F470119

General Info

Members Datasets Scaffolds Average Seq Length
622 338 1244 152

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0089251|Ga0395901_0089251_2019_2558
Length 179
Sequence LDLLTGVLAAFRSMTPAGRSIVICTYVAQRYIVPNWFTRNVFNRFVAAMTRLGISVWGSRVLEVRGRESGQPRRTPVNVLTLDGTRYLVAPRGHTQWVRNLRAAGEGELLLGRRRDRFVASEVPDRDKEPILRAYLERWKWEVGQFFGGVDATSSSDDLRRIAPDHPIFRIETRGTVDR

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
172 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
173 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
174 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
212 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
213 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
332 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 2547132424 Nocardia nova SH22a Isolate Unclassified
335 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
336 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
337 2643221692 Nocardia sp. Root136 Isolate Unclassified
338 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0.8
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.93
Nodule 0
Rhizoplane 11.41
Rhizosphere 84.08
Stem 0
Stem Tuber 0
Unclassified 6.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0089251 3300038443 Bacteria 3226
2 JGI24034J26672_10119170 3300002239 Bacteria 509
3 Ga0070658_11175948 3300005327 Bacteria 667
4 Ga0070676_10203068 3300005328 Bacteria 1300
5 Ga0070683_100001633 3300005329 Bacteria 17360
6 Ga0070683_100455603 3300005329 Bacteria 1221
7 Ga0070683_101776237 3300005329 Bacteria 593
8 Ga0070677_10294130 3300005333 Bacteria 823
9 Ga0068869_100037481 3300005334 Bacteria 3447
10 Ga0070666_10884186 3300005335 Bacteria 660
11 Ga0070680_100099187 3300005336 Bacteria 2417
12 Ga0070680_100103318 3300005336 Bacteria 2367
13 Ga0070680_100230005 3300005336 Bacteria 1566
14 Ga0070680_100955547 3300005336 Bacteria 740
15 Ga0070682_100019914 3300005337 Bacteria 3941
16 Ga0070682_100026583 3300005337 Bacteria 3466
17 Ga0070682_101037394 3300005337 Bacteria 683
18 Ga0068868_100207301 3300005338 Bacteria 1637
19 Ga0070660_100942338 3300005339 Bacteria 729
20 Ga0070689_100163108 3300005340 Bacteria 1802
21 Ga0070689_100848261 3300005340 Bacteria 806
22 Ga0070691_10056507 3300005341 Bacteria 1881
23 Ga0070661_100584252 3300005344 Bacteria 902
24 Ga0070692_10255550 3300005345 Unclassified 1051
25 Ga0070669_100833426 3300005353 Unclassified 785
26 Ga0070669_100887836 3300005353 Bacteria 761
27 Ga0070675_100315117 3300005354 Bacteria 1381
28 Ga0070675_100634245 3300005354 Bacteria 971
29 Ga0070671_100681967 3300005355 Bacteria 891
30 Ga0070674_100009530 3300005356 Bacteria 5816
31 Ga0070673_100280741 3300005364 Bacteria 1461
32 Ga0070673_100976383 3300005364 Bacteria 788
33 Ga0070673_100997897 3300005364 Bacteria 779
34 Ga0070673_101228403 3300005364 Bacteria 703
35 Ga0070703_10316944 3300005406 Bacteria 655
36 Ga0070709_10066570 3300005434 Bacteria 2311
37 Ga0070709_10734037 3300005434 Bacteria 771
38 Ga0070714_100060850 3300005435 Bacteria 3242
39 Ga0070714_100111093 3300005435 Bacteria 2427
40 Ga0070714_100347083 3300005435 Bacteria 1393
41 Ga0070714_100800127 3300005435 Bacteria 913
42 Ga0070713_100244896 3300005436 Bacteria 1633
43 Ga0070713_101655793 3300005436 Unclassified 621
44 Ga0070710_10038777 3300005437 Bacteria 2618
45 Ga0070710_10047058 3300005437 Bacteria 2405
46 Ga0070710_10303142 3300005437 Bacteria 1043
47 Ga0070710_10688870 3300005437 Bacteria 720
48 Ga0070701_10129008 3300005438 Bacteria 1434
49 Ga0070711_100058009 3300005439 Bacteria 2683
50 Ga0070711_100143121 3300005439 Unclassified 1795
51 Ga0070711_101350731 3300005439 Bacteria 619
52 Ga0070705_100441448 3300005440 Bacteria 974
53 Ga0070705_100719787 3300005440 Bacteria 786
54 Ga0070700_100005875 3300005441 Bacteria 6521
55 Ga0070694_100358736 3300005444 Bacteria 1131
56 Ga0070694_100742033 3300005444 Bacteria 801
57 Ga0070708_100082126 3300005445 Bacteria 2919
58 Ga0070708_100923869 3300005445 Bacteria 819
59 Ga0070663_100057761 3300005455 Bacteria 2785
60 Ga0070678_100010432 3300005456 Bacteria 5676
61 Ga0070678_100013864 3300005456 Bacteria 5067
62 Ga0070678_100109286 3300005456 Bacteria 2160
63 Ga0070662_100040459 3300005457 Bacteria 3319
64 Ga0070681_10006222 3300005458 Bacteria 11601
65 Ga0070681_10103966 3300005458 Bacteria 2783
66 Ga0070681_11304981 3300005458 Bacteria 649
67 Ga0070685_10134903 3300005466 Bacteria 1547
68 Ga0070707_100129231 3300005468 Bacteria 2456
69 Ga0070707_100756356 3300005468 Bacteria 935
70 Ga0070698_100737366 3300005471 Bacteria 928
71 Ga0070699_100334743 3300005518 Bacteria 1362
72 Ga0070679_100017052 3300005530 Bacteria 7020
73 Ga0070684_100002599 3300005535 Bacteria 13327
74 Ga0070684_100613715 3300005535 Bacteria 1012
75 Ga0070684_100874993 3300005535 Bacteria 841
76 Ga0070697_100507064 3300005536 Bacteria 1055
77 Ga0070697_100864173 3300005536 Bacteria 802
78 Ga0070697_101539845 3300005536 Bacteria 594
79 Ga0068853_100125960 3300005539 Bacteria 2288
80 Ga0070672_100194089 3300005543 Bacteria 1696
81 Ga0070672_101635527 3300005543 Bacteria 578
82 Ga0070686_100157459 3300005544 Bacteria 1596
83 Ga0070686_100179639 3300005544 Bacteria 1502
84 Ga0070686_101000284 3300005544 Bacteria 686
85 Ga0070695_100253953 3300005545 Bacteria 1281
86 Ga0070696_100258789 3300005546 Bacteria 1319
87 Ga0070696_100487036 3300005546 Bacteria 979
88 Ga0070693_100091029 3300005547 Bacteria 1839
89 Ga0070693_100385487 3300005547 Bacteria 968
90 Ga0070665_100294961 3300005548 Bacteria 1624
91 Ga0070665_100892763 3300005548 Bacteria 901
92 Ga0070665_101052413 3300005548 Bacteria 826
93 Ga0070704_100046498 3300005549 Bacteria 3027
94 Ga0070704_100047441 3300005549 Bacteria 3002
95 Ga0070704_100419522 3300005549 Bacteria 1146
96 Ga0068855_100410530 3300005563 Bacteria 1482
97 Ga0070664_100489398 3300005564 Bacteria 1133
98 Ga0068857_100173287 3300005577 Bacteria 1962
99 Ga0068857_100661321 3300005577 Bacteria 991
100 Ga0068854_100055095 3300005578 Bacteria 2861
101 Ga0068856_100007847 3300005614 Bacteria 10423
102 Ga0068856_100008490 3300005614 Bacteria 9991
103 Ga0068856_100051880 3300005614 Bacteria 4044
104 Ga0068856_100123052 3300005614 Bacteria 2597
105 Ga0068856_100392208 3300005614 Bacteria 1408
106 Ga0070702_100043577 3300005615 Bacteria 2529
107 Ga0070702_100101535 3300005615 Bacteria 1765
108 Ga0068852_100253267 3300005616 Unclassified 1688
109 Ga0068859_100235600 3300005617 Unclassified 1919
110 Ga0068859_100946697 3300005617 Bacteria 945
111 Ga0068859_101307304 3300005617 Bacteria 799
112 Ga0068866_10183337 3300005718 Bacteria 1238
113 Ga0068861_100086262 3300005719 Unclassified 2467
114 Ga0068861_101107538 3300005719 Bacteria 761
115 Ga0068861_101180902 3300005719 Bacteria 739
116 Ga0068858_101912684 3300005842 Bacteria 586
117 Ga0068862_100249890 3300005844 Bacteria 1616
118 Ga0068862_101690406 3300005844 Bacteria 641
119 Ga0081538_10007182 3300005981 Bacteria 9671
120 Ga0081539_10010822 3300005985 Bacteria 7335
121 Ga0081539_10011499 3300005985 Bacteria 6989
122 Ga0075365_10575980 3300006038 Bacteria 796
123 Ga0075368_10263502 3300006042 Bacteria 738
124 Ga0075364_10238718 3300006051 Bacteria 1234
125 Ga0070715_10019256 3300006163 Bacteria 2614
126 Ga0070716_101577833 3300006173 Bacteria 538
127 Ga0070712_100007711 3300006175 Bacteria 6733
128 Ga0070712_100270253 3300006175 Bacteria 1365
129 Ga0070712_101087686 3300006175 Bacteria 694
130 Ga0097621_100027516 3300006237 Bacteria 4473
131 Ga0075370_10280860 3300006353 Bacteria 989
132 Ga0068871_100572815 3300006358 Bacteria 1024
133 Ga0075428_101696585 3300006844 Bacteria 659
134 Ga0075430_100021540 3300006846 Bacteria 5478
135 Ga0075433_10876782 3300006852 Unclassified 783
136 Ga0075434_100928524 3300006871 Bacteria 885
137 Ga0075429_100074822 3300006880 Bacteria 2950
138 Ga0068865_100002260 3300006881 Bacteria 11338
139 Ga0068865_100258766 3300006881 Bacteria 1377
140 Ga0097620_100235595 3300006931 Unclassified 1919
141 Ga0097620_100946677 3300006931 Bacteria 945
142 Ga0097620_101307304 3300006931 Bacteria 799
143 Ga0105240_10215180 3300009093 Bacteria 2242
144 Ga0111539_10148991 3300009094 Bacteria 2739
145 Ga0105245_10026100 3300009098 Bacteria 5141
146 Ga0105245_10049267 3300009098 Bacteria 3771
147 Ga0105245_11666005 3300009098 Bacteria 690
148 Ga0105247_10446278 3300009101 Bacteria 932
149 Ga0105247_10868264 3300009101 Bacteria 694
150 Ga0114129_10003425 3300009147 Bacteria 22306
151 Ga0114129_10443205 3300009147 Bacteria 1704
152 Ga0114129_10569017 3300009147 Bacteria 1472
153 Ga0105243_10014650 3300009148 Bacteria 5933
154 Ga0105243_10147818 3300009148 Bacteria 2012
155 Ga0105243_11083267 3300009148 Unclassified 808
156 Ga0105241_10292908 3300009174 Unclassified 1394
157 Ga0105241_10473112 3300009174 Bacteria 1112
158 Ga0105241_10580243 3300009174 Bacteria 1010
159 Ga0105242_10015826 3300009176 Bacteria 5860
160 Ga0105242_10187799 3300009176 Bacteria 1827
161 Ga0105248_10154237 3300009177 Bacteria 2591
162 Ga0105237_10720977 3300009545 Bacteria 1004
163 Ga0105237_10778810 3300009545 Bacteria 963
164 Ga0105237_11240200 3300009545 Bacteria 752
165 Ga0105237_11412841 3300009545 Bacteria 702
166 Ga0105238_10154625 3300009551 Bacteria 2269
167 Ga0105238_10524897 3300009551 Bacteria 1187
168 Ga0105238_10812895 3300009551 Bacteria 951
169 Ga0105249_10044883 3300009553 Bacteria 4019
170 Ga0105249_10120931 3300009553 Bacteria 2488
171 Ga0105249_10748580 3300009553 Bacteria 1039
172 Ga0099796_10354779 3300010159 Bacteria 633
173 Ga0105239_10020682 3300010375 Bacteria 7261
174 Ga0105239_10026655 3300010375 Bacteria 6361
175 Ga0105239_10609541 3300010375 Bacteria 1245
176 Ga0105246_10453987 3300011119 Bacteria 1078
177 Ga0105246_10712481 3300011119 Bacteria 881
178 Ga0105246_12004165 3300011119 Unclassified 559
179 Ga0157371_11124278 3300013102 Bacteria 603
180 Ga0157370_10084397 3300013104 Bacteria 2985
181 Ga0157369_10110532 3300013105 Bacteria 2922
182 Ga0157369_10432150 3300013105 Bacteria 1364
183 Ga0157374_10224505 3300013296 Bacteria 1844
184 Ga0157374_10563534 3300013296 Bacteria 1147
185 Ga0157378_10190052 3300013297 Bacteria 1936
186 Ga0163162_10020021 3300013306 Bacteria 6572
187 Ga0163162_11898206 3300013306 Bacteria 682
188 Ga0157372_10000006 3300013307 Bacteria 354669
189 Ga0157372_10042234 3300013307 Bacteria 5043
190 Ga0157372_10643856 3300013307 Bacteria 1234
191 Ga0157372_11604993 3300013307 Bacteria 749
192 Ga0157375_10311989 3300013308 Bacteria 1737
193 Ga0157375_10668668 3300013308 Bacteria 1194
194 Ga0157375_11513634 3300013308 Bacteria 792
195 Ga0157375_12295882 3300013308 Unclassified 643
196 Ga0163163_10427767 3300014325 Unclassified 1383
197 Ga0163163_10709937 3300014325 Bacteria 1069
198 Ga0157380_10451768 3300014326 Bacteria 1234
199 Ga0157377_10138166 3300014745 Bacteria 1495
200 Ga0157377_10153214 3300014745 Bacteria 1427
201 Ga0157377_10650412 3300014745 Bacteria 759
202 Ga0157379_10243770 3300014968 Unclassified 1630
203 Ga0157376_10010617 3300014969 Bacteria 6745
204 Ga0157376_10060204 3300014969 Unclassified 3187
205 Ga0157376_10779785 3300014969 Bacteria 967
206 Ga0163161_10012578 3300017792 Bacteria 5879
207 Ga0163161_10172166 3300017792 Bacteria 1656
208 Ga0206356_11455724 3300020070 Bacteria 1485
209 Ga0206354_10174022 3300020081 Bacteria 1027
210 Ga0206353_11232773 3300020082 Bacteria 846
211 Ga0206353_11247076 3300020082 Bacteria 612
212 Ga0213876_10099125 3300021384 Bacteria 1544
213 Ga0207653_10096508 3300025885 Bacteria 1041
214 Ga0207682_10299623 3300025893 Bacteria 753
215 Ga0207692_10528589 3300025898 Bacteria 751
216 Ga0207692_10777130 3300025898 Bacteria 625
217 Ga0207692_10790619 3300025898 Bacteria 620
218 Ga0207642_10058443 3300025899 Bacteria 1779
219 Ga0207710_10058436 3300025900 Bacteria 1744
220 Ga0207710_10325878 3300025900 Bacteria 779
221 Ga0207688_10054826 3300025901 Bacteria 2237
222 Ga0207680_10620975 3300025903 Bacteria 773
223 Ga0207685_10108854 3300025905 Bacteria 1198
224 Ga0207699_10212912 3300025906 Bacteria 1315
225 Ga0207699_10623243 3300025906 Unclassified 786
226 Ga0207705_10001341 3300025909 Bacteria 19707
227 Ga0207705_10145094 3300025909 Bacteria 1775
228 Ga0207654_10039562 3300025911 Bacteria 2653
229 Ga0207654_10299102 3300025911 Bacteria 1094
230 Ga0207707_10007659 3300025912 Bacteria 9408
231 Ga0207707_10414112 3300025912 Bacteria 1156
232 Ga0207707_11039869 3300025912 Bacteria 670
233 Ga0207695_10469703 3300025913 Bacteria 1140
234 Ga0207695_10872407 3300025913 Unclassified 780
235 Ga0207693_10010827 3300025915 Bacteria 7404
236 Ga0207693_10012358 3300025915 Bacteria 6899
237 Ga0207693_10804111 3300025915 Bacteria 725
238 Ga0207663_10046893 3300025916 Bacteria 2665
239 Ga0207663_10510924 3300025916 Bacteria 934
240 Ga0207663_10765814 3300025916 Bacteria 767
241 Ga0207660_10157906 3300025917 Bacteria 1747
242 Ga0207660_10277640 3300025917 Bacteria 1329
243 Ga0207662_10601792 3300025918 Bacteria 765
244 Ga0207657_10474047 3300025919 Bacteria 981
245 Ga0207652_10292194 3300025921 Bacteria 1470
246 Ga0207652_10403284 3300025921 Bacteria 1234
247 Ga0207646_10068309 3300025922 Bacteria 3174
248 Ga0207681_10137419 3300025923 Bacteria 1816
249 Ga0207681_10176225 3300025923 Bacteria 1625
250 Ga0207694_10384318 3300025924 Bacteria 1165
251 Ga0207694_10645155 3300025924 Bacteria 892
252 Ga0207659_10479948 3300025926 Bacteria 1050
253 Ga0207659_11261604 3300025926 Bacteria 635
254 Ga0207687_10027720 3300025927 Bacteria 3802
255 Ga0207687_10114220 3300025927 Bacteria 2010
256 Ga0207687_10174077 3300025927 Bacteria 1662
257 Ga0207700_10201281 3300025928 Bacteria 1678
258 Ga0207700_11221704 3300025928 Bacteria 671
259 Ga0207664_10046400 3300025929 Bacteria 3410
260 Ga0207664_10088077 3300025929 Bacteria 2539
261 Ga0207664_10495895 3300025929 Bacteria 1093
262 Ga0207644_10654905 3300025931 Bacteria 874
263 Ga0207690_10432206 3300025932 Bacteria 1055
264 Ga0207690_10703993 3300025932 Bacteria 831
265 Ga0207706_10381144 3300025933 Bacteria 1224
266 Ga0207686_10008498 3300025934 Bacteria 5547
267 Ga0207686_10416970 3300025934 Bacteria 1026
268 Ga0207686_10716648 3300025934 Bacteria 796
269 Ga0207709_10103292 3300025935 Bacteria 1889
270 Ga0207709_10536871 3300025935 Bacteria 918
271 Ga0207669_10324103 3300025937 Bacteria 1180
272 Ga0207669_11152068 3300025937 Bacteria 656
273 Ga0207669_11480708 3300025937 Unclassified 579
274 Ga0207704_10201070 3300025938 Bacteria 1458
275 Ga0207665_10200320 3300025939 Bacteria 1454
276 Ga0207691_10036399 3300025940 Bacteria 4560
277 Ga0207711_10128513 3300025941 Unclassified 2269
278 Ga0207661_10058798 3300025944 Bacteria 3095
279 Ga0207667_10255125 3300025949 Bacteria 1794
280 Ga0207667_10827556 3300025949 Bacteria 921
281 Ga0207667_11366201 3300025949 Bacteria 683
282 Ga0207651_10064832 3300025960 Bacteria 2559
283 Ga0207651_10761173 3300025960 Bacteria 857
284 Ga0207712_10017855 3300025961 Bacteria 4615
285 Ga0207712_10239561 3300025961 Bacteria 1460
286 Ga0207668_10363567 3300025972 Bacteria 1213
287 Ga0207640_10596153 3300025981 Bacteria 935
288 Ga0207658_10707296 3300025986 Bacteria 911
289 Ga0207677_10031225 3300026023 Unclassified 3410
290 Ga0207677_10109547 3300026023 Bacteria 2054
291 Ga0207703_11697312 3300026035 Bacteria 607
292 Ga0207678_10025949 3300026067 Bacteria 5112
293 Ga0207708_10001232 3300026075 Bacteria 19288
294 Ga0207702_10007430 3300026078 Bacteria 9349
295 Ga0207702_10013488 3300026078 Bacteria 6790
296 Ga0207702_10482305 3300026078 Bacteria 1207
297 Ga0207648_10005076 3300026089 Bacteria 13346
298 Ga0207648_10688046 3300026089 Bacteria 947
299 Ga0207648_11546235 3300026089 Bacteria 624
300 Ga0207648_11638273 3300026089 Bacteria 605
301 Ga0207674_10412873 3300026116 Bacteria 1304
302 Ga0207674_10610251 3300026116 Bacteria 1054
303 Ga0207674_11221477 3300026116 Bacteria 721
304 Ga0207675_100006346 3300026118 Bacteria 11210
305 Ga0207675_101612571 3300026118 Bacteria 669
306 Ga0207683_10000252 3300026121 Bacteria 47809
307 Ga0207683_10013473 3300026121 Bacteria 6976
308 Ga0207683_10021557 3300026121 Bacteria 5520
309 Ga0268266_10325438 3300028379 Bacteria 1440
310 Ga0268265_10397648 3300028380 Bacteria 1273
311 Ga0268265_11275471 3300028380 Bacteria 734
312 Ga0268265_11614925 3300028380 Bacteria 653
313 Ga0268264_10885561 3300028381 Bacteria 895
314 Ga0265319_1003944 3300028563 Bacteria 7531
315 Ga0265319_1136631 3300028563 Bacteria 761
316 Ga0265334_10078156 3300028573 Bacteria 1223
317 Ga0265334_10160351 3300028573 Bacteria 791
318 Ga0265318_10040487 3300028577 Bacteria 1773
319 Ga0265322_10004193 3300028654 Bacteria 4315
320 Ga0265336_10046554 3300028666 Bacteria 1318
321 Ga0265338_10009987 3300028800 Bacteria 11223
322 Ga0307511_10210836 3300030521 Bacteria 992
323 Ga0265330_10062191 3300031235 Bacteria 1624
324 Ga0265320_10047045 3300031240 Bacteria 2111
325 Ga0265320_10067363 3300031240 Bacteria 1694
326 Ga0265325_10079439 3300031241 Bacteria 1632
327 Ga0265329_10110424 3300031242 Bacteria 878
328 Ga0265340_10001036 3300031247 Bacteria 15861
329 Ga0265339_10002280 3300031249 Bacteria 13835
330 Ga0265339_10143624 3300031249 Bacteria 1212
331 Ga0265331_10324882 3300031250 Bacteria 689
332 Ga0265327_10064736 3300031251 Bacteria 1851
333 Ga0265316_10034201 3300031344 Bacteria 4130
334 Ga0265316_10079859 3300031344 Bacteria 2509
335 Ga0265313_10023869 3300031595 Bacteria 3284
336 Ga0265314_10076448 3300031711 Bacteria 2224
337 Ga0265342_10002676 3300031712 Bacteria 15165
338 Ga0265342_10046992 3300031712 Bacteria 2593
339 Ga0316576_10303864 3300031727 Bacteria 1192
340 Ga0307410_10045572 3300031852 Bacteria 2921
341 Ga0307410_12068597 3300031852 Bacteria 509
342 Ga0307409_100392394 3300031995 Bacteria 1323
343 Ga0307416_100003816 3300032002 Bacteria 8954
344 Ga0307415_100049039 3300032126 Bacteria 2852
345 Ga0307415_100950875 3300032126 Bacteria 795
346 Ga0373949_0160517 3300035090 Bacteria 655
347 Ga0373951_0147966 3300035091 Bacteria 656
348 Ga0373932_0160897 3300035112 Bacteria 776
349 Ga0373960_0082540 3300035121 Bacteria 1014
350 Ga0373961_0119767 3300035241 Unclassified 871
351 Ga0373962_0011637 3300035242 Bacteria 2208
352 Ga0373937_0535514 3300036401 Bacteria 1113
353 Ga0373937_1518603 3300036401 Bacteria 617
354 Ga0372808_050328 3300036459 Bacteria 596
355 Ga0316584_0047386 3300036712 Bacteria 3211
356 Ga0373925_0000186 3300037068 Bacteria 68187
357 Ga0373925_0604456 3300037068 Bacteria 903
358 Ga0395899_0019962 3300037312 Bacteria 5083
359 Ga0395899_0058019 3300037312 Bacteria 2856
360 Ga0395899_0314565 3300037312 Bacteria 1056
361 Ga0395900_0298071 3300037418 Bacteria 1599
362 Ga0395900_0338962 3300037418 Bacteria 1479
363 Ga0395898_0323481 3300037466 Bacteria 1471
364 Ga0395898_0512626 3300037466 Bacteria 1140
365 Ga0395905_0352229 3300037471 Bacteria 1364
366 Ga0436364_0888643 3300037853 Bacteria 5104
367 Ga0395901_0110572 3300038443 Bacteria 2885
368 Ga0395901_0125572 3300038443 Unclassified 2697
369 Ga0395901_0177882 3300038443 Bacteria 2231
370 Ga0395901_0180867 3300038443 Bacteria 2211
371 Ga0395901_0399291 3300038443 Bacteria 1412
372 Ga0395901_0654580 3300038443 Bacteria 1053
373 Ga0395901_1922526 3300038443 Unclassified 539
374 Ga0436365_0711669 3300039437 Bacteria 3782
375 Ga0436365_1401419 3300039437 Bacteria 4152
376 Ga0436365_1750513 3300039437 Bacteria 6388
377 Ga0436362_0776994 3300039453 Bacteria 959
378 Ga0451791_1102982 3300041451 Bacteria 1117
379 Ga0451833_1047769 3300041491 Bacteria 1075
380 Ga0451837_0189717 3300041494 Bacteria 1249
381 Ga0451853_1590687 3300041512 Bacteria 1078
382 Ga0451853_2778008 3300041512 Bacteria 701
383 Ga0439460_0137093 3300042461 Bacteria 810
384 Ga0466969_0007179 3300044656 Bacteria 5926
385 Ga0466965_0010577 3300044683 Bacteria 4311
386 Ga0466966_0043328 3300044684 Bacteria 2885
387 Ga0466966_0306849 3300044684 Bacteria 954
388 Ga0466961_0014333 3300044693 Bacteria 5087
389 Ga0466961_0019726 3300044693 Bacteria 4338
390 Ga0466961_0317798 3300044693 Bacteria 950
391 Ga0466963_0033914 3300044694 Bacteria 3319
392 Ga0466963_0360625 3300044694 Bacteria 1024
393 Ga0466971_0001221 3300044719 Bacteria 10681
394 Ga0466971_0528012 3300044719 Bacteria 584
395 Ga0466957_0022328 3300044842 Bacteria 3733
396 Ga0466957_0670975 3300044842 Bacteria 730
397 Ga0466960_0099669 3300044901 Bacteria 1494
398 Ga0466959_0009580 3300045049 Bacteria 6891
399 Ga0466959_0022284 3300045049 Bacteria 4681
400 Ga0466959_0394972 3300045049 Bacteria 940
401 Ga0466958_0005229 3300045836 Bacteria 6955
402 Ga0466958_0089249 3300045836 Bacteria 1906
403 Ga0466958_0416192 3300045836 Bacteria 868
404 Ga0466967_0113700 3300045976 Unclassified 2491
405 Ga0466967_0168874 3300045976 Bacteria 2057
406 Ga0466967_0325260 3300045976 Bacteria 1484
407 Ga0466967_0829164 3300045976 Bacteria 919
408 Ga0466967_1910651 3300045976 Bacteria 590
409 Ga0495603_0037210 3300046455 Bacteria 2920
410 Ga0495629_0387425 3300046459 Bacteria 951
411 Ga0495641_0092519 3300046461 Bacteria 1351
412 Ga0495651_0006431 3300046462 Bacteria 8987
413 Ga0495653_0148313 3300046463 Bacteria 1641
414 Ga0495653_0523567 3300046463 Unclassified 737
415 Ga0495580_0097925 3300046472 Bacteria 2040
416 Ga0495582_0059025 3300046473 Unclassified 2116
417 Ga0495582_0752650 3300046473 Bacteria 564
418 Ga0495639_0159206 3300046475 Bacteria 1092
419 Ga0495639_0420899 3300046475 Bacteria 676
420 Ga0495664_0007449 3300046477 Bacteria 6080
421 Ga0495607_0051495 3300046501 Bacteria 2391
422 Ga0495608_0003953 3300046511 Bacteria 10652
423 Ga0495608_0101187 3300046511 Bacteria 1858
424 Ga0495618_0243125 3300046514 Bacteria 1131
425 Ga0495628_0033067 3300046516 Bacteria 4170
426 Ga0495628_0061152 3300046516 Bacteria 2954
427 Ga0495628_0683640 3300046516 Bacteria 726
428 Ga0495630_0001925 3300046517 Bacteria 14482
429 Ga0495630_0045156 3300046517 Bacteria 3292
430 Ga0495630_0514633 3300046517 Bacteria 917
431 Ga0495630_0536931 3300046517 Bacteria 897
432 Ga0495666_0003878 3300046526 Bacteria 7562
433 Ga0495666_0278833 3300046526 Unclassified 758
434 Ga0495652_0099053 3300046529 Bacteria 2367
435 Ga0495652_0421366 3300046529 Unclassified 941
436 Ga0495652_0809831 3300046529 Bacteria 623
437 Ga0495665_0009164 3300046531 Bacteria 5364
438 Ga0495640_0009168 3300046533 Bacteria 7723
439 Ga0495640_0540699 3300046533 Bacteria 707
440 Ga0495587_0021689 3300046536 Bacteria 3962
441 Ga0495668_0135424 3300046616 Bacteria 1348
442 Ga0495634_0017046 3300046642 Bacteria 5189
443 Ga0495634_0030663 3300046642 Bacteria 3711
444 Ga0495611_0101732 3300046648 Bacteria 1335
445 Ga0495659_0141983 3300046664 Bacteria 959
446 Ga0495659_0151201 3300046664 Bacteria 932
447 Ga0495588_0287227 3300046674 Bacteria 867
448 Ga0495657_0007056 3300046675 Bacteria 8715
449 Ga0495657_0059487 3300046675 Bacteria 2535
450 Ga0495599_0019987 3300046678 Bacteria 4170
451 Ga0495623_0018937 3300046679 Bacteria 4444
452 Ga0495646_0043445 3300046680 Bacteria 2751
453 Ga0495658_0157379 3300046683 Bacteria 1399
454 Ga0495613_0003206 3300046689 Bacteria 12243
455 Ga0495613_0051583 3300046689 Bacteria 3031
456 Ga0495670_0400609 3300046691 Bacteria 741
457 Ga0495589_0090600 3300046794 Unclassified 1485
458 Ga0495600_0355115 3300046809 Bacteria 917
459 Ga0495581_0015912 3300047315 Bacteria 4370
460 Ga0495581_0145418 3300047315 Bacteria 1384
461 Ga0495581_0195246 3300047315 Bacteria 1184
462 Ga0495604_0000225 3300047317 Bacteria 51285
463 Ga0495674_0030312 3300047319 Bacteria 4919
464 Ga0495676_0026680 3300047321 Bacteria 4968
465 Ga0495680_0028979 3300047322 Bacteria 4537
466 Ga0495680_0186350 3300047322 Bacteria 1495
467 Ga0495680_0248938 3300047322 Bacteria 1260
468 Ga0495683_0000907 3300047323 Bacteria 20911
469 Ga0495677_0129169 3300047445 Archaea 967
470 Ga0495684_0014781 3300047471 Bacteria 6010
471 Ga0495684_0312799 3300047471 Bacteria 1125
472 Ga0495684_0454362 3300047471 Bacteria 889
473 Ga0495593_0068441 3300047673 Bacteria 1847
474 Ga0495602_0082221 3300048088 Bacteria 2703
475 Ga0495602_0930917 3300048088 Unclassified 577
476 Ga0496100_0035315 3300048903 Unclassified 3143
477 Ga0496100_0089656 3300048903 Bacteria 2095
478 Ga0496100_0358145 3300048903 Bacteria 1103
479 Ga0496100_0759859 3300048903 Bacteria 758
480 Ga0496101_0059580 3300048904 Bacteria 2767
481 Ga0496101_0075156 3300048904 Unclassified 2486
482 Ga0496101_0203208 3300048904 Bacteria 1532
483 Ga0496101_0213571 3300048904 Bacteria 1495
484 Ga0496102_0003728 3300048905 Bacteria 12880
485 Ga0496102_0047957 3300048905 Unclassified 3883
486 Ga0496102_0063230 3300048905 Bacteria 3388
487 Ga0496102_0273473 3300048905 Bacteria 1593
488 Ga0496102_1421787 3300048905 Bacteria 613
489 Ga0496103_0009214 3300048906 Bacteria 5848
490 Ga0496103_0149955 3300048906 Bacteria 1493
491 Ga0496103_0298565 3300048906 Bacteria 1036
492 Ga0496104_0004456 3300048907 Bacteria 12201
493 Ga0496104_0015503 3300048907 Bacteria 6901
494 Ga0496104_0081490 3300048907 Bacteria 3086
495 Ga0496104_0095991 3300048907 Bacteria 2836
496 Ga0496104_0244813 3300048907 Unclassified 1706
497 Ga0496105_0001889 3300048908 Bacteria 15029
498 Ga0496105_0009218 3300048908 Bacteria 7707
499 Ga0496105_0039699 3300048908 Bacteria 3881
500 Ga0496105_0041059 3300048908 Bacteria 3814
501 Ga0496105_0268603 3300048908 Bacteria 1378
502 Ga0496105_0358408 3300048908 Bacteria 1164
503 Ga0496105_0372723 3300048908 Bacteria 1137
504 Ga0496106_0020695 3300048909 Bacteria 4883
505 Ga0496106_0021778 3300048909 Bacteria 4760
506 Ga0496107_0025282 3300048910 Bacteria 4203
507 Ga0496107_0070185 3300048910 Bacteria 2543
508 Ga0496107_0214099 3300048910 Bacteria 1433
509 Ga0496107_0653029 3300048910 Bacteria 775
510 Ga0496107_1096485 3300048910 Unclassified 575
511 Ga0496108_0017829 3300048911 Bacteria 5806
512 Ga0496108_0135178 3300048911 Bacteria 2121
513 Ga0496108_0326557 3300048911 Bacteria 1338
514 Ga0496108_0366838 3300048911 Unclassified 1257
515 Ga0496109_0018811 3300048912 Bacteria 6076
516 Ga0496109_0023843 3300048912 Bacteria 5432
517 Ga0496109_0127127 3300048912 Bacteria 2377
518 Ga0496109_0154453 3300048912 Bacteria 2149
519 Ga0496109_1225528 3300048912 Bacteria 687
520 Ga0496110_0074005 3300048913 Bacteria 3024
521 Ga0496110_0171809 3300048913 Bacteria 1966
522 Ga0496110_0249412 3300048913 Bacteria 1616
523 Ga0496110_0331708 3300048913 Bacteria 1386
524 Ga0496110_0387085 3300048913 Bacteria 1274
525 Ga0496111_0063192 3300048914 Bacteria 2685
526 Ga0496111_0074680 3300048914 Bacteria 2469
527 Ga0496111_1109328 3300048914 Bacteria 564
528 Ga0496112_0001349 3300048915 Bacteria 18681
529 Ga0496112_0120026 3300048915 Bacteria 2599
530 Ga0496112_0186478 3300048915 Bacteria 2037
531 Ga0496112_0370446 3300048915 Bacteria 1374
532 Ga0496112_0926648 3300048915 Bacteria 793
533 Ga0496113_0013687 3300048916 Bacteria 5508
534 Ga0496113_0031099 3300048916 Bacteria 3871
535 Ga0496113_0127425 3300048916 Bacteria 1995
536 Ga0496114_0003189 3300048917 Bacteria 12573
537 Ga0496114_0014825 3300048917 Bacteria 6265
538 Ga0496114_0017313 3300048917 Bacteria 5815
539 Ga0496114_0054465 3300048917 Bacteria 3335
540 Ga0496114_0235335 3300048917 Bacteria 1610
541 Ga0496115_0019555 3300048918 Bacteria 5213
542 Ga0496115_0030211 3300048918 Bacteria 4261
543 Ga0496115_0071538 3300048918 Bacteria 2813
544 Ga0496115_0311311 3300048918 Bacteria 1289
545 Ga0496115_0736716 3300048918 Unclassified 772
546 Ga0496119_0000762 3300048922 Bacteria 43203
547 Ga0496120_0002003 3300048923 Bacteria 22155
548 Ga0496126_0452819 3300048929 Bacteria 1033
549 Ga0501031_0001891 3300049568 Bacteria 13197
550 Ga0501032_0006650 3300049569 Bacteria 8485
551 Ga0501033_0001259 3300049570 Bacteria 22655
552 Ga0501034_0054399 3300049571 Bacteria 4029
553 Ga0501034_0192549 3300049571 Bacteria 2001
554 Ga0501034_1073212 3300049571 Bacteria 687
555 Ga0501036_0000290 3300049572 Bacteria 34813
556 Ga0501037_0006720 3300049573 Bacteria 8416
557 Ga0501038_0001257 3300049574 Bacteria 23006
558 Ga0501038_0152686 3300049574 Bacteria 1882
559 Ga0501040_0099117 3300049576 Bacteria 2031
560 Ga0501042_0600197 3300049578 Bacteria 800
561 Ga0501043_0001967 3300049579 Bacteria 17539
562 Ga0501046_0001423 3300049580 Bacteria 23025
563 Ga0501047_0007209 3300049581 Bacteria 10453
564 Ga0501047_0487437 3300049581 Bacteria 1060
565 Ga0501048_0000843 3300049582 Bacteria 22584
566 Ga0501067_0034651 3300049583 Bacteria 2802
567 Ga0501068_0040937 3300049584 Bacteria 2783
568 Ga0501068_0081792 3300049584 Bacteria 1983
569 Ga0501069_0015436 3300049585 Bacteria 4093
570 Ga0501069_0088739 3300049585 Bacteria 1748
571 Ga0501070_0002390 3300049586 Bacteria 16460
572 Ga0501070_0430532 3300049586 Bacteria 1065
573 Ga0501071_1041884 3300049587 Bacteria 632
574 Ga0501071_1454233 3300049587 Bacteria 529
575 Ga0501072_1322782 3300049588 Bacteria 558
576 Ga0501073_0003798 3300049589 Bacteria 11347
577 Ga0501074_0009605 3300049590 Bacteria 7024
578 Ga0501074_0081340 3300049590 Bacteria 2323
579 Ga0501074_0560694 3300049590 Bacteria 808
580 Ga0501074_1167643 3300049590 Bacteria 540
581 Ga0501079_0225331 3300049741 Bacteria 1465
582 Ga0501080_0018427 3300049742 Bacteria 6461
583 Ga0501080_0192491 3300049742 Bacteria 1874
584 Ga0501080_0530821 3300049742 Bacteria 1049
585 Ga0501081_0275065 3300049743 Bacteria 1232
586 Ga0501083_0006888 3300049744 Bacteria 8070
587 Ga0501035_0000368 3300049822 Bacteria 51908
588 Ga0501035_0671410 3300049822 Bacteria 838
589 Ga0501044_0019414 3300049823 Bacteria 7272
590 Ga0501044_0100349 3300049823 Bacteria 2913
591 Ga0501045_0013298 3300049824 Bacteria 5810
592 Ga0501045_0853987 3300049824 Bacteria 669
593 nmdc:mga00v17_120945_c1 3300050491 Bacteria 1667
594 nmdc:mga00v17_282353_c1 3300050491 Bacteria 1078
595 nmdc:mga00v17_666053_c1 3300050491 Bacteria 669
596 nmdc:mga0yw44_229574_c1 3300050492 Bacteria 1232
597 nmdc:mga06z11_879994_c1 3300050494 Bacteria 546
598 nmdc:mga04h51_72799_c1 3300050495 Bacteria 1203
599 nmdc:mga05p37_573728_c1 3300050507 Bacteria 1279
600 nmdc:mga05p37_9779_c1 3300050507 Bacteria 11378
601 nmdc:mga09592_57821_c1 3300050508 Bacteria 3279
602 nmdc:mga0qj67_15758_c1 3300050509 Bacteria 5726
603 nmdc:mga08y16_863875_c1 3300050511 Unclassified 893
604 nmdc:mga0n895_533032_c1 3300050512 Bacteria 1181
605 nmdc:mga0rr50_1135083_c1 3300050513 Unclassified 665
606 nmdc:mga0a205_922100_c1 3300050515 Unclassified 720
607 Ga0495601_0008636 3300053077 Bacteria 6012
608 Ga0495601_0013033 3300053077 Bacteria 4995
609 Ga0495601_0113728 3300053077 Bacteria 1754
610 Ga0495612_0000116 3300053078 Bacteria 33433
611 Ga0495619_0034326 3300053085 Bacteria 3298
612 Ga0495619_0079808 3300053085 Bacteria 2201
613 Ga0495619_0120722 3300053085 Bacteria 1797
614 Ga0495619_0651448 3300053085 Bacteria 718
615 Ga0500566_0137672 3300053094 Bacteria 1299
616 Ga0500568_0000027 3300053139 Bacteria 162311
617 Ga0501082_0006895 3300060353 Bacteria 9828
618 2548696848 2547132424 Bacteria 8348532
619 2552111537 2551306166 Bacteria 9731570
620 2588106923 2585428157 Bacteria 3018951
621 2644517950 2643221692 Bacteria 7282860
622 2919717539 2919713450 Bacteria 7431245
623 Ga0395901_0089251
624 JGI24034J26672_10119170
625 Ga0070658_11175948
626 Ga0070676_10203068
627 Ga0070683_100001633
628 Ga0070683_100455603
629 Ga0070683_101776237
630 Ga0070677_10294130
631 Ga0068869_100037481
632 Ga0070666_10884186
633 Ga0070680_100099187
634 Ga0070680_100103318
635 Ga0070680_100230005
636 Ga0070680_100955547
637 Ga0070682_100019914
638 Ga0070682_100026583
639 Ga0070682_101037394
640 Ga0068868_100207301
641 Ga0070660_100942338
642 Ga0070689_100163108
643 Ga0070689_100848261
644 Ga0070691_10056507
645 Ga0070661_100584252
646 Ga0070692_10255550
647 Ga0070669_100833426
648 Ga0070669_100887836
649 Ga0070675_100315117
650 Ga0070675_100634245
651 Ga0070671_100681967
652 Ga0070674_100009530
653 Ga0070673_100280741
654 Ga0070673_100976383
655 Ga0070673_100997897
656 Ga0070673_101228403
657 Ga0070703_10316944
658 Ga0070709_10066570
659 Ga0070709_10734037
660 Ga0070714_100060850
661 Ga0070714_100111093
662 Ga0070714_100347083
663 Ga0070714_100800127
664 Ga0070713_100244896
665 Ga0070713_101655793
666 Ga0070710_10038777
667 Ga0070710_10047058
668 Ga0070710_10303142
669 Ga0070710_10688870
670 Ga0070701_10129008
671 Ga0070711_100058009
672 Ga0070711_100143121
673 Ga0070711_101350731
674 Ga0070705_100441448
675 Ga0070705_100719787
676 Ga0070700_100005875
677 Ga0070694_100358736
678 Ga0070694_100742033
679 Ga0070708_100082126
680 Ga0070708_100923869
681 Ga0070663_100057761
682 Ga0070678_100010432
683 Ga0070678_100013864
684 Ga0070678_100109286
685 Ga0070662_100040459
686 Ga0070681_10006222
687 Ga0070681_10103966
688 Ga0070681_11304981
689 Ga0070685_10134903
690 Ga0070707_100129231
691 Ga0070707_100756356
692 Ga0070698_100737366
693 Ga0070699_100334743
694 Ga0070679_100017052
695 Ga0070684_100002599
696 Ga0070684_100613715
697 Ga0070684_100874993
698 Ga0070697_100507064
699 Ga0070697_100864173
700 Ga0070697_101539845
701 Ga0068853_100125960
702 Ga0070672_100194089
703 Ga0070672_101635527
704 Ga0070686_100157459
705 Ga0070686_100179639
706 Ga0070686_101000284
707 Ga0070695_100253953
708 Ga0070696_100258789
709 Ga0070696_100487036
710 Ga0070693_100091029
711 Ga0070693_100385487
712 Ga0070665_100294961
713 Ga0070665_100892763
714 Ga0070665_101052413
715 Ga0070704_100046498
716 Ga0070704_100047441
717 Ga0070704_100419522
718 Ga0068855_100410530
719 Ga0070664_100489398
720 Ga0068857_100173287
721 Ga0068857_100661321
722 Ga0068854_100055095
723 Ga0068856_100007847
724 Ga0068856_100008490
725 Ga0068856_100051880
726 Ga0068856_100123052
727 Ga0068856_100392208
728 Ga0070702_100043577
729 Ga0070702_100101535
730 Ga0068852_100253267
731 Ga0068859_100235600
732 Ga0068859_100946697
733 Ga0068859_101307304
734 Ga0068866_10183337
735 Ga0068861_100086262
736 Ga0068861_101107538
737 Ga0068861_101180902
738 Ga0068858_101912684
739 Ga0068862_100249890
740 Ga0068862_101690406
741 Ga0081538_10007182
742 Ga0081539_10010822
743 Ga0081539_10011499
744 Ga0075365_10575980
745 Ga0075368_10263502
746 Ga0075364_10238718
747 Ga0070715_10019256
748 Ga0070716_101577833
749 Ga0070712_100007711
750 Ga0070712_100270253
751 Ga0070712_101087686
752 Ga0097621_100027516
753 Ga0075370_10280860
754 Ga0068871_100572815
755 Ga0075428_101696585
756 Ga0075430_100021540
757 Ga0075433_10876782
758 Ga0075434_100928524
759 Ga0075429_100074822
760 Ga0068865_100002260
761 Ga0068865_100258766
762 Ga0097620_100235595
763 Ga0097620_100946677
764 Ga0097620_101307304
765 Ga0105240_10215180
766 Ga0111539_10148991
767 Ga0105245_10026100
768 Ga0105245_10049267
769 Ga0105245_11666005
770 Ga0105247_10446278
771 Ga0105247_10868264
772 Ga0114129_10003425
773 Ga0114129_10443205
774 Ga0114129_10569017
775 Ga0105243_10014650
776 Ga0105243_10147818
777 Ga0105243_11083267
778 Ga0105241_10292908
779 Ga0105241_10473112
780 Ga0105241_10580243
781 Ga0105242_10015826
782 Ga0105242_10187799
783 Ga0105248_10154237
784 Ga0105237_10720977
785 Ga0105237_10778810
786 Ga0105237_11240200
787 Ga0105237_11412841
788 Ga0105238_10154625
789 Ga0105238_10524897
790 Ga0105238_10812895
791 Ga0105249_10044883
792 Ga0105249_10120931
793 Ga0105249_10748580
794 Ga0099796_10354779
795 Ga0105239_10020682
796 Ga0105239_10026655
797 Ga0105239_10609541
798 Ga0105246_10453987
799 Ga0105246_10712481
800 Ga0105246_12004165
801 Ga0157371_11124278
802 Ga0157370_10084397
803 Ga0157369_10110532
804 Ga0157369_10432150
805 Ga0157374_10224505
806 Ga0157374_10563534
807 Ga0157378_10190052
808 Ga0163162_10020021
809 Ga0163162_11898206
810 Ga0157372_10000006
811 Ga0157372_10042234
812 Ga0157372_10643856
813 Ga0157372_11604993
814 Ga0157375_10311989
815 Ga0157375_10668668
816 Ga0157375_11513634
817 Ga0157375_12295882
818 Ga0163163_10427767
819 Ga0163163_10709937
820 Ga0157380_10451768
821 Ga0157377_10138166
822 Ga0157377_10153214
823 Ga0157377_10650412
824 Ga0157379_10243770
825 Ga0157376_10010617
826 Ga0157376_10060204
827 Ga0157376_10779785
828 Ga0163161_10012578
829 Ga0163161_10172166
830 Ga0206356_11455724
831 Ga0206354_10174022
832 Ga0206353_11232773
833 Ga0206353_11247076
834 Ga0213876_10099125
835 Ga0207653_10096508
836 Ga0207682_10299623
837 Ga0207692_10528589
838 Ga0207692_10777130
839 Ga0207692_10790619
840 Ga0207642_10058443
841 Ga0207710_10058436
842 Ga0207710_10325878
843 Ga0207688_10054826
844 Ga0207680_10620975
845 Ga0207685_10108854
846 Ga0207699_10212912
847 Ga0207699_10623243
848 Ga0207705_10001341
849 Ga0207705_10145094
850 Ga0207654_10039562
851 Ga0207654_10299102
852 Ga0207707_10007659
853 Ga0207707_10414112
854 Ga0207707_11039869
855 Ga0207695_10469703
856 Ga0207695_10872407
857 Ga0207693_10010827
858 Ga0207693_10012358
859 Ga0207693_10804111
860 Ga0207663_10046893
861 Ga0207663_10510924
862 Ga0207663_10765814
863 Ga0207660_10157906
864 Ga0207660_10277640
865 Ga0207662_10601792
866 Ga0207657_10474047
867 Ga0207652_10292194
868 Ga0207652_10403284
869 Ga0207646_10068309
870 Ga0207681_10137419
871 Ga0207681_10176225
872 Ga0207694_10384318
873 Ga0207694_10645155
874 Ga0207659_10479948
875 Ga0207659_11261604
876 Ga0207687_10027720
877 Ga0207687_10114220
878 Ga0207687_10174077
879 Ga0207700_10201281
880 Ga0207700_11221704
881 Ga0207664_10046400
882 Ga0207664_10088077
883 Ga0207664_10495895
884 Ga0207644_10654905
885 Ga0207690_10432206
886 Ga0207690_10703993
887 Ga0207706_10381144
888 Ga0207686_10008498
889 Ga0207686_10416970
890 Ga0207686_10716648
891 Ga0207709_10103292
892 Ga0207709_10536871
893 Ga0207669_10324103
894 Ga0207669_11152068
895 Ga0207669_11480708
896 Ga0207704_10201070
897 Ga0207665_10200320
898 Ga0207691_10036399
899 Ga0207711_10128513
900 Ga0207661_10058798
901 Ga0207667_10255125
902 Ga0207667_10827556
903 Ga0207667_11366201
904 Ga0207651_10064832
905 Ga0207651_10761173
906 Ga0207712_10017855
907 Ga0207712_10239561
908 Ga0207668_10363567
909 Ga0207640_10596153
910 Ga0207658_10707296
911 Ga0207677_10031225
912 Ga0207677_10109547
913 Ga0207703_11697312
914 Ga0207678_10025949
915 Ga0207708_10001232
916 Ga0207702_10007430
917 Ga0207702_10013488
918 Ga0207702_10482305
919 Ga0207648_10005076
920 Ga0207648_10688046
921 Ga0207648_11546235
922 Ga0207648_11638273
923 Ga0207674_10412873
924 Ga0207674_10610251
925 Ga0207674_11221477
926 Ga0207675_100006346
927 Ga0207675_101612571
928 Ga0207683_10000252
929 Ga0207683_10013473
930 Ga0207683_10021557
931 Ga0268266_10325438
932 Ga0268265_10397648
933 Ga0268265_11275471
934 Ga0268265_11614925
935 Ga0268264_10885561
936 Ga0265319_1003944
937 Ga0265319_1136631
938 Ga0265334_10078156
939 Ga0265334_10160351
940 Ga0265318_10040487
941 Ga0265322_10004193
942 Ga0265336_10046554
943 Ga0265338_10009987
944 Ga0307511_10210836
945 Ga0265330_10062191
946 Ga0265320_10047045
947 Ga0265320_10067363
948 Ga0265325_10079439
949 Ga0265329_10110424
950 Ga0265340_10001036
951 Ga0265339_10002280
952 Ga0265339_10143624
953 Ga0265331_10324882
954 Ga0265327_10064736
955 Ga0265316_10034201
956 Ga0265316_10079859
957 Ga0265313_10023869
958 Ga0265314_10076448
959 Ga0265342_10002676
960 Ga0265342_10046992
961 Ga0316576_10303864
962 Ga0307410_10045572
963 Ga0307410_12068597
964 Ga0307409_100392394
965 Ga0307416_100003816
966 Ga0307415_100049039
967 Ga0307415_100950875
968 Ga0373949_0160517
969 Ga0373951_0147966
970 Ga0373932_0160897
971 Ga0373960_0082540
972 Ga0373961_0119767
973 Ga0373962_0011637
974 Ga0373937_0535514
975 Ga0373937_1518603
976 Ga0372808_050328
977 Ga0316584_0047386
978 Ga0373925_0000186
979 Ga0373925_0604456
980 Ga0395899_0019962
981 Ga0395899_0058019
982 Ga0395899_0314565
983 Ga0395900_0298071
984 Ga0395900_0338962
985 Ga0395898_0323481
986 Ga0395898_0512626
987 Ga0395905_0352229
988 Ga0436364_0888643
989 Ga0395901_0110572
990 Ga0395901_0125572
991 Ga0395901_0177882
992 Ga0395901_0180867
993 Ga0395901_0399291
994 Ga0395901_0654580
995 Ga0395901_1922526
996 Ga0436365_0711669
997 Ga0436365_1401419
998 Ga0436365_1750513
999 Ga0436362_0776994
1000 Ga0451791_1102982
1001 Ga0451833_1047769
1002 Ga0451837_0189717
1003 Ga0451853_1590687
1004 Ga0451853_2778008
1005 Ga0439460_0137093
1006 Ga0466969_0007179
1007 Ga0466965_0010577
1008 Ga0466966_0043328
1009 Ga0466966_0306849
1010 Ga0466961_0014333
1011 Ga0466961_0019726
1012 Ga0466961_0317798
1013 Ga0466963_0033914
1014 Ga0466963_0360625
1015 Ga0466971_0001221
1016 Ga0466971_0528012
1017 Ga0466957_0022328
1018 Ga0466957_0670975
1019 Ga0466960_0099669
1020 Ga0466959_0009580
1021 Ga0466959_0022284
1022 Ga0466959_0394972
1023 Ga0466958_0005229
1024 Ga0466958_0089249
1025 Ga0466958_0416192
1026 Ga0466967_0113700
1027 Ga0466967_0168874
1028 Ga0466967_0325260
1029 Ga0466967_0829164
1030 Ga0466967_1910651
1031 Ga0495603_0037210
1032 Ga0495629_0387425
1033 Ga0495641_0092519
1034 Ga0495651_0006431
1035 Ga0495653_0148313
1036 Ga0495653_0523567
1037 Ga0495580_0097925
1038 Ga0495582_0059025
1039 Ga0495582_0752650
1040 Ga0495639_0159206
1041 Ga0495639_0420899
1042 Ga0495664_0007449
1043 Ga0495607_0051495
1044 Ga0495608_0003953
1045 Ga0495608_0101187
1046 Ga0495618_0243125
1047 Ga0495628_0033067
1048 Ga0495628_0061152
1049 Ga0495628_0683640
1050 Ga0495630_0001925
1051 Ga0495630_0045156
1052 Ga0495630_0514633
1053 Ga0495630_0536931
1054 Ga0495666_0003878
1055 Ga0495666_0278833
1056 Ga0495652_0099053
1057 Ga0495652_0421366
1058 Ga0495652_0809831
1059 Ga0495665_0009164
1060 Ga0495640_0009168
1061 Ga0495640_0540699
1062 Ga0495587_0021689
1063 Ga0495668_0135424
1064 Ga0495634_0017046
1065 Ga0495634_0030663
1066 Ga0495611_0101732
1067 Ga0495659_0141983
1068 Ga0495659_0151201
1069 Ga0495588_0287227
1070 Ga0495657_0007056
1071 Ga0495657_0059487
1072 Ga0495599_0019987
1073 Ga0495623_0018937
1074 Ga0495646_0043445
1075 Ga0495658_0157379
1076 Ga0495613_0003206
1077 Ga0495613_0051583
1078 Ga0495670_0400609
1079 Ga0495589_0090600
1080 Ga0495600_0355115
1081 Ga0495581_0015912
1082 Ga0495581_0145418
1083 Ga0495581_0195246
1084 Ga0495604_0000225
1085 Ga0495674_0030312
1086 Ga0495676_0026680
1087 Ga0495680_0028979
1088 Ga0495680_0186350
1089 Ga0495680_0248938
1090 Ga0495683_0000907
1091 Ga0495677_0129169
1092 Ga0495684_0014781
1093 Ga0495684_0312799
1094 Ga0495684_0454362
1095 Ga0495593_0068441
1096 Ga0495602_0082221
1097 Ga0495602_0930917
1098 Ga0496100_0035315
1099 Ga0496100_0089656
1100 Ga0496100_0358145
1101 Ga0496100_0759859
1102 Ga0496101_0059580
1103 Ga0496101_0075156
1104 Ga0496101_0203208
1105 Ga0496101_0213571
1106 Ga0496102_0003728
1107 Ga0496102_0047957
1108 Ga0496102_0063230
1109 Ga0496102_0273473
1110 Ga0496102_1421787
1111 Ga0496103_0009214
1112 Ga0496103_0149955
1113 Ga0496103_0298565
1114 Ga0496104_0004456
1115 Ga0496104_0015503
1116 Ga0496104_0081490
1117 Ga0496104_0095991
1118 Ga0496104_0244813
1119 Ga0496105_0001889
1120 Ga0496105_0009218
1121 Ga0496105_0039699
1122 Ga0496105_0041059
1123 Ga0496105_0268603
1124 Ga0496105_0358408
1125 Ga0496105_0372723
1126 Ga0496106_0020695
1127 Ga0496106_0021778
1128 Ga0496107_0025282
1129 Ga0496107_0070185
1130 Ga0496107_0214099
1131 Ga0496107_0653029
1132 Ga0496107_1096485
1133 Ga0496108_0017829
1134 Ga0496108_0135178
1135 Ga0496108_0326557
1136 Ga0496108_0366838
1137 Ga0496109_0018811
1138 Ga0496109_0023843
1139 Ga0496109_0127127
1140 Ga0496109_0154453
1141 Ga0496109_1225528
1142 Ga0496110_0074005
1143 Ga0496110_0171809
1144 Ga0496110_0249412
1145 Ga0496110_0331708
1146 Ga0496110_0387085
1147 Ga0496111_0063192
1148 Ga0496111_0074680
1149 Ga0496111_1109328
1150 Ga0496112_0001349
1151 Ga0496112_0120026
1152 Ga0496112_0186478
1153 Ga0496112_0370446
1154 Ga0496112_0926648
1155 Ga0496113_0013687
1156 Ga0496113_0031099
1157 Ga0496113_0127425
1158 Ga0496114_0003189
1159 Ga0496114_0014825
1160 Ga0496114_0017313
1161 Ga0496114_0054465
1162 Ga0496114_0235335
1163 Ga0496115_0019555
1164 Ga0496115_0030211
1165 Ga0496115_0071538
1166 Ga0496115_0311311
1167 Ga0496115_0736716
1168 Ga0496119_0000762
1169 Ga0496120_0002003
1170 Ga0496126_0452819
1171 Ga0501031_0001891
1172 Ga0501032_0006650
1173 Ga0501033_0001259
1174 Ga0501034_0054399
1175 Ga0501034_0192549
1176 Ga0501034_1073212
1177 Ga0501036_0000290
1178 Ga0501037_0006720
1179 Ga0501038_0001257
1180 Ga0501038_0152686
1181 Ga0501040_0099117
1182 Ga0501042_0600197
1183 Ga0501043_0001967
1184 Ga0501046_0001423
1185 Ga0501047_0007209
1186 Ga0501047_0487437
1187 Ga0501048_0000843
1188 Ga0501067_0034651
1189 Ga0501068_0040937
1190 Ga0501068_0081792
1191 Ga0501069_0015436
1192 Ga0501069_0088739
1193 Ga0501070_0002390
1194 Ga0501070_0430532
1195 Ga0501071_1041884
1196 Ga0501071_1454233
1197 Ga0501072_1322782
1198 Ga0501073_0003798
1199 Ga0501074_0009605
1200 Ga0501074_0081340
1201 Ga0501074_0560694
1202 Ga0501074_1167643
1203 Ga0501079_0225331
1204 Ga0501080_0018427
1205 Ga0501080_0192491
1206 Ga0501080_0530821
1207 Ga0501081_0275065
1208 Ga0501083_0006888
1209 Ga0501035_0000368
1210 Ga0501035_0671410
1211 Ga0501044_0019414
1212 Ga0501044_0100349
1213 Ga0501045_0013298
1214 Ga0501045_0853987
1215 nmdc:mga00v17_120945_c1
1216 nmdc:mga00v17_282353_c1
1217 nmdc:mga00v17_666053_c1
1218 nmdc:mga0yw44_229574_c1
1219 nmdc:mga06z11_879994_c1
1220 nmdc:mga04h51_72799_c1
1221 nmdc:mga05p37_573728_c1
1222 nmdc:mga05p37_9779_c1
1223 nmdc:mga09592_57821_c1
1224 nmdc:mga0qj67_15758_c1
1225 nmdc:mga08y16_863875_c1
1226 nmdc:mga0n895_533032_c1
1227 nmdc:mga0rr50_1135083_c1
1228 nmdc:mga0a205_922100_c1
1229 Ga0495601_0008636
1230 Ga0495601_0013033
1231 Ga0495601_0113728
1232 Ga0495612_0000116
1233 Ga0495619_0034326
1234 Ga0495619_0079808
1235 Ga0495619_0120722
1236 Ga0495619_0651448
1237 Ga0500566_0137672
1238 Ga0500568_0000027
1239 Ga0501082_0006895
1240 2548696848
1241 2552111537
1242 2588106923
1243 2644517950
1244 2919717539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04075

F420H2_quin_red

F420H(2)-dependent quinone reductase

37

145

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.7873 32 146
3r5r-assembly2.cif.gz_B structure of ddn, the deazaflavin-dependent nitroreductase from mycobacterium tuberculosis involved in bioreductive activation of pa-824, with co-factor f420 0.7612 32 146
2fhq-assembly1.cif.gz_B crystal structure of general stress protein from bacteroides thetaiotaomicron 0.7417 33 145
3h96-assembly2.cif.gz_B msmeg_3358 f420 reductase 0.7265 17 148
2qck-assembly1.cif.gz_A crystal structure of flavin reductase domain protein (yp_831077.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.7232 32 83
ID Description Score Start End Superfamily
af_M9MSI4_327_472_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.8162 33 60 3.80.10.10
af_O53328_2_119_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7839 29 148 2.30.110.10
2imlD01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7837 32 95 2.30.110.10
2ptfB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7769 32 88 2.30.110.10
2oolB01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7472 80 148 3.30.450.20
ID Description Score Start End GO Terms
AF-G8SDI0-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9969 32 148 GO:0016491
AF-A0A5H2UID3-F1-model_v4 deleted 0.9939 32 146
AF-A0A388ST72-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9839 39 146 GO:0016491
AF-G8SDI0-F1-model_v4 Nitroreductase family deazaflavin-dependent oxidoreductase 0.9801 32 148 GO:0016491
AF-A0A6P2BZV4-F1-model_v4 DUF385 domain-containing protein 0.9788 29 151 GO:0016491

Map