0209565_1000026190 129
194 3300025263 Ga0209565_1001771 Ga0209565_10017717 129
195 3300025273 Ga0209673_1000009 Ga0209673_1000009197 129
196 3300025284 Ga0209130_1000863 Ga0209130_100086321 129
197 3300025291 Ga0209675_1000849 Ga0209675_100084912 129
198 3300025292 Ga0209676_1000013 Ga0209676_100001344 129
199 3300025292 Ga0209676_1015738 Ga0209676_10157383 129
200 3300025294 Ga0209025_1006038 Ga0209025_10060385 129
201 3300025294 Ga0209025_1021226 Ga0209025_10212263 129
202 3300025294 Ga0209025_1029879 Ga0209025_10298793 129
203 3300025294 Ga0209025_1034015 Ga0209025_10340152 129
204 3300025295 Ga0209564_1000243 Ga0209564_10002433 129
205 3300025295 Ga0209564_1000676 Ga0209564_10006763 129
206 3300025295 Ga0209564_1016333 Ga0209564_10163332 129
207 3300025297 Ga0209758_1023858 Ga0209758_10238582 129
208 3300025298 Ga0209050_1000008 Ga0209050_100000844 129
209 3300025299 Ga0209256_1000003 Ga0209256_1000003352 129
210 3300025299 Ga0209256_1051099 Ga0209256_10510992 129
211 3300025302 Ga0207426_1005424 Ga0207426_10054246 129
212 3300025303 Ga0209051_1000005 Ga0209051_100000544 129
213 3300025303 Ga0209051_1067323 Ga0209051_10673232 129
214 3300025304 Ga0209257_1000048 Ga0209257_100004844 129
215 3300025304 Ga0209257_1022646 Ga0209257_10226463 129
216 3300025315 Ga0207697_10143720 Ga0207697_101437202 129
217 3300025321 Ga0207656_10330112 Ga0207656_103301121 129
218 3300025893 Ga0207682_10038333 Ga0207682_100383332 129
219 3300025899 Ga0207642_10013253 Ga0207642_100132533 129
220 3300025899 Ga0207642_10427750 Ga0207642_104277501 129
221 3300025904 Ga0207647_10203155 Ga0207647_102031552 129
222 3300025907 Ga0207645_10064873 Ga0207645_100648735 129
223 3300025907 Ga0207645_10155536 Ga0207645_101555363 129
224 3300025909 Ga0207705_10383845 Ga0207705_103838451 129
225 3300025918 Ga0207662_10015828 Ga0207662_100158282 129
226 3300025919 Ga0207657_10378630 Ga0207657_103786301 129
227 3300025920 Ga0207649_10220943 Ga0207649_102209433 129
228 3300025920 Ga0207649_10322642 Ga0207649_103226423 129
229 3300025922 Ga0207646_11046434 Ga0207646_110464342 129
230 3300025923 Ga0207681_10003285 Ga0207681_100032859 129
231 3300025923 Ga0207681_10136881 Ga0207681_101368812 129
232 3300025924 Ga0207694_10606665 Ga0207694_106066652 129
233 3300025925 Ga0207650_10274037 Ga0207650_102740373 129
234 3300025926 Ga0207659_10339085 Ga0207659_103390851 129
235 3300025926 Ga0207659_10353097 Ga0207659_103530972 129
236 3300025932 Ga0207690_10093922 Ga0207690_100939222 129
237 3300025933 Ga0207706_10013686 Ga0207706_100136869 129
238 3300025933 Ga0207706_10593238 Ga0207706_105932382 129
239 3300025934 Ga0207686_10061530 Ga0207686_100615304 129
240 3300025935 Ga0207709_10052084 Ga0207709_100520845 129
241 3300025935 Ga0207709_10259143 Ga0207709_102591433 129
242 3300025936 Ga0207670_10380396 Ga0207670_103803962 129
243 3300025937 Ga0207669_10018238 Ga0207669_100182384 129
244 3300025937 Ga0207669_10047773 Ga0207669_100477735 129
245 3300025938 Ga0207704_10205129 Ga0207704_102051292 129
246 3300025938 Ga0207704_10230827 Ga0207704_102308272 129
247 3300025939 Ga0207665_10052296 Ga0207665_100522965 129
248 3300025940 Ga0207691_10004290 Ga0207691_100042908 129
249 3300025940 Ga0207691_10210807 Ga0207691_102108073 129
250 3300025940 Ga0207691_10503302 Ga0207691_105033023 129
251 3300025942 Ga0207689_10002311 Ga0207689_1000231119 129
252 3300025942 Ga0207689_10421561 Ga0207689_104215612 129
253 3300025945 Ga0207679_10121170 Ga0207679_101211703 129
254 3300025945 Ga0207679_10152599 Ga0207679_101525992 129
255 3300025960 Ga0207651_10580530 Ga0207651_105805302 129
256 3300025960 Ga0207651_10854187 Ga0207651_108541872 129
257 3300025961 Ga0207712_10044613 Ga0207712_100446133 129
258 3300025972 Ga0207668_10006717 Ga0207668_100067177 129
259 3300025986 Ga0207658_10040832 Ga0207658_100408328 129
260 3300026023 Ga0207677_10343701 Ga0207677_103437012 129
261 3300026035 Ga0207703_10004330 Ga0207703_1000433012 129
262 3300026075 Ga0207708_10071102 Ga0207708_100711022 129
263 3300026088 Ga0207641_10005332 Ga0207641_100053324 129
264 3300026089 Ga0207648_10006184 Ga0207648_100061849 129
265 3300026089 Ga0207648_10064744 Ga0207648_100647446 129
266 3300026089 Ga0207648_10208699 Ga0207648_102086994 129
267 3300026089 Ga0207648_12204687 Ga0207648_122046871 129
268 3300026118 Ga0207675_100011271 Ga0207675_1000112717 129
269 3300026118 Ga0207675_100187271 Ga0207675_1001872714 129
270 3300026121 Ga0207683_10104945 Ga0207683_101049454 129
271 3300026121 Ga0207683_10235133 Ga0207683_102351332 129
272 3300026142 Ga0207698_10030718 Ga0207698_100307183 129
273 3300026142 Ga0207698_10526931 Ga0207698_105269312 129
274 3300027111 Ga0209281_1014949 Ga0209281_10149491 129
275 3300028379 Ga0268266_10100231 Ga0268266_101002313 129
276 3300028380 Ga0268265_10020791 Ga0268265_100207918 129
277 3300028380 Ga0268265_11418123 Ga0268265_114181231 129
278 3300028381 Ga0268264_10001473 Ga0268264_1000147327 129
279 3300031548 Ga0307408_100002845 Ga0307408_1000028453 129
280 3300032126 Ga0307415_101932838 Ga0307415_1019328382 129
281 3300041456 Ga0451795_1572657 Ga0451795_1572657_38_427 129
282 3300041459 Ga0451800_0284904 Ga0451800_0284904_209_679 129
283 3300041486 Ga0451807_1834078 Ga0451807_1834078_457_846 129
284 3300041512 Ga0451853_0031700 Ga0451853_0031700_1047_1514 129
285 3300041512 Ga0451853_3958630 Ga0451853_3958630_29_418 129
286 3300042435 Ga0439434_0282696 Ga0439434_0282696_120_509 129
287 3300046455 Ga0495603_0165742 Ga0495603_0165742_549_938 129
288 3300046492 Ga0495585_0489270 Ga0495585_0489270_160_549 129
289 3300046506 Ga0495583_0000141 Ga0495583_0000141_48165_48554 129
290 3300046537 Ga0495598_0150332 Ga0495598_0150332_348_737 129
291 3300046538 Ga0495609_0150682 Ga0495609_0150682_194_583 129
292 3300046558 Ga0495633_0045070 Ga0495633_0045070_107_496 129
293 3300046691 Ga0495670_0018727 Ga0495670_0018727_858_1247 129
294 3300046692 Ga0495671_0428424 Ga0495671_0428424_95_484 129
295 3300048091 Ga0495626_0024909 Ga0495626_0024909_502_891 129
296 3300048903 Ga0496100_1402119 Ga0496100_1402119_64_453 129
297 3300048911 Ga0496108_0422753 Ga0496108_0422753_534_923 129
298 3300050489 nmdc:mga03683_323177_c1 nmdc:mga03683_323177_c1_103_492 129
299 3300050491 nmdc:mga00v17_316372_c1 nmdc:mga00v17_316372_c1_446_835 129
300 3300050491 nmdc:mga00v17_364495_c1 nmdc:mga00v17_364495_c1_125_514 129
301 3300050494 nmdc:mga06z11_51372_c1 nmdc:mga06z11_51372_c1_1686_2075 129
302 3300050495 nmdc:mga04h51_474697_c1 nmdc:mga04h51_474697_c1_62_451 129
303 3300050496 nmdc:mga07m45_40941_c1 nmdc:mga07m45_40941_c1_184_573 129
304 3300050507 nmdc:mga05p37_12853_c1 nmdc:mga05p37_12853_c1_1451_1840 129
305 3300050509 nmdc:mga0qj67_84826_c1 nmdc:mga0qj67_84826_c1_994_1383 129
306 3300050510 nmdc:mga06r32_9868_c1 nmdc:mga06r32_9868_c1_2425_2829 129
307 3300053735 Ga0500596_027066 Ga0500596_027066_115_504 129
308 iso_pu_bacteria 2643221644 2644246828 129
309 3300003323 rootH1_10198405 rootH1_101984053 130
310 3300005445 Ga0070708_100063017 Ga0070708_1000630172 130
311 3300005467 Ga0070706_100181709 Ga0070706_1001817092 130
312 3300005518 Ga0070699_100957521 Ga0070699_1009575212 130
313 3300005536 Ga0070697_100093303 Ga0070697_1000933031 130
314 3300006871 Ga0075434_100278625 Ga0075434_1002786251 130
315 3300006914 Ga0075436_100704756 Ga0075436_1007047562 130
316 3300009553 Ga0105249_12223686 Ga0105249_122236861 130
317 3300025910 Ga0207684_10022188 Ga0207684_100221885 130
318 3300045051 Ga0451576_0651378 Ga0451576_0651378_461_871 130
319 3300050512 nmdc:mga0n895_63633_c1 nmdc:mga0n895_63633_c1_1422_1823 130
320 3300003347 JGI26128J50194_1003445 JGI26128J50194_10034451 131
321 3300003371 JGI26145J50221_1006004 JGI26145J50221_10060041 131
322 3300003503 JGI26141J51220_1001960 JGI26141J51220_10019601 131
323 3300003775 Ga0055524_1000029 Ga0055524_1000029102 131
324 3300005295 Ga0065707_10381511 Ga0065707_103815112 131
325 3300005295 Ga0065707_11091181 Ga0065707_110911811 131
326 3300005328 Ga0070676_10029151 Ga0070676_100291513 131
327 3300005334 Ga0068869_100000898 Ga0068869_10000089812 131
328 3300005341 Ga0070691_10027353 Ga0070691_100273531 131
329 3300005353 Ga0070669_100198605 Ga0070669_1001986052 131
330 3300005353 Ga0070669_100444500 Ga0070669_1004445002 131
331 3300005353 Ga0070669_100944654 Ga0070669_1009446542 131
332 3300005438 Ga0070701_10182760 Ga0070701_101827602 131
333 3300005444 Ga0070694_100008315 Ga0070694_1000083157 131
334 3300005444 Ga0070694_100008926 Ga0070694_1000089263 131
335 3300005444 Ga0070694_100022552 Ga0070694_1000225523 131
336 3300005444 Ga0070694_100822852 Ga0070694_1008228522 131
337 3300005445 Ga0070708_100021577 Ga0070708_1000215772 131
338 3300005457 Ga0070662_100026440 Ga0070662_1000264404 131
339 3300005467 Ga0070706_100005973 Ga0070706_10000597310 131
340 3300005467 Ga0070706_100609017 Ga0070706_1006090172 131
341 3300005471 Ga0070698_100880552 Ga0070698_1008805522 131
342 3300005518 Ga0070699_100282221 Ga0070699_1002822213 131
343 3300005536 Ga0070697_100117793 Ga0070697_1001177932 131
344 3300005543 Ga0070672_100645710 Ga0070672_1006457102 131
345 3300005545 Ga0070695_100007759 Ga0070695_1000077597 131
346 3300005545 Ga0070695_100008268 Ga0070695_1000082684 131
347 3300005545 Ga0070695_100008555 Ga0070695_1000085553 131
348 3300005546 Ga0070696_100026544 Ga0070696_1000265443 131
349 3300005546 Ga0070696_100214630 Ga0070696_1002146302 131
350 3300005546 Ga0070696_100230751 Ga0070696_1002307512 131
351 3300005547 Ga0070693_100031753 Ga0070693_1000317533 131
352 3300005563 Ga0068855_100666291 Ga0068855_1006662912 131
353 3300005578 Ga0068854_100730738 Ga0068854_1007307382 131
354 3300005617 Ga0068859_100405292 Ga0068859_1004052923 131
355 3300005618 Ga0068864_100462589 Ga0068864_1004625892 131
356 3300005618 Ga0068864_101608538 Ga0068864_1016085382 131
357 3300005841 Ga0068863_101042109 Ga0068863_1010421091 131
358 3300005843 Ga0068860_100102520 Ga0068860_1001025203 131
359 3300005843 Ga0068860_100113610 Ga0068860_1001136103 131
360 3300005843 Ga0068860_100257945 Ga0068860_1002579452 131
361 3300005843 Ga0068860_100352507 Ga0068860_1003525072 131
362 3300005844 Ga0068862_100071518 Ga0068862_1000715183 131
363 3300005844 Ga0068862_100172908 Ga0068862_1001729082 131
364 3300005844 Ga0068862_100507472 Ga0068862_1005074723 131
365 3300005844 Ga0068862_101884837 Ga0068862_1018848371 131
366 3300005844 Ga0068862_102403276 Ga0068862_1024032761 131
367 3300005937 Ga0081455_10002385 Ga0081455_1000238512 131
368 3300006844 Ga0075428_100062294 Ga0075428_1000622941 131
369 3300006844 Ga0075428_100358192 Ga0075428_1003581922 131
370 3300006844 Ga0075428_100523903 Ga0075428_1005239032 131
371 3300006844 Ga0075428_100643712 Ga0075428_1006437122 131
372 3300006846 Ga0075430_100064814 Ga0075430_1000648142 131
373 3300006846 Ga0075430_100369136 Ga0075430_1003691362 131
374 3300006847 Ga0075431_100117952 Ga0075431_1001179523 131
375 3300006847 Ga0075431_100172837 Ga0075431_1001728372 131
376 3300006852 Ga0075433_10093981 Ga0075433_100939813 131
377 3300006852 Ga0075433_10141078 Ga0075433_101410783 131
378 3300006871 Ga0075434_100035260 Ga0075434_1000352604 131
379 3300006880 Ga0075429_100008503 Ga0075429_1000085034 131
380 3300006880 Ga0075429_100134337 Ga0075429_1001343372 131
381 3300006914 Ga0075436_100057203 Ga0075436_1000572031 131
382 3300006931 Ga0097620_100405298 Ga0097620_1004052983 131
383 3300007076 Ga0075435_100010391 Ga0075435_1000103916 131
384 3300007265 Ga0099794_10092677 Ga0099794_100926773 131
385 3300009094 Ga0111539_10011026 Ga0111539_100110263 131
386 3300009094 Ga0111539_10015091 Ga0111539_100150919 131
387 3300009094 Ga0111539_10151445 Ga0111539_101514453 131
388 3300009094 Ga0111539_11469757 Ga0111539_114697571 131
389 3300009098 Ga0105245_10361313 Ga0105245_103613132 131
390 3300009101 Ga0105247_10624041 Ga0105247_106240412 131
391 3300009147 Ga0114129_10007626 Ga0114129_1000762614 131
392 3300009147 Ga0114129_10056533 Ga0114129_100565338 131
393 3300009147 Ga0114129_10394839 Ga0114129_103948392 131
394 3300009147 Ga0114129_10535554 Ga0114129_105355542 131
395 3300009148 Ga0105243_10315268 Ga0105243_103152682 131
396 3300009174 Ga0105241_10102678 Ga0105241_101026782 131
397 3300009177 Ga0105248_10407936 Ga0105248_104079362 131
398 3300009177 Ga0105248_11454080 Ga0105248_114540802 131
399 3300009177 Ga0105248_12109876 Ga0105248_121098762 131
400 3300009553 Ga0105249_10074121 Ga0105249_100741213 131
401 3300009553 Ga0105249_11378937 Ga0105249_113789372 131
402 3300009553 Ga0105249_11519218 Ga0105249_115192182 131
403 3300013297 Ga0157378_11431285 Ga0157378_114312852 131
404 3300013306 Ga0163162_10368365 Ga0163162_103683652 131
405 3300013306 Ga0163162_10692915 Ga0163162_106929152 131
406 3300013308 Ga0157375_10144413 Ga0157375_101444132 131
407 3300014326 Ga0157380_10454145 Ga0157380_104541451 131
408 3300014326 Ga0157380_10884997 Ga0157380_108849972 131
409 3300014968 Ga0157379_10280311 Ga0157379_102803113 131
410 3300014968 Ga0157379_11731583 Ga0157379_117315831 131
411 3300025263 Ga0209565_1003658 Ga0209565_10036586 131
412 3300025291 Ga0209675_1044783 Ga0209675_10447831 131
413 3300025299 Ga0209256_1000013 Ga0209256_1000013101 131
414 3300025907 Ga0207645_10021628 Ga0207645_100216283 131
415 3300025910 Ga0207684_10019480 Ga0207684_100194806 131
416 3300025910 Ga0207684_10055957 Ga0207684_100559573 131
417 3300025910 Ga0207684_10246497 Ga0207684_102464973 131
418 3300025910 Ga0207684_10289988 Ga0207684_102899883 131
419 3300025911 Ga0207654_10046321 Ga0207654_100463212 131
420 3300025918 Ga0207662_10933352 Ga0207662_109333522 131
421 3300025922 Ga0207646_10058994 Ga0207646_100589944 131
422 3300025922 Ga0207646_10927500 Ga0207646_109275002 131
423 3300025923 Ga0207681_10233218 Ga0207681_102332182 131
424 3300025927 Ga0207687_10053993 Ga0207687_100539933 131
425 3300025933 Ga0207706_10017989 Ga0207706_100179895 131
426 3300025933 Ga0207706_10154981 Ga0207706_101549813 131
427 3300025941 Ga0207711_10160205 Ga0207711_101602053 131
428 3300025941 Ga0207711_10680072 Ga0207711_106800722 131
429 3300025942 Ga0207689_10016669 Ga0207689_100166692 131
430 3300025942 Ga0207689_10174704 Ga0207689_101747042 131
431 3300025961 Ga0207712_10765210 Ga0207712_107652102 131
432 3300026035 Ga0207703_10219485 Ga0207703_102194853 131
433 3300026035 Ga0207703_10509184 Ga0207703_105091842 131
434 3300026088 Ga0207641_10956933 Ga0207641_109569332 131
435 3300026088 Ga0207641_11128472 Ga0207641_111284721 131
436 3300026089 Ga0207648_10377461 Ga0207648_103774613 131
437 3300026095 Ga0207676_11793955 Ga0207676_117939551 131
438 3300026118 Ga0207675_100039997 Ga0207675_1000399971 131
439 3300026118 Ga0207675_100111477 Ga0207675_1001114773 131
440 3300027395 Ga0209996_1002811 Ga0209996_10028112 131
441 3300027462 Ga0210000_1002988 Ga0210000_10029883 131
442 3300027526 Ga0209968_1012920 Ga0209968_10129202 131
443 3300027543 Ga0209999_1000254 Ga0209999_10002542 131
444 3300027665 Ga0209983_1000432 Ga0209983_10004324 131
445 3300027671 Ga0209588_1033754 Ga0209588_10337543 131
446 3300027682 Ga0209971_1000001 Ga0209971_100000151 131
447 3300027695 Ga0209966_1000049 Ga0209966_100004910 131
448 3300027717 Ga0209998_10000044 Ga0209998_1000004411 131
449 3300027876 Ga0209974_10010678 Ga0209974_100106784 131
450 3300027907 Ga0207428_10033155 Ga0207428_100331554 131
451 3300027907 Ga0207428_10069498 Ga0207428_100694983 131
452 3300027907 Ga0207428_10750580 Ga0207428_107505802 131
453 3300028380 Ga0268265_10012563 Ga0268265_100125635 131
454 3300028380 Ga0268265_10098334 Ga0268265_100983342 131
455 3300028381 Ga0268264_10017747 Ga0268264_100177473 131
456 3300028381 Ga0268264_11835220 Ga0268264_118352202 131
457 3300032005 Ga0307411_10135132 Ga0307411_101351324 131
458 3300042005 Ga0439448_0042699 Ga0439448_0042699_1027_1437 131
459 3300042436 Ga0439435_0072766 Ga0439435_0072766_411_806 131
460 3300042461 Ga0439460_0001532 Ga0439460_0001532_3973_4383 131
461 3300042876 Ga0451577_0053258 Ga0451577_0053258_2471_2887 131
462 3300042876 Ga0451577_0075119 Ga0451577_0075119_1250_1666 131
463 3300044673 Ga0453683_0223815 Ga0453683_0223815_359_763 131
464 3300044673 Ga0453683_0636413 Ga0453683_0636413_57_461 131
465 3300044712 Ga0453684_0066299 Ga0453684_0066299_588_1004 131
466 3300044712 Ga0453684_1040859 Ga0453684_1040859_119_535 131
467 3300045051 Ga0451576_0022999 Ga0451576_0022999_3479_3880 131
468 3300045051 Ga0451576_0158110 Ga0451576_0158110_123_539 131
469 3300045051 Ga0451576_0963395 Ga0451576_0963395_40_456 131
470 3300045051 Ga0451576_1708614 Ga0451576_1708614_167_583 131
471 3300046455 Ga0495603_0133576 Ga0495603_0133576_354_758 131
472 3300046472 Ga0495580_0041159 Ga0495580_0041159_932_1333 131
473 3300046499 Ga0495594_0177545 Ga0495594_0177545_780_1184 131
474 3300046537 Ga0495598_0230105 Ga0495598_0230105_213_617 131
475 3300046615 Ga0495656_0117759 Ga0495656_0117759_609_1013 131
476 3300046648 Ga0495611_0532183 Ga0495611_0532183_69_473 131
477 3300046674 Ga0495588_0188988 Ga0495588_0188988_337_741 131
478 3300049572 Ga0501036_0551725 Ga0501036_0551725_198_608 131
479 3300049573 Ga0501037_0049366 Ga0501037_0049366_2201_2611 131
480 3300049574 Ga0501038_0104578 Ga0501038_0104578_750_1160 131
481 3300049574 Ga0501038_0404925 Ga0501038_0404925_26_442 131
482 3300049575 Ga0501039_0035784 Ga0501039_0035784_2263_2673 131
483 3300049576 Ga0501040_0021676 Ga0501040_0021676_2956_3366 131
484 3300049577 Ga0501041_0011996 Ga0501041_0011996_3013_3423 131
485 3300049578 Ga0501042_0035058 Ga0501042_0035058_2008_2418 131
486 3300049578 Ga0501042_0239934 Ga0501042_0239934_277_693 131
487 3300049580 Ga0501046_0088951 Ga0501046_0088951_633_1049 131
488 3300049582 Ga0501048_0011079 Ga0501048_0011079_5577_5987 131
489 3300049582 Ga0501048_0409819 Ga0501048_0409819_11_427 131
490 3300049582 Ga0501048_1210598 Ga0501048_1210598_84_500 131
491 3300049584 Ga0501068_0098200 Ga0501068_0098200_104_520 131
492 3300049584 Ga0501068_0151229 Ga0501068_0151229_23_466 131
493 3300049584 Ga0501068_0156228 Ga0501068_0156228_874_1284 131
494 3300049587 Ga0501071_0162774 Ga0501071_0162774_453_863 131
495 3300049590 Ga0501074_0671869 Ga0501074_0671869_191_607 131
496 3300049591 Ga0501075_0021077 Ga0501075_0021077_4040_4450 131
497 3300049591 Ga0501075_0246977 Ga0501075_0246977_270_713 131
498 3300049591 Ga0501075_0368149 Ga0501075_0368149_661_1065 131
499 3300049592 Ga0501076_0268658 Ga0501076_0268658_303_707 131
500 3300049593 Ga0501077_0005676 Ga0501077_0005676_6051_6461 131
501 3300049593 Ga0501077_0133035 Ga0501077_0133035_455_871 131
502 3300049741 Ga0501079_0005459 Ga0501079_0005459_2096_2506 131
503 3300049741 Ga0501079_0394864 Ga0501079_0394864_91_495 131
504 3300049741 Ga0501079_0954997 Ga0501079_0954997_209_625 131
505 3300049742 Ga0501080_0239367 Ga0501080_0239367_420_830 131
506 3300049742 Ga0501080_0456334 Ga0501080_0456334_11_427 131
507 3300049743 Ga0501081_0023584 Ga0501081_0023584_864_1274 131
508 3300049743 Ga0501081_0272854 Ga0501081_0272854_47_463 131
509 3300049743 Ga0501081_1315351 Ga0501081_1315351_58_462 131
510 3300049744 Ga0501083_0048580 Ga0501083_0048580_552_962 131
511 3300049744 Ga0501083_0078918 Ga0501083_0078918_637_1047 131
512 3300049822 Ga0501035_0171413 Ga0501035_0171413_521_931 131
513 3300049824 Ga0501045_0000334 Ga0501045_0000334_26943_27353 131
514 3300050507 nmdc:mga05p37_308500_c1 nmdc:mga05p37_308500_c1_1447_1857 131
515 3300050507 nmdc:mga05p37_32315_c1 nmdc:mga05p37_32315_c1_4890_5294 131
516 3300050507 nmdc:mga05p37_434067_c1 nmdc:mga05p37_434067_c1_403_807 131
517 3300050508 nmdc:mga09592_296722_c1 nmdc:mga09592_296722_c1_557_961 131
518 3300050508 nmdc:mga09592_57125_c1 nmdc:mga09592_57125_c1_633_1043 131
519 3300050508 nmdc:mga09592_98309_c1 nmdc:mga09592_98309_c1_1510_1914 131
520 3300050509 nmdc:mga0qj67_446861_c1 nmdc:mga0qj67_446861_c1_385_789 131
521 3300050510 nmdc:mga06r32_22654_c1 nmdc:mga06r32_22654_c1_5215_5619 131
522 3300050511 nmdc:mga08y16_13509_c1 nmdc:mga08y16_13509_c1_2072_2482 131
523 3300050511 nmdc:mga08y16_162719_c1 nmdc:mga08y16_162719_c1_1708_2112 131
524 3300050511 nmdc:mga08y16_204863_c1 nmdc:mga08y16_204863_c1_965_1369 131
525 3300050511 nmdc:mga08y16_939691_c1 nmdc:mga08y16_939691_c1_163_573 131
526 3300050512 nmdc:mga0n895_247767_c1 nmdc:mga0n895_247767_c1_665_1069 131
527 3300050512 nmdc:mga0n895_47512_c1 nmdc:mga0n895_47512_c1_1475_1885 131
528 3300050513 nmdc:mga0rr50_14691_c1 nmdc:mga0rr50_14691_c1_4716_5126 131
529 3300050515 nmdc:mga0a205_51835_c1 nmdc:mga0a205_51835_c1_21_431 131
530 3300050515 nmdc:mga0a205_7653_c1 nmdc:mga0a205_7653_c1_5925_6335 131
531 3300050515 nmdc:mga0a205_97130_c1 nmdc:mga0a205_97130_c1_1798_2202 131
532 3300054114 Ga0501084_0003207 Ga0501084_0003207_10558_10968 131
533 3300054114 Ga0501084_0114165 Ga0501084_0114165_584_988 131
534 3300054114 Ga0501084_0120784 Ga0501084_0120784_1276_1692 131
535 3300060353 Ga0501082_0042073 Ga0501082_0042073_996_1412 131
536 3300060353 Ga0501082_0098200 Ga0501082_0098200_1260_1670 131
537 3300061734 Ga0530510_0056715 Ga0530510_0056715_1810_2214 131
538 3300061734 Ga0530510_0094342 Ga0530510_0094342_587_1003 131
539 3300061734 Ga0530510_0096888 Ga0530510_0096888_485_901 131
540 3300061734 Ga0530510_0128015 Ga0530510_0128015_929_1339 131
541 3300005339 Ga0070660_100368146 Ga0070660_1003681462 132
542 3300005344 Ga0070661_100005150 Ga0070661_1000051508 132
543 3300005366 Ga0070659_100000722 Ga0070659_1000007228 132
544 3300005445 Ga0070708_100000602 Ga0070708_10000060223 132
545 3300005467 Ga0070706_100034961 Ga0070706_1000349612 132
546 3300005467 Ga0070706_100326296 Ga0070706_1003262962 132
547 3300005468 Ga0070707_100062028 Ga0070707_1000620282 132
548 3300005471 Ga0070698_100041080 Ga0070698_1000410803 132
549 3300005471 Ga0070698_100468235 Ga0070698_1004682352 132
550 3300005518 Ga0070699_100004312 Ga0070699_1000043126 132
551 3300005518 Ga0070699_100284486 Ga0070699_1002844863 132
552 3300005536 Ga0070697_100009950 Ga0070697_1000099506 132
553 3300005536 Ga0070697_100892617 Ga0070697_1008926172 132
554 3300005536 Ga0070697_100999370 Ga0070697_1009993701 132
555 3300005549 Ga0070704_101245891 Ga0070704_1012458911 132
556 3300005564 Ga0070664_100029878 Ga0070664_1000298785 132
557 3300025910 Ga0207684_10000546 Ga0207684_100005467 132
558 3300025910 Ga0207684_10001016 Ga0207684_1000101629 132
559 3300025910 Ga0207684_10003757 Ga0207684_100037579 132
560 3300025910 Ga0207684_10305655 Ga0207684_103056552 132
561 3300025919 Ga0207657_10166589 Ga0207657_101665892 132
562 3300025920 Ga0207649_10919925 Ga0207649_109199251 132
563 3300025922 Ga0207646_10001810 Ga0207646_100018106 132
564 3300025922 Ga0207646_10234950 Ga0207646_102349502 132
565 3300025932 Ga0207690_10195516 Ga0207690_101955162 132
566 3300025945 Ga0207679_10009574 Ga0207679_100095747 132
567 3300042876 Ga0451577_0301869 Ga0451577_0301869_837_1244 132
568 3300046506 Ga0495583_0032113 Ga0495583_0032113_1493_1891 132
569 3300005334 Ga0068869_100004925 Ga0068869_1000049252 133
570 3300005335 Ga0070666_10090973 Ga0070666_100909732 133
571 3300005338 Ga0068868_100104562 Ga0068868_1001045622 133
572 3300005354 Ga0070675_101249222 Ga0070675_1012492221 133
573 3300005355 Ga0070671_101026058 Ga0070671_1010260581 133
574 3300005364 Ga0070673_100110725 Ga0070673_1001107253 133
575 3300005367 Ga0070667_100979273 Ga0070667_1009792732 133
576 3300005459 Ga0068867_100446934 Ga0068867_1004469342 133
577 3300005543 Ga0070672_101636288 Ga0070672_1016362881 133
578 3300005549 Ga0070704_100348486 Ga0070704_1003484862 133
579 3300005577 Ga0068857_100682070 Ga0068857_1006820701 133
580 3300005615 Ga0070702_100779239 Ga0070702_1007792391 133
581 3300005718 Ga0068866_10113195 Ga0068866_101131953 133
582 3300005843 Ga0068860_100038436 Ga0068860_1000384364 133
583 3300005844 Ga0068862_100052009 Ga0068862_1000520092 133
584 3300006177 Ga0075362_10288032 Ga0075362_102880322 133
585 3300006237 Ga0097621_100066987 Ga0097621_1000669875 133
586 3300009148 Ga0105243_12434419 Ga0105243_124344191 133
587 3300009176 Ga0105242_10161452 Ga0105242_101614522 133
588 3300009177 Ga0105248_10013164 Ga0105248_1001316413 133
589 3300010375 Ga0105239_10872097 Ga0105239_108720972 133
590 3300013296 Ga0157374_11458285 Ga0157374_114582852 133
591 3300013297 Ga0157378_11068274 Ga0157378_110682741 133
592 3300014968 Ga0157379_11150841 Ga0157379_111508412 133
593 3300014969 Ga0157376_10006466 Ga0157376_100064669 133
594 3300025295 Ga0209564_1009676 Ga0209564_10096763 133
595 3300025934 Ga0207686_10613648 Ga0207686_106136482 133
596 3300025935 Ga0207709_10095072 Ga0207709_100950723 133
597 3300025940 Ga0207691_10817299 Ga0207691_108172991 133
598 3300025941 Ga0207711_10026819 Ga0207711_100268191 133
599 3300025942 Ga0207689_10003107 Ga0207689_100031074 133
600 3300025960 Ga0207651_10352495 Ga0207651_103524952 133
601 3300025986 Ga0207658_12065207 Ga0207658_120652071 133
602 3300026023 Ga0207677_12234239 Ga0207677_122342391 133
603 3300026089 Ga0207648_10587761 Ga0207648_105877611 133
604 3300026121 Ga0207683_10116115 Ga0207683_101161151 133
605 3300028380 Ga0268265_10257232 Ga0268265_102572322 133
606 3300042121 Ga0450919_001422 Ga0450919_001422_1996_2397 133
607 3300042531 Ga0450918_000280 Ga0450918_000280_6069_6470 133
608 3300046692 Ga0495671_0018740 Ga0495671_0018740_1074_1475 133
609 3300002704 JGI25155J39150_1000028 JGI25155J39150_10000285 134
610 3300002705 JGI25156J39149_1000013 JGI25156J39149_1000013108 134
611 3300002738 JGI25154J39366_1000032 JGI25154J39366_1000032108 134
612 3300002741 JGI25157J39369_1000017 JGI25157J39369_1000017108 134
613 3300005356 Ga0070674_100999369 Ga0070674_1009993692 134
614 3300005406 Ga0070703_10457783 Ga0070703_104577831 134
615 3300009148 Ga0105243_11547254 Ga0105243_115472542 134
616 3300025206 Ga0209435_100003 Ga0209435_10000363 134
617 3300025246 Ga0209646_1000008 Ga0209646_100000863 134
618 3300025250 Ga0209026_1000007 Ga0209026_100000763 134
619 3300025256 Ga0209759_1000026 Ga0209759_1000026216 134
620 3300025921 Ga0207652_10296919 Ga0207652_102969191 134
621 3300041451 Ga0451791_1367803 Ga0451791_1367803_128_535 134
622 3300047318 Ga0495636_0198395 Ga0495636_0198395_224_637 134

Structural Annotation

Top 5 Hits

ID Description Score Start End
8he6-assembly1.cif.gz_B crystal structure of a fosfomycin and bleomycin resistant protein (all3014) from anabaena/nostoc cyanobacterium at 1.70 a resolution 0.9686 1 123
8he6-assembly1.cif.gz_B crystal structure of a fosfomycin and bleomycin resistant protein (all3014) from anabaena/nostoc cyanobacterium at 1.70 a resolution 0.9607 1 123
6a4x-assembly1.cif.gz_A-2 oxidase chap-h2 0.9535 1 125
6a52-assembly1.cif.gz_A oxidase chap-h1 0.9462 2 126
6a52-assembly1.cif.gz_A oxidase chap-h1 0.9389 2 126
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8049 59 121 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7809 61 119 3.30.720.110
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7744 6 121 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7672 59 121 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7583 60 123 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A4V1TRZ8-F1-model_v4 VOC family protein 0.9905 1 126
AF-A0A3M8SX28-F1-model_v4 VOC family protein 0.9894 1 126
AF-A0A2V7C324-F1-model_v4 VOC family protein 0.9841 1 126
AF-A0A2E2VH65-F1-model_v4 Bleomycin resistance protein 0.9735 1 123
AF-A0A2K8SFT2-F1-model_v4 Catechol 2,3-dioxygenase or other lactoylglutathione lyase family enzyme 0.9728 43 123 GO:0016829
GO:0051213

Feature Viewer

pLDDT pTM Quality
93.94 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map