F470066

General Info

Members Datasets Scaffolds Average Seq Length
622 303 1244 206

Family's Representative Sequence

Representative Sequence 3300001991|JGI24743J22301_10001495|JGI24743J22301_100014954
Length 219
Sequence VPGRRDASTKDTVTALTTNIQRKRPGRPPGTSDTRERILECARNLFARNGIDKTSIRAIAKDAGVDPALVHHYFGTKTQLFAAAIHIPIDPMAVIGPLREVPVEKIGYVLPSVLLPLWDSEMGKGFIATLRSILAGGEVSLIRSFLQEVIAVEVGTRVDNPPGSGRIRVQFVASQLVGVVMARYILELEPFKSLPVEQIAETIAPNLQRYLTGELPGLT

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
186 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
187 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
188 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
189 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
190 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
191 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
290 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
295 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
296 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
297 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
298 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
299 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
300 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
301 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
302 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
303 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.34
Nodule 0.16
Rhizoplane 10.45
Rhizosphere 70.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10001495 3300001991 Bacteria 3252
2 JGI24737J22298_10089555 3300001990 Bacteria 913
3 JGI24735J21928_10019734 3300002067 Bacteria 2071
4 JGI24749J21850_1021685 3300002076 Bacteria 909
5 JGI24744J21845_10008588 3300002077 Bacteria 2099
6 JGI24744J21845_10011818 3300002077 Bacteria 1779
7 JGI24034J26672_10027793 3300002239 Bacteria 911
8 Ga0055540_1000211 3300003792 Bacteria 55318
9 Ga0055540_1002075 3300003792 Bacteria 11027
10 Ga0055540_1002792 3300003792 Bacteria 8933
11 Ga0055540_1008630 3300003792 Bacteria 3644
12 Ga0070676_10001631 3300005328 Bacteria 11407
13 Ga0070683_100228734 3300005329 Bacteria 1768
14 Ga0070690_100004005 3300005330 Bacteria 8149
15 Ga0070670_100081730 3300005331 Bacteria 2776
16 Ga0068869_100033086 3300005334 Bacteria 3648
17 Ga0070666_10227111 3300005335 Bacteria 1318
18 Ga0070682_100047106 3300005337 Bacteria 2679
19 Ga0070682_100404783 3300005337 Bacteria 1033
20 Ga0068868_100007809 3300005338 Bacteria 7637
21 Ga0068868_100081429 3300005338 Bacteria 2595
22 Ga0070689_100089687 3300005340 Bacteria 2422
23 Ga0070687_100422280 3300005343 Bacteria 880
24 Ga0070692_10008567 3300005345 Bacteria 4566
25 Ga0070668_100007872 3300005347 Bacteria 7913
26 Ga0070668_100007937 3300005347 Bacteria 7881
27 Ga0070668_100291853 3300005347 Bacteria 1365
28 Ga0070669_100002083 3300005353 Bacteria 14451
29 Ga0070669_100013695 3300005353 Bacteria 5766
30 Ga0070675_100513669 3300005354 Bacteria 1080
31 Ga0070675_100679109 3300005354 Bacteria 937
32 Ga0070671_100000370 3300005355 Bacteria 31140
33 Ga0070671_100013695 3300005355 Bacteria 6539
34 Ga0070671_100074653 3300005355 Bacteria 2833
35 Ga0070674_100001374 3300005356 Bacteria 12862
36 Ga0070674_100007715 3300005356 Bacteria 6355
37 Ga0070674_100395294 3300005356 Bacteria 1128
38 Ga0070674_100732785 3300005356 Bacteria 848
39 Ga0070673_100048232 3300005364 Bacteria 3319
40 Ga0070688_100013371 3300005365 Bacteria 4625
41 Ga0070688_100074312 3300005365 Bacteria 2183
42 Ga0070659_100059342 3300005366 Bacteria 3021
43 Ga0070667_100000562 3300005367 Bacteria 36767
44 Ga0070667_100002728 3300005367 Bacteria 15284
45 Ga0070667_100014776 3300005367 Bacteria 6450
46 Ga0070667_100096259 3300005367 Bacteria 2553
47 Ga0070667_100275832 3300005367 Bacteria 1509
48 Ga0070667_100633038 3300005367 Bacteria 987
49 Ga0070709_10025246 3300005434 Bacteria 3509
50 Ga0070714_100018330 3300005435 Bacteria 5685
51 Ga0070713_100343988 3300005436 Bacteria 1382
52 Ga0070710_10003645 3300005437 Bacteria 7288
53 Ga0070710_10010120 3300005437 Bacteria 4628
54 Ga0070701_10002014 3300005438 Bacteria 7702
55 Ga0070711_100005138 3300005439 Bacteria 7796
56 Ga0070711_100031566 3300005439 Bacteria 3517
57 Ga0070711_100040517 3300005439 Bacteria 3142
58 Ga0070705_100005820 3300005440 Bacteria 6026
59 Ga0070700_100003071 3300005441 Bacteria 8560
60 Ga0070700_100069352 3300005441 Bacteria 2245
61 Ga0070694_100003154 3300005444 Bacteria 9824
62 Ga0070694_100188345 3300005444 Bacteria 1531
63 Ga0070663_100214166 3300005455 Bacteria 1510
64 Ga0070678_100002271 3300005456 Bacteria 10458
65 Ga0070678_100013638 3300005456 Bacteria 5105
66 Ga0070678_100654484 3300005456 Bacteria 943
67 Ga0070662_100006532 3300005457 Bacteria 7523
68 Ga0070662_100169691 3300005457 Bacteria 1713
69 Ga0068867_100008196 3300005459 Bacteria 7380
70 Ga0068867_100175631 3300005459 Bacteria 1699
71 Ga0068867_100405126 3300005459 Bacteria 1151
72 Ga0070685_10009346 3300005466 Bacteria 5062
73 Ga0070685_10065625 3300005466 Bacteria 2137
74 Ga0070685_10217541 3300005466 Bacteria 1250
75 Ga0070679_100276293 3300005530 Bacteria 1633
76 Ga0068853_100003543 3300005539 Bacteria 11944
77 Ga0068853_100010244 3300005539 Bacteria 7582
78 Ga0068853_100067862 3300005539 Bacteria 3099
79 Ga0070672_100082871 3300005543 Bacteria 2573
80 Ga0070686_100016113 3300005544 Bacteria 4343
81 Ga0070695_100011864 3300005545 Bacteria 5215
82 Ga0070696_100010335 3300005546 Bacteria 6252
83 Ga0070696_100160816 3300005546 Bacteria 1654
84 Ga0070693_100001335 3300005547 Bacteria 11096
85 Ga0070665_100035002 3300005548 Bacteria 5051
86 Ga0070665_100082762 3300005548 Bacteria 3214
87 Ga0070665_100279378 3300005548 Bacteria 1671
88 Ga0070704_100002767 3300005549 Bacteria 9920
89 Ga0070704_100094734 3300005549 Bacteria 2234
90 Ga0068855_100376026 3300005563 Bacteria 1561
91 Ga0068855_100515434 3300005563 Bacteria 1298
92 Ga0068854_100002196 3300005578 Bacteria 11999
93 Ga0068854_100090966 3300005578 Bacteria 2270
94 Ga0070702_100000252 3300005615 Bacteria 18230
95 Ga0070702_100717021 3300005615 Bacteria 764
96 Ga0068852_100031617 3300005616 Bacteria 4371
97 Ga0068852_100131328 3300005616 Bacteria 2307
98 Ga0068852_100278092 3300005616 Bacteria 1613
99 Ga0068859_100001857 3300005617 Bacteria 21468
100 Ga0068859_100005777 3300005617 Bacteria 12569
101 Ga0068859_100309904 3300005617 Bacteria 1672
102 Ga0068864_100111710 3300005618 Bacteria 2435
103 Ga0068864_100150917 3300005618 Bacteria 2105
104 Ga0068864_100183276 3300005618 Bacteria 1915
105 Ga0068864_100383677 3300005618 Bacteria 1332
106 Ga0068866_10001145 3300005718 Bacteria 11647
107 Ga0068861_100165199 3300005719 Bacteria 1830
108 Ga0068861_100769306 3300005719 Bacteria 901
109 Ga0068863_100007827 3300005841 Bacteria 10448
110 Ga0068863_100010106 3300005841 Bacteria 9179
111 Ga0068863_100299078 3300005841 Bacteria 1561
112 Ga0068858_100004001 3300005842 Bacteria 14547
113 Ga0068858_100163095 3300005842 Bacteria 2099
114 Ga0068858_100285702 3300005842 Bacteria 1571
115 Ga0068860_100000112 3300005843 Bacteria 130953
116 Ga0068860_100006354 3300005843 Bacteria 11861
117 Ga0068860_100162844 3300005843 Bacteria 2151
118 Ga0068862_100001577 3300005844 Bacteria 20769
119 Ga0068862_100005634 3300005844 Bacteria 10458
120 Ga0068862_100274309 3300005844 Bacteria 1543
121 Ga0081455_10041927 3300005937 Bacteria 4020
122 Ga0081455_10049404 3300005937 Bacteria 3626
123 Ga0081455_10134554 3300005937 Bacteria 1928
124 Ga0081455_10286487 3300005937 Bacteria 1188
125 Ga0081538_10059970 3300005981 Bacteria 2193
126 Ga0075365_10004891 3300006038 Bacteria 7157
127 Ga0075365_10108851 3300006038 Bacteria 1903
128 Ga0075365_10220165 3300006038 Bacteria 1331
129 Ga0075365_10352284 3300006038 Bacteria 1038
130 Ga0075365_10458848 3300006038 Bacteria 900
131 Ga0075365_10462425 3300006038 Bacteria 896
132 Ga0075368_10020991 3300006042 Bacteria 2478
133 Ga0075363_100004281 3300006048 Bacteria 6207
134 Ga0075363_100006395 3300006048 Bacteria 5345
135 Ga0075363_100009129 3300006048 Bacteria 4655
136 Ga0075363_100020599 3300006048 Bacteria 3309
137 Ga0075363_100051632 3300006048 Bacteria 2194
138 Ga0075363_100132638 3300006048 Bacteria 1398
139 Ga0075363_100136670 3300006048 Bacteria 1378
140 Ga0075363_100157704 3300006048 Bacteria 1284
141 Ga0075364_10005714 3300006051 Bacteria 7249
142 Ga0075364_10010907 3300006051 Bacteria 5506
143 Ga0075364_10011622 3300006051 Bacteria 5352
144 Ga0075364_10027397 3300006051 Bacteria 3640
145 Ga0075364_10036102 3300006051 Bacteria 3195
146 Ga0075364_10037188 3300006051 Bacteria 3150
147 Ga0075364_10044214 3300006051 Bacteria 2896
148 Ga0075364_10058020 3300006051 Bacteria 2536
149 Ga0075364_10292511 3300006051 Bacteria 1109
150 Ga0070715_10004988 3300006163 Bacteria 4397
151 Ga0070715_10006490 3300006163 Bacteria 3981
152 Ga0070716_100066514 3300006173 Bacteria 2103
153 Ga0070716_100475733 3300006173 Bacteria 916
154 Ga0070712_100013734 3300006175 Bacteria 5182
155 Ga0070712_100023062 3300006175 Bacteria 4106
156 Ga0075362_10013485 3300006177 Bacteria 3273
157 Ga0075362_10029621 3300006177 Bacteria 2360
158 Ga0075362_10158504 3300006177 Bacteria 1089
159 Ga0075362_10159031 3300006177 Bacteria 1087
160 Ga0075367_10074227 3300006178 Bacteria 2051
161 Ga0075367_10201648 3300006178 Bacteria 1243
162 Ga0075369_10002345 3300006186 Bacteria 6743
163 Ga0075369_10003891 3300006186 Bacteria 5475
164 Ga0075369_10018680 3300006186 Bacteria 2825
165 Ga0075369_10045797 3300006186 Bacteria 1882
166 Ga0075370_10007437 3300006353 Bacteria 5579
167 Ga0075370_10010718 3300006353 Bacteria 4805
168 Ga0075370_10011476 3300006353 Bacteria 4657
169 Ga0075370_10073372 3300006353 Bacteria 1959
170 Ga0075370_10091645 3300006353 Bacteria 1754
171 Ga0075370_10178036 3300006353 Bacteria 1251
172 Ga0068871_100155117 3300006358 Bacteria 1955
173 Ga0075428_100000630 3300006844 Bacteria 36085
174 Ga0075430_100006119 3300006846 Bacteria 10145
175 Ga0075430_100269912 3300006846 Bacteria 1408
176 Ga0075431_100110488 3300006847 Bacteria 2837
177 Ga0075433_10564354 3300006852 Bacteria 1000
178 Ga0075429_100145167 3300006880 Bacteria 2077
179 Ga0068865_100000680 3300006881 Bacteria 19178
180 Ga0068865_100159014 3300006881 Bacteria 1721
181 Ga0097620_100001857 3300006931 Bacteria 21468
182 Ga0097620_100005777 3300006931 Bacteria 12569
183 Ga0097620_100309917 3300006931 Bacteria 1672
184 Ga0099795_10002326 3300007788 Bacteria 4440
185 Ga0105250_10030996 3300009092 Bacteria 2148
186 Ga0105250_10075586 3300009092 Bacteria 1363
187 Ga0111539_11110843 3300009094 Bacteria 919
188 Ga0105245_10001865 3300009098 Bacteria 19158
189 Ga0105245_10523166 3300009098 Bacteria 1205
190 Ga0105245_11362188 3300009098 Bacteria 759
191 Ga0105247_10000007 3300009101 Bacteria 409490
192 Ga0105247_10001456 3300009101 Bacteria 17102
193 Ga0114129_10009646 3300009147 Bacteria 13775
194 Ga0105243_10002145 3300009148 Bacteria 16675
195 Ga0105241_10029760 3300009174 Bacteria 4076
196 Ga0105241_10262034 3300009174 Bacteria 1469
197 Ga0105242_10011881 3300009176 Bacteria 6702
198 Ga0105242_10556505 3300009176 Bacteria 1101
199 Ga0105242_10682394 3300009176 Bacteria 1003
200 Ga0105248_10002480 3300009177 Bacteria 20511
201 Ga0105248_10024994 3300009177 Bacteria 6639
202 Ga0105248_10260919 3300009177 Bacteria 1950
203 Ga0105248_10297152 3300009177 Bacteria 1818
204 Ga0105237_10049272 3300009545 Bacteria 4234
205 Ga0105237_10230134 3300009545 Bacteria 1854
206 Ga0105238_10337065 3300009551 Bacteria 1496
207 Ga0105238_10647552 3300009551 Bacteria 1066
208 Ga0105249_10000001 3300009553 Bacteria 504948
209 Ga0105249_10001870 3300009553 Bacteria 18265
210 Ga0105249_10010413 3300009553 Bacteria 8171
211 Ga0099796_10034725 3300010159 Bacteria 1667
212 Ga0105239_10007675 3300010375 Bacteria 12354
213 Ga0105239_10043158 3300010375 Bacteria 4941
214 Ga0105239_10391847 3300010375 Bacteria 1571
215 Ga0105246_10149559 3300011119 Bacteria 1766
216 Ga0157373_10483275 3300013100 Bacteria 894
217 Ga0157371_10174928 3300013102 Bacteria 1534
218 Ga0157369_10085639 3300013105 Bacteria 3367
219 Ga0157369_10550066 3300013105 Bacteria 1193
220 Ga0157374_10009985 3300013296 Bacteria 8151
221 Ga0157374_10036891 3300013296 Bacteria 4480
222 Ga0157374_10130572 3300013296 Bacteria 2431
223 Ga0157378_10022145 3300013297 Bacteria 5592
224 Ga0163162_10005764 3300013306 Bacteria 11982
225 Ga0163162_10098793 3300013306 Bacteria 3009
226 Ga0163162_10208488 3300013306 Bacteria 2084
227 Ga0163162_10563947 3300013306 Bacteria 1266
228 Ga0163162_10603413 3300013306 Bacteria 1224
229 Ga0157372_10003317 3300013307 Bacteria 17389
230 Ga0157372_10623749 3300013307 Bacteria 1256
231 Ga0157375_10018186 3300013308 Bacteria 6369
232 Ga0157375_10184201 3300013308 Bacteria 2241
233 Ga0157375_11063276 3300013308 Bacteria 946
234 Ga0163163_10004608 3300014325 Bacteria 11772
235 Ga0163163_10025282 3300014325 Bacteria 5661
236 Ga0157380_10005882 3300014326 Bacteria 8581
237 Ga0157380_10193289 3300014326 Bacteria 1799
238 Ga0157380_10524153 3300014326 Bacteria 1156
239 Ga0182008_10369533 3300014497 Bacteria 764
240 Ga0157377_10105692 3300014745 Bacteria 1685
241 Ga0157379_10116768 3300014968 Bacteria 2400
242 Ga0157379_10210879 3300014968 Bacteria 1758
243 Ga0157379_10257539 3300014968 Bacteria 1585
244 Ga0157376_10049583 3300014969 Bacteria 3478
245 Ga0157376_10067523 3300014969 Bacteria 3025
246 Ga0163161_10003421 3300017792 Bacteria 11127
247 Ga0163161_10094597 3300017792 Bacteria 2215
248 Ga0213876_10116747 3300021384 Bacteria 1416
249 Ga0213875_10012858 3300021388 Bacteria 4124
250 Ga0209051_1000011 3300025303 Bacteria 610828
251 Ga0209051_1000795 3300025303 Bacteria 33193
252 Ga0209051_1002312 3300025303 Bacteria 13876
253 Ga0209051_1008885 3300025303 Bacteria 5253
254 Ga0207682_10182104 3300025893 Bacteria 960
255 Ga0207692_10003270 3300025898 Bacteria 6310
256 Ga0207692_10116961 3300025898 Bacteria 1487
257 Ga0207642_10003553 3300025899 Bacteria 4942
258 Ga0207710_10000013 3300025900 Bacteria 409402
259 Ga0207710_10032410 3300025900 Bacteria 2289
260 Ga0207688_10007393 3300025901 Bacteria 5981
261 Ga0207688_10115664 3300025901 Bacteria 1561
262 Ga0207680_10027599 3300025903 Bacteria 3164
263 Ga0207647_10013820 3300025904 Bacteria 5590
264 Ga0207647_10080732 3300025904 Bacteria 1950
265 Ga0207685_10001953 3300025905 Bacteria 4565
266 Ga0207699_10016166 3300025906 Bacteria 3896
267 Ga0207699_10360553 3300025906 Bacteria 1028
268 Ga0207645_10076971 3300025907 Bacteria 2137
269 Ga0207654_10140195 3300025911 Bacteria 1541
270 Ga0207671_10059929 3300025914 Bacteria 2823
271 Ga0207693_10002493 3300025915 Bacteria 16014
272 Ga0207693_10004546 3300025915 Bacteria 11714
273 Ga0207663_10002049 3300025916 Bacteria 9597
274 Ga0207662_10079717 3300025918 Bacteria 1995
275 Ga0207681_10001110 3300025923 Bacteria 17448
276 Ga0207681_10036599 3300025923 Bacteria 3239
277 Ga0207659_10075564 3300025926 Bacteria 2473
278 Ga0207687_10005326 3300025927 Bacteria 8521
279 Ga0207687_10033461 3300025927 Bacteria 3487
280 Ga0207687_10089785 3300025927 Bacteria 2238
281 Ga0207644_10027484 3300025931 Bacteria 3930
282 Ga0207644_10034503 3300025931 Bacteria 3540
283 Ga0207690_10060776 3300025932 Bacteria 2566
284 Ga0207690_10692821 3300025932 Bacteria 837
285 Ga0207706_10002446 3300025933 Bacteria 18131
286 Ga0207706_10091640 3300025933 Bacteria 2672
287 Ga0207686_10005359 3300025934 Bacteria 6879
288 Ga0207709_10002109 3300025935 Bacteria 12791
289 Ga0207670_10091637 3300025936 Bacteria 2150
290 Ga0207669_10000816 3300025937 Bacteria 13367
291 Ga0207669_10057563 3300025937 Bacteria 2367
292 Ga0207704_10001973 3300025938 Bacteria 9201
293 Ga0207704_10086110 3300025938 Bacteria 2048
294 Ga0207665_10009085 3300025939 Bacteria 6526
295 Ga0207665_10573363 3300025939 Bacteria 879
296 Ga0207691_10043145 3300025940 Bacteria 4157
297 Ga0207711_10001465 3300025941 Bacteria 22000
298 Ga0207711_10121121 3300025941 Bacteria 2336
299 Ga0207711_10179221 3300025941 Bacteria 1926
300 Ga0207689_10012222 3300025942 Bacteria 7345
301 Ga0207689_10026531 3300025942 Bacteria 4852
302 Ga0207661_10123262 3300025944 Bacteria 2210
303 Ga0207679_10972796 3300025945 Bacteria 778
304 Ga0207667_10390381 3300025949 Bacteria 1418
305 Ga0207651_10040915 3300025960 Bacteria 3072
306 Ga0207712_10000006 3300025961 Bacteria 573204
307 Ga0207712_10002457 3300025961 Bacteria 11951
308 Ga0207668_10005239 3300025972 Bacteria 7624
309 Ga0207668_10009865 3300025972 Bacteria 5738
310 Ga0207668_10026610 3300025972 Bacteria 3757
311 Ga0207640_10002500 3300025981 Bacteria 9850
312 Ga0207640_10075635 3300025981 Bacteria 2283
313 Ga0207640_10083941 3300025981 Bacteria 2185
314 Ga0207658_10000970 3300025986 Bacteria 23684
315 Ga0207658_10002350 3300025986 Bacteria 13901
316 Ga0207658_10013888 3300025986 Bacteria 5511
317 Ga0207658_10019601 3300025986 Bacteria 4678
318 Ga0207658_10122816 3300025986 Bacteria 2073
319 Ga0207658_10336922 3300025986 Bacteria 1310
320 Ga0207677_10023178 3300026023 Bacteria 3829
321 Ga0207677_10104938 3300026023 Bacteria 2090
322 Ga0207703_10016085 3300026035 Bacteria 5835
323 Ga0207703_10016553 3300026035 Bacteria 5750
324 Ga0207703_10300163 3300026035 Bacteria 1464
325 Ga0207639_10006599 3300026041 Bacteria 7889
326 Ga0207639_10008954 3300026041 Bacteria 6891
327 Ga0207678_10034015 3300026067 Bacteria 4440
328 Ga0207678_10059708 3300026067 Bacteria 3281
329 Ga0207678_10569187 3300026067 Bacteria 992
330 Ga0207708_10005219 3300026075 Bacteria 9575
331 Ga0207708_10596284 3300026075 Bacteria 935
332 Ga0207641_10006251 3300026088 Bacteria 10078
333 Ga0207641_10009261 3300026088 Bacteria 8119
334 Ga0207648_10008947 3300026089 Bacteria 9631
335 Ga0207648_10020109 3300026089 Bacteria 6020
336 Ga0207676_10009430 3300026095 Bacteria 6947
337 Ga0207676_10151274 3300026095 Bacteria 1999
338 Ga0207676_10152812 3300026095 Bacteria 1990
339 Ga0207675_100005589 3300026118 Bacteria 12034
340 Ga0207675_100194216 3300026118 Bacteria 1948
341 Ga0207683_10003601 3300026121 Bacteria 13503
342 Ga0207683_10010479 3300026121 Bacteria 7909
343 Ga0207698_10051501 3300026142 Bacteria 3148
344 Ga0207698_10460826 3300026142 Bacteria 1229
345 Ga0268266_10007320 3300028379 Bacteria 9975
346 Ga0268266_10013894 3300028379 Bacteria 6933
347 Ga0268266_10018744 3300028379 Bacteria 5896
348 Ga0268266_10035391 3300028379 Bacteria 4248
349 Ga0268265_10000016 3300028380 Bacteria 299380
350 Ga0268265_10006081 3300028380 Bacteria 8198
351 Ga0268265_10341081 3300028380 Bacteria 1364
352 Ga0268264_10000026 3300028381 Bacteria 459088
353 Ga0268264_10005462 3300028381 Bacteria 10773
354 Ga0268264_10989637 3300028381 Bacteria 847
355 Ga0265328_10032953 3300031239 Bacteria 1921
356 Ga0265327_10001529 3300031251 Bacteria 28541
357 Ga0307410_10110305 3300031852 Bacteria 1990
358 Ga0307410_10138334 3300031852 Bacteria 1798
359 Ga0307410_10213501 3300031852 Bacteria 1480
360 Ga0307412_10211310 3300031911 Bacteria 1481
361 Ga0307411_10131310 3300032005 Bacteria 1831
362 Ga0307415_100062750 3300032126 Bacteria 2579
363 Ga0373951_0029874 3300035091 Bacteria 1281
364 Ga0373960_0153489 3300035121 Bacteria 788
365 Ga0373942_0071039 3300035207 Bacteria 1017
366 Ga0373931_0036844 3300035691 Bacteria 2552
367 Ga0373935_0220087 3300035692 Bacteria 1318
368 Ga0436364_0365224 3300037853 Bacteria 9944
369 Ga0436365_0187823 3300039437 Bacteria 22544
370 Ga0436365_0810711 3300039437 Bacteria 50192
371 Ga0436365_1270341 3300039437 Bacteria 6956
372 Ga0436363_0156358 3300039450 Bacteria 731
373 Ga0439461_0000404 3300041410 Bacteria 6213
374 Ga0439461_0005742 3300041410 Bacteria 2131
375 Ga0439466_0000522 3300041411 Bacteria 14489
376 Ga0439466_0008200 3300041411 Bacteria 3938
377 Ga0439466_0045718 3300041411 Bacteria 1447
378 Ga0439466_0050507 3300041411 Bacteria 1364
379 Ga0439465_0004656 3300041413 Bacteria 4425
380 Ga0439465_0005224 3300041413 Bacteria 4158
381 Ga0451795_1374281 3300041456 Bacteria 1878
382 Ga0439431_0015280 3300041997 Bacteria 1785
383 Ga0439433_0095293 3300041999 Bacteria 735
384 Ga0439442_042242 3300042002 Bacteria 959
385 Ga0439445_0027353 3300042004 Bacteria 1464
386 Ga0439434_0003351 3300042435 Bacteria 4698
387 Ga0466969_0240702 3300044656 Bacteria 821
388 Ga0466972_0013462 3300044658 Bacteria 4107
389 Ga0466972_0110124 3300044658 Bacteria 1301
390 Ga0466965_0001984 3300044683 Bacteria 8555
391 Ga0466965_0004690 3300044683 Bacteria 6095
392 Ga0466965_0014773 3300044683 Bacteria 3698
393 Ga0466965_0024517 3300044683 Bacteria 2919
394 Ga0466966_0009377 3300044684 Bacteria 6479
395 Ga0466966_0027261 3300044684 Bacteria 3726
396 Ga0466966_0029925 3300044684 Bacteria 3540
397 Ga0466961_0004379 3300044693 Bacteria 8843
398 Ga0466963_0338456 3300044694 Bacteria 1059
399 Ga0466964_0024087 3300044706 Bacteria 2370
400 Ga0466971_0004459 3300044719 Bacteria 6045
401 Ga0466968_0020558 3300044735 Bacteria 2666
402 Ga0466970_0020485 3300044765 Bacteria 3436
403 Ga0466957_0004331 3300044842 Bacteria 7884
404 Ga0466957_0011948 3300044842 Bacteria 5019
405 Ga0466957_0024369 3300044842 Bacteria 3581
406 Ga0466957_0153544 3300044842 Bacteria 1491
407 Ga0466960_0001311 3300044901 Bacteria 9013
408 Ga0466960_0004775 3300044901 Bacteria 5323
409 Ga0466960_0008435 3300044901 Bacteria 4220
410 Ga0466960_0115250 3300044901 Bacteria 1401
411 Ga0466959_0008780 3300045049 Bacteria 7159
412 Ga0466959_0027751 3300045049 Bacteria 4198
413 Ga0466959_0038392 3300045049 Bacteria 3538
414 Ga0466958_0005687 3300045836 Bacteria 6734
415 Ga0466958_0058044 3300045836 Bacteria 2353
416 Ga0466958_0120523 3300045836 Bacteria 1642
417 Ga0466958_0305373 3300045836 Bacteria 1022
418 Ga0466967_0016654 3300045976 Bacteria 5805
419 Ga0466967_0023623 3300045976 Bacteria 5042
420 Ga0466967_0058742 3300045976 Bacteria 3401
421 Ga0466967_0091511 3300045976 Bacteria 2765
422 Ga0466967_0407052 3300045976 Bacteria 1324
423 Ga0466967_0537185 3300045976 Bacteria 1150
424 Ga0466967_0767867 3300045976 Bacteria 956
425 Ga0495603_0073672 3300046455 Bacteria 2006
426 Ga0495629_0015693 3300046459 Bacteria 5437
427 Ga0495638_0001596 3300046460 Bacteria 20236
428 Ga0495641_0044293 3300046461 Bacteria 2053
429 Ga0495580_0156133 3300046472 Bacteria 1580
430 Ga0495639_0082797 3300046475 Bacteria 1496
431 Ga0495594_0113089 3300046499 Bacteria 1531
432 Ga0495583_0250071 3300046506 Bacteria 711
433 Ga0495606_0035335 3300046507 Bacteria 3417
434 Ga0495654_0036703 3300046530 Bacteria 2462
435 Ga0495668_0021580 3300046616 Bacteria 3690
436 Ga0495611_0043085 3300046648 Bacteria 2017
437 Ga0495625_0105701 3300046660 Bacteria 1928
438 Ga0495625_0281942 3300046660 Bacteria 1069
439 Ga0495635_0142508 3300046663 Bacteria 1632
440 Ga0495588_0132122 3300046674 Bacteria 1317
441 Ga0495649_0181753 3300046694 Bacteria 1097
442 Ga0495581_0005638 3300047315 Bacteria 7259
443 Ga0495674_0019094 3300047319 Bacteria 6371
444 Ga0495674_0680019 3300047319 Bacteria 809
445 Ga0495672_0003416 3300047320 Bacteria 13614
446 Ga0495676_0173617 3300047321 Bacteria 1515
447 Ga0495686_0007394 3300047472 Bacteria 8241
448 Ga0496100_0000335 3300048903 Bacteria 22955
449 Ga0496100_0001739 3300048903 Bacteria 10862
450 Ga0496100_0001922 3300048903 Bacteria 10390
451 Ga0496100_0008998 3300048903 Bacteria 5591
452 Ga0496100_0098643 3300048903 Bacteria 2009
453 Ga0496101_0002418 3300048904 Bacteria 11467
454 Ga0496101_0003567 3300048904 Bacteria 9707
455 Ga0496101_0007255 3300048904 Bacteria 7172
456 Ga0496101_0007839 3300048904 Bacteria 6945
457 Ga0496101_0103368 3300048904 Bacteria 2135
458 Ga0496101_0261570 3300048904 Bacteria 1350
459 Ga0496102_0000750 3300048905 Bacteria 31716
460 Ga0496102_0004236 3300048905 Bacteria 12127
461 Ga0496102_0004464 3300048905 Bacteria 11805
462 Ga0496102_0015485 3300048905 Bacteria 6644
463 Ga0496102_0067264 3300048905 Bacteria 3286
464 Ga0496102_0111102 3300048905 Bacteria 2555
465 Ga0496102_0485392 3300048905 Bacteria 1157
466 Ga0496103_0005346 3300048906 Bacteria 7696
467 Ga0496103_0010488 3300048906 Bacteria 5484
468 Ga0496103_0010533 3300048906 Bacteria 5474
469 Ga0496103_0021306 3300048906 Bacteria 3899
470 Ga0496103_0124362 3300048906 Bacteria 1644
471 Ga0496103_0125790 3300048906 Bacteria 1635
472 Ga0496104_0020048 3300048907 Bacteria 6125
473 Ga0496104_0031766 3300048907 Bacteria 4912
474 Ga0496104_0148854 3300048907 Bacteria 2247
475 Ga0496104_0512530 3300048907 Bacteria 1111
476 Ga0496106_0000199 3300048909 Bacteria 42320
477 Ga0496106_0003032 3300048909 Bacteria 12507
478 Ga0496106_0003338 3300048909 Bacteria 11963
479 Ga0496106_0103117 3300048909 Bacteria 2213
480 Ga0496106_0137018 3300048909 Bacteria 1923
481 Ga0496107_0006633 3300048910 Bacteria 7968
482 Ga0496107_0010568 3300048910 Bacteria 6417
483 Ga0496107_0186629 3300048910 Bacteria 1540
484 Ga0496108_0004467 3300048911 Bacteria 11258
485 Ga0496108_0005411 3300048911 Bacteria 10322
486 Ga0496108_0026682 3300048911 Bacteria 4767
487 Ga0496108_0050927 3300048911 Bacteria 3469
488 Ga0496108_0077332 3300048911 Bacteria 2814
489 Ga0496108_0198378 3300048911 Bacteria 1741
490 Ga0496109_0003614 3300048912 Bacteria 12930
491 Ga0496109_0025970 3300048912 Bacteria 5220
492 Ga0496109_0038555 3300048912 Bacteria 4321
493 Ga0496109_0169960 3300048912 Bacteria 2045
494 Ga0496110_0004869 3300048913 Bacteria 10475
495 Ga0496110_0179239 3300048913 Bacteria 1924
496 Ga0496111_0027187 3300048914 Bacteria 4045
497 Ga0496111_0035635 3300048914 Bacteria 3558
498 Ga0496112_0004724 3300048915 Bacteria 11611
499 Ga0496112_0006675 3300048915 Bacteria 10159
500 Ga0496112_0066787 3300048915 Bacteria 3549
501 Ga0496112_0158599 3300048915 Bacteria 2229
502 Ga0496112_0433239 3300048915 Bacteria 1253
503 Ga0496113_0047945 3300048916 Bacteria 3177
504 Ga0496113_0053374 3300048916 Bacteria 3022
505 Ga0496113_0179549 3300048916 Bacteria 1678
506 Ga0496114_0001803 3300048917 Bacteria 16262
507 Ga0496114_0003949 3300048917 Bacteria 11440
508 Ga0496114_0004141 3300048917 Bacteria 11219
509 Ga0496115_0006492 3300048918 Bacteria 8574
510 Ga0496115_0017689 3300048918 Bacteria 5456
511 Ga0496115_0061508 3300048918 Bacteria 3027
512 Ga0496116_0012697 3300048919 Bacteria 6852
513 Ga0496116_0045828 3300048919 Bacteria 2956
514 Ga0496117_0003028 3300048920 Bacteria 20155
515 Ga0496117_0248895 3300048920 Bacteria 971
516 Ga0496117_0384674 3300048920 Bacteria 713
517 Ga0496118_0002102 3300048921 Bacteria 27974
518 Ga0496118_0008887 3300048921 Bacteria 10267
519 Ga0496118_0015628 3300048921 Bacteria 7014
520 Ga0496119_0004206 3300048922 Bacteria 14450
521 Ga0496119_0015855 3300048922 Bacteria 5769
522 Ga0496120_0024956 3300048923 Bacteria 3718
523 Ga0496121_0000433 3300048924 Bacteria 82438
524 Ga0496121_0021572 3300048924 Bacteria 6301
525 Ga0496122_0007865 3300048925 Bacteria 11712
526 Ga0496123_0017857 3300048926 Bacteria 5681
527 Ga0496124_0000015 3300048927 Bacteria 460700
528 Ga0496124_0304768 3300048927 Bacteria 1148
529 Ga0496125_0000021 3300048928 Bacteria 460688
530 Ga0496125_0020483 3300048928 Bacteria 6206
531 Ga0496126_0000015 3300048929 Bacteria 663212
532 Ga0496126_0012532 3300048929 Bacteria 8680
533 Ga0496126_0024047 3300048929 Bacteria 5887
534 Ga0501031_0383490 3300049568 Bacteria 909
535 Ga0501032_0009668 3300049569 Bacteria 6984
536 Ga0501032_0013367 3300049569 Bacteria 5842
537 Ga0501032_0059162 3300049569 Bacteria 2572
538 Ga0501033_0029901 3300049570 Bacteria 4094
539 Ga0501033_0322513 3300049570 Bacteria 1085
540 Ga0501034_0016882 3300049571 Bacteria 7486
541 Ga0501034_0133340 3300049571 Bacteria 2466
542 Ga0501034_0376664 3300049571 Bacteria 1345
543 Ga0501036_0028555 3300049572 Bacteria 4714
544 Ga0501036_0112043 3300049572 Bacteria 2305
545 Ga0501037_0001123 3300049573 Bacteria 19813
546 Ga0501037_0021147 3300049573 Bacteria 4807
547 Ga0501038_0040259 3300049574 Bacteria 4083
548 Ga0501039_0001048 3300049575 Bacteria 20241
549 Ga0501043_0000606 3300049579 Bacteria 31710
550 Ga0501046_0046954 3300049580 Bacteria 3425
551 Ga0501047_0011816 3300049581 Bacteria 8258
552 Ga0501048_0001136 3300049582 Bacteria 19978
553 Ga0501067_0032745 3300049583 Bacteria 2885
554 Ga0501068_0259777 3300049584 Bacteria 1108
555 Ga0501069_0045568 3300049585 Bacteria 2430
556 Ga0501070_0010023 3300049586 Bacteria 8016
557 Ga0501070_0010888 3300049586 Bacteria 7681
558 Ga0501070_0278793 3300049586 Bacteria 1364
559 Ga0501073_0285299 3300049589 Bacteria 1139
560 Ga0501077_0487817 3300049593 Bacteria 790
561 Ga0501080_0106032 3300049742 Bacteria 2605
562 Ga0501083_0298287 3300049744 Bacteria 1048
563 Ga0501035_0005336 3300049822 Bacteria 12158
564 Ga0501035_0016732 3300049822 Bacteria 6761
565 Ga0501035_0051207 3300049822 Bacteria 3698
566 Ga0501044_0003964 3300049823 Bacteria 16580
567 Ga0501044_0005770 3300049823 Bacteria 13701
568 Ga0501044_0064865 3300049823 Bacteria 3726
569 Ga0501044_0247111 3300049823 Bacteria 1726
570 nmdc:mga03683_137033_c1 3300050489 Bacteria 1098
571 nmdc:mga03683_25099_c1 3300050489 Bacteria 2337
572 nmdc:mga03683_351858_c1 3300050489 Bacteria 697
573 nmdc:mga03n38_16295_c1 3300050490 Bacteria 2889
574 nmdc:mga03n38_19381_c1 3300050490 Bacteria 2703
575 nmdc:mga03n38_3929_c1 3300050490 Bacteria 4845
576 nmdc:mga03n38_50588_c1 3300050490 Bacteria 1853
577 nmdc:mga03n38_57008_c1 3300050490 Bacteria 1765
578 nmdc:mga03n38_86483_c1 3300050490 Bacteria 1484
579 nmdc:mga00v17_111706_c1 3300050491 Bacteria 1734
580 nmdc:mga00v17_22223_c1 3300050491 Bacteria 3658
581 nmdc:mga00v17_238766_c1 3300050491 Bacteria 1178
582 nmdc:mga00v17_25871_c1 3300050491 Bacteria 3414
583 nmdc:mga00v17_34043_c1 3300050491 Bacteria 3023
584 nmdc:mga00v17_53892_c1 3300050491 Bacteria 2453
585 nmdc:mga0yw44_185365_c1 3300050492 Bacteria 1371
586 nmdc:mga0yw44_324316_c1 3300050492 Bacteria 1034
587 nmdc:mga06z11_196919_c1 3300050494 Bacteria 1168
588 nmdc:mga06z11_235732_c1 3300050494 Bacteria 1073
589 nmdc:mga06z11_25478_c1 3300050494 Bacteria 2803
590 nmdc:mga04h51_221262_c1 3300050495 Bacteria 750
591 nmdc:mga04h51_28299_c1 3300050495 Bacteria 1384
592 nmdc:mga07m45_331609_c1 3300050496 Bacteria 884
593 nmdc:mga07m45_44666_c1 3300050496 Bacteria 2487
594 nmdc:mga07m45_47943_c1 3300050496 Bacteria 2402
595 nmdc:mga07m45_62574_c1 3300050496 Bacteria 2109
596 nmdc:mga07m45_9488_c1 3300050496 Bacteria 5050
597 nmdc:mga05p37_201265_c1 3300050507 Bacteria 2412
598 nmdc:mga09592_433287_c1 3300050508 Bacteria 1135
599 nmdc:mga0qj67_28730_c1 3300050509 Bacteria 926
600 nmdc:mga0qj67_62485_c1 3300050509 Bacteria 2959
601 nmdc:mga0qj67_8753_c1 3300050509 Bacteria 7510
602 nmdc:mga06r32_129091_c1 3300050510 Bacteria 2498
603 nmdc:mga0sz30_2463_c1 3300050516 Bacteria 6591
604 nmdc:mga0sz30_2692_c2 3300050516 Bacteria 3444
605 nmdc:mga0sz30_332630_c1 3300050516 Bacteria 678
606 Ga0500610_0003698 3300053079 Bacteria 5928
607 Ga0500556_0013962 3300053104 Bacteria 2443
608 Ga0500556_0058531 3300053104 Bacteria 1413
609 Ga0500616_0003817 3300053153 Bacteria 11177
610 Ga0500620_106382 3300053155 Bacteria 982
611 Ga0466962_0005252 3300061719 Bacteria 6222
612 Ga0466962_0256767 3300061719 Bacteria 860
613 2644488687 2643221687 Bacteria 6500351
614 2644636695 2643221715 Bacteria 6671032
615 2738664976 2738541264 Bacteria 5935393
616 2739144110 2738541356 Bacteria 5935017
617 2842137813 2842134933 Bacteria 5847019
618 2902795769 2902792274 Bacteria 7270173
619 2902811841 2902810491 Bacteria 6794147
620 2902838571 2902837492 Bacteria 6697721
621 2929215661 2929212328 Bacteria 7708288
622 2939589352 2939582691 Bacteria 7088898
623 JGI24743J22301_10001495
624 JGI24737J22298_10089555
625 JGI24735J21928_10019734
626 JGI24749J21850_1021685
627 JGI24744J21845_10008588
628 JGI24744J21845_10011818
629 JGI24034J26672_10027793
630 Ga0055540_1000211
631 Ga0055540_1002075
632 Ga0055540_1002792
633 Ga0055540_1008630
634 Ga0070676_10001631
635 Ga0070683_100228734
636 Ga0070690_100004005
637 Ga0070670_100081730
638 Ga0068869_100033086
639 Ga0070666_10227111
640 Ga0070682_100047106
641 Ga0070682_100404783
642 Ga0068868_100007809
643 Ga0068868_100081429
644 Ga0070689_100089687
645 Ga0070687_100422280
646 Ga0070692_10008567
647 Ga0070668_100007872
648 Ga0070668_100007937
649 Ga0070668_100291853
650 Ga0070669_100002083
651 Ga0070669_100013695
652 Ga0070675_100513669
653 Ga0070675_100679109
654 Ga0070671_100000370
655 Ga0070671_100013695
656 Ga0070671_100074653
657 Ga0070674_100001374
658 Ga0070674_100007715
659 Ga0070674_100395294
660 Ga0070674_100732785
661 Ga0070673_100048232
662 Ga0070688_100013371
663 Ga0070688_100074312
664 Ga0070659_100059342
665 Ga0070667_100000562
666 Ga0070667_100002728
667 Ga0070667_100014776
668 Ga0070667_100096259
669 Ga0070667_100275832
670 Ga0070667_100633038
671 Ga0070709_10025246
672 Ga0070714_100018330
673 Ga0070713_100343988
674 Ga0070710_10003645
675 Ga0070710_10010120
676 Ga0070701_10002014
677 Ga0070711_100005138
678 Ga0070711_100031566
679 Ga0070711_100040517
680 Ga0070705_100005820
681 Ga0070700_100003071
682 Ga0070700_100069352
683 Ga0070694_100003154
684 Ga0070694_100188345
685 Ga0070663_100214166
686 Ga0070678_100002271
687 Ga0070678_100013638
688 Ga0070678_100654484
689 Ga0070662_100006532
690 Ga0070662_100169691
691 Ga0068867_100008196
692 Ga0068867_100175631
693 Ga0068867_100405126
694 Ga0070685_10009346
695 Ga0070685_10065625
696 Ga0070685_10217541
697 Ga0070679_100276293
698 Ga0068853_100003543
699 Ga0068853_100010244
700 Ga0068853_100067862
701 Ga0070672_100082871
702 Ga0070686_100016113
703 Ga0070695_100011864
704 Ga0070696_100010335
705 Ga0070696_100160816
706 Ga0070693_100001335
707 Ga0070665_100035002
708 Ga0070665_100082762
709 Ga0070665_100279378
710 Ga0070704_100002767
711 Ga0070704_100094734
712 Ga0068855_100376026
713 Ga0068855_100515434
714 Ga0068854_100002196
715 Ga0068854_100090966
716 Ga0070702_100000252
717 Ga0070702_100717021
718 Ga0068852_100031617
719 Ga0068852_100131328
720 Ga0068852_100278092
721 Ga0068859_100001857
722 Ga0068859_100005777
723 Ga0068859_100309904
724 Ga0068864_100111710
725 Ga0068864_100150917
726 Ga0068864_100183276
727 Ga0068864_100383677
728 Ga0068866_10001145
729 Ga0068861_100165199
730 Ga0068861_100769306
731 Ga0068863_100007827
732 Ga0068863_100010106
733 Ga0068863_100299078
734 Ga0068858_100004001
735 Ga0068858_100163095
736 Ga0068858_100285702
737 Ga0068860_100000112
738 Ga0068860_100006354
739 Ga0068860_100162844
740 Ga0068862_100001577
741 Ga0068862_100005634
742 Ga0068862_100274309
743 Ga0081455_10041927
744 Ga0081455_10049404
745 Ga0081455_10134554
746 Ga0081455_10286487
747 Ga0081538_10059970
748 Ga0075365_10004891
749 Ga0075365_10108851
750 Ga0075365_10220165
751 Ga0075365_10352284
752 Ga0075365_10458848
753 Ga0075365_10462425
754 Ga0075368_10020991
755 Ga0075363_100004281
756 Ga0075363_100006395
757 Ga0075363_100009129
758 Ga0075363_100020599
759 Ga0075363_100051632
760 Ga0075363_100132638
761 Ga0075363_100136670
762 Ga0075363_100157704
763 Ga0075364_10005714
764 Ga0075364_10010907
765 Ga0075364_10011622
766 Ga0075364_10027397
767 Ga0075364_10036102
768 Ga0075364_10037188
769 Ga0075364_10044214
770 Ga0075364_10058020
771 Ga0075364_10292511
772 Ga0070715_10004988
773 Ga0070715_10006490
774 Ga0070716_100066514
775 Ga0070716_100475733
776 Ga0070712_100013734
777 Ga0070712_100023062
778 Ga0075362_10013485
779 Ga0075362_10029621
780 Ga0075362_10158504
781 Ga0075362_10159031
782 Ga0075367_10074227
783 Ga0075367_10201648
784 Ga0075369_10002345
785 Ga0075369_10003891
786 Ga0075369_10018680
787 Ga0075369_10045797
788 Ga0075370_10007437
789 Ga0075370_10010718
790 Ga0075370_10011476
791 Ga0075370_10073372
792 Ga0075370_10091645
793 Ga0075370_10178036
794 Ga0068871_100155117
795 Ga0075428_100000630
796 Ga0075430_100006119
797 Ga0075430_100269912
798 Ga0075431_100110488
799 Ga0075433_10564354
800 Ga0075429_100145167
801 Ga0068865_100000680
802 Ga0068865_100159014
803 Ga0097620_100001857
804 Ga0097620_100005777
805 Ga0097620_100309917
806 Ga0099795_10002326
807 Ga0105250_10030996
808 Ga0105250_10075586
809 Ga0111539_11110843
810 Ga0105245_10001865
811 Ga0105245_10523166
812 Ga0105245_11362188
813 Ga0105247_10000007
814 Ga0105247_10001456
815 Ga0114129_10009646
816 Ga0105243_10002145
817 Ga0105241_10029760
818 Ga0105241_10262034
819 Ga0105242_10011881
820 Ga0105242_10556505
821 Ga0105242_10682394
822 Ga0105248_10002480
823 Ga0105248_10024994
824 Ga0105248_10260919
825 Ga0105248_10297152
826 Ga0105237_10049272
827 Ga0105237_10230134
828 Ga0105238_10337065
829 Ga0105238_10647552
830 Ga0105249_10000001
831 Ga0105249_10001870
832 Ga0105249_10010413
833 Ga0099796_10034725
834 Ga0105239_10007675
835 Ga0105239_10043158
836 Ga0105239_10391847
837 Ga0105246_10149559
838 Ga0157373_10483275
839 Ga0157371_10174928
840 Ga0157369_10085639
841 Ga0157369_10550066
842 Ga0157374_10009985
843 Ga0157374_10036891
844 Ga0157374_10130572
845 Ga0157378_10022145
846 Ga0163162_10005764
847 Ga0163162_10098793
848 Ga0163162_10208488
849 Ga0163162_10563947
850 Ga0163162_10603413
851 Ga0157372_10003317
852 Ga0157372_10623749
853 Ga0157375_10018186
854 Ga0157375_10184201
855 Ga0157375_11063276
856 Ga0163163_10004608
857 Ga0163163_10025282
858 Ga0157380_10005882
859 Ga0157380_10193289
860 Ga0157380_10524153
861 Ga0182008_10369533
862 Ga0157377_10105692
863 Ga0157379_10116768
864 Ga0157379_10210879
865 Ga0157379_10257539
866 Ga0157376_10049583
867 Ga0157376_10067523
868 Ga0163161_10003421
869 Ga0163161_10094597
870 Ga0213876_10116747
871 Ga0213875_10012858
872 Ga0209051_1000011
873 Ga0209051_1000795
874 Ga0209051_1002312
875 Ga0209051_1008885
876 Ga0207682_10182104
877 Ga0207692_10003270
878 Ga0207692_10116961
879 Ga0207642_10003553
880 Ga0207710_10000013
881 Ga0207710_10032410
882 Ga0207688_10007393
883 Ga0207688_10115664
884 Ga0207680_10027599
885 Ga0207647_10013820
886 Ga0207647_10080732
887 Ga0207685_10001953
888 Ga0207699_10016166
889 Ga0207699_10360553
890 Ga0207645_10076971
891 Ga0207654_10140195
892 Ga0207671_10059929
893 Ga0207693_10002493
894 Ga0207693_10004546
895 Ga0207663_10002049
896 Ga0207662_10079717
897 Ga0207681_10001110
898 Ga0207681_10036599
899 Ga0207659_10075564
900 Ga0207687_10005326
901 Ga0207687_10033461
902 Ga0207687_10089785
903 Ga0207644_10027484
904 Ga0207644_10034503
905 Ga0207690_10060776
906 Ga0207690_10692821
907 Ga0207706_10002446
908 Ga0207706_10091640
909 Ga0207686_10005359
910 Ga0207709_10002109
911 Ga0207670_10091637
912 Ga0207669_10000816
913 Ga0207669_10057563
914 Ga0207704_10001973
915 Ga0207704_10086110
916 Ga0207665_10009085
917 Ga0207665_10573363
918 Ga0207691_10043145
919 Ga0207711_10001465
920 Ga0207711_10121121
921 Ga0207711_10179221
922 Ga0207689_10012222
923 Ga0207689_10026531
924 Ga0207661_10123262
925 Ga0207679_10972796
926 Ga0207667_10390381
927 Ga0207651_10040915
928 Ga0207712_10000006
929 Ga0207712_10002457
930 Ga0207668_10005239
931 Ga0207668_10009865
932 Ga0207668_10026610
933 Ga0207640_10002500
934 Ga0207640_10075635
935 Ga0207640_10083941
936 Ga0207658_10000970
937 Ga0207658_10002350
938 Ga0207658_10013888
939 Ga0207658_10019601
940 Ga0207658_10122816
941 Ga0207658_10336922
942 Ga0207677_10023178
943 Ga0207677_10104938
944 Ga0207703_10016085
945 Ga0207703_10016553
946 Ga0207703_10300163
947 Ga0207639_10006599
948 Ga0207639_10008954
949 Ga0207678_10034015
950 Ga0207678_10059708
951 Ga0207678_10569187
952 Ga0207708_10005219
953 Ga0207708_10596284
954 Ga0207641_10006251
955 Ga0207641_10009261
956 Ga0207648_10008947
957 Ga0207648_10020109
958 Ga0207676_10009430
959 Ga0207676_10151274
960 Ga0207676_10152812
961 Ga0207675_100005589
962 Ga0207675_100194216
963 Ga0207683_10003601
964 Ga0207683_10010479
965 Ga0207698_10051501
966 Ga0207698_10460826
967 Ga0268266_10007320
968 Ga0268266_10013894
969 Ga0268266_10018744
970 Ga0268266_10035391
971 Ga0268265_10000016
972 Ga0268265_10006081
973 Ga0268265_10341081
974 Ga0268264_10000026
975 Ga0268264_10005462
976 Ga0268264_10989637
977 Ga0265328_10032953
978 Ga0265327_10001529
979 Ga0307410_10110305
980 Ga0307410_10138334
981 Ga0307410_10213501
982 Ga0307412_10211310
983 Ga0307411_10131310
984 Ga0307415_100062750
985 Ga0373951_0029874
986 Ga0373960_0153489
987 Ga0373942_0071039
988 Ga0373931_0036844
989 Ga0373935_0220087
990 Ga0436364_0365224
991 Ga0436365_0187823
992 Ga0436365_0810711
993 Ga0436365_1270341
994 Ga0436363_0156358
995 Ga0439461_0000404
996 Ga0439461_0005742
997 Ga0439466_0000522
998 Ga0439466_0008200
999 Ga0439466_0045718
1000 Ga0439466_0050507
1001 Ga0439465_0004656
1002 Ga0439465_0005224
1003 Ga0451795_1374281
1004 Ga0439431_0015280
1005 Ga0439433_0095293
1006 Ga0439442_042242
1007 Ga0439445_0027353
1008 Ga0439434_0003351
1009 Ga0466969_0240702
1010 Ga0466972_0013462
1011 Ga0466972_0110124
1012 Ga0466965_0001984
1013 Ga0466965_0004690
1014 Ga0466965_0014773
1015 Ga0466965_0024517
1016 Ga0466966_0009377
1017 Ga0466966_0027261
1018 Ga0466966_0029925
1019 Ga0466961_0004379
1020 Ga0466963_0338456
1021 Ga0466964_0024087
1022 Ga0466971_0004459
1023 Ga0466968_0020558
1024 Ga0466970_0020485
1025 Ga0466957_0004331
1026 Ga0466957_0011948
1027 Ga0466957_0024369
1028 Ga0466957_0153544
1029 Ga0466960_0001311
1030 Ga0466960_0004775
1031 Ga0466960_0008435
1032 Ga0466960_0115250
1033 Ga0466959_0008780
1034 Ga0466959_0027751
1035 Ga0466959_0038392
1036 Ga0466958_0005687
1037 Ga0466958_0058044
1038 Ga0466958_0120523
1039 Ga0466958_0305373
1040 Ga0466967_0016654
1041 Ga0466967_0023623
1042 Ga0466967_0058742
1043 Ga0466967_0091511
1044 Ga0466967_0407052
1045 Ga0466967_0537185
1046 Ga0466967_0767867
1047 Ga0495603_0073672
1048 Ga0495629_0015693
1049 Ga0495638_0001596
1050 Ga0495641_0044293
1051 Ga0495580_0156133
1052 Ga0495639_0082797
1053 Ga0495594_0113089
1054 Ga0495583_0250071
1055 Ga0495606_0035335
1056 Ga0495654_0036703
1057 Ga0495668_0021580
1058 Ga0495611_0043085
1059 Ga0495625_0105701
1060 Ga0495625_0281942
1061 Ga0495635_0142508
1062 Ga0495588_0132122
1063 Ga0495649_0181753
1064 Ga0495581_0005638
1065 Ga0495674_0019094
1066 Ga0495674_0680019
1067 Ga0495672_0003416
1068 Ga0495676_0173617
1069 Ga0495686_0007394
1070 Ga0496100_0000335
1071 Ga0496100_0001739
1072 Ga0496100_0001922
1073 Ga0496100_0008998
1074 Ga0496100_0098643
1075 Ga0496101_0002418
1076 Ga0496101_0003567
1077 Ga0496101_0007255
1078 Ga0496101_0007839
1079 Ga0496101_0103368
1080 Ga0496101_0261570
1081 Ga0496102_0000750
1082 Ga0496102_0004236
1083 Ga0496102_0004464
1084 Ga0496102_0015485
1085 Ga0496102_0067264
1086 Ga0496102_0111102
1087 Ga0496102_0485392
1088 Ga0496103_0005346
1089 Ga0496103_0010488
1090 Ga0496103_0010533
1091 Ga0496103_0021306
1092 Ga0496103_0124362
1093 Ga0496103_0125790
1094 Ga0496104_0020048
1095 Ga0496104_0031766
1096 Ga0496104_0148854
1097 Ga0496104_0512530
1098 Ga0496106_0000199
1099 Ga0496106_0003032
1100 Ga0496106_0003338
1101 Ga0496106_0103117
1102 Ga0496106_0137018
1103 Ga0496107_0006633
1104 Ga0496107_0010568
1105 Ga0496107_0186629
1106 Ga0496108_0004467
1107 Ga0496108_0005411
1108 Ga0496108_0026682
1109 Ga0496108_0050927
1110 Ga0496108_0077332
1111 Ga0496108_0198378
1112 Ga0496109_0003614
1113 Ga0496109_0025970
1114 Ga0496109_0038555
1115 Ga0496109_0169960
1116 Ga0496110_0004869
1117 Ga0496110_0179239
1118 Ga0496111_0027187
1119 Ga0496111_0035635
1120 Ga0496112_0004724
1121 Ga0496112_0006675
1122 Ga0496112_0066787
1123 Ga0496112_0158599
1124 Ga0496112_0433239
1125 Ga0496113_0047945
1126 Ga0496113_0053374
1127 Ga0496113_0179549
1128 Ga0496114_0001803
1129 Ga0496114_0003949
1130 Ga0496114_0004141
1131 Ga0496115_0006492
1132 Ga0496115_0017689
1133 Ga0496115_0061508
1134 Ga0496116_0012697
1135 Ga0496116_0045828
1136 Ga0496117_0003028
1137 Ga0496117_0248895
1138 Ga0496117_0384674
1139 Ga0496118_0002102
1140 Ga0496118_0008887
1141 Ga0496118_0015628
1142 Ga0496119_0004206
1143 Ga0496119_0015855
1144 Ga0496120_0024956
1145 Ga0496121_0000433
1146 Ga0496121_0021572
1147 Ga0496122_0007865
1148 Ga0496123_0017857
1149 Ga0496124_0000015
1150 Ga0496124_0304768
1151 Ga0496125_0000021
1152 Ga0496125_0020483
1153 Ga0496126_0000015
1154 Ga0496126_0012532
1155 Ga0496126_0024047
1156 Ga0501031_0383490
1157 Ga0501032_0009668
1158 Ga0501032_0013367
1159 Ga0501032_0059162
1160 Ga0501033_0029901
1161 Ga0501033_0322513
1162 Ga0501034_0016882
1163 Ga0501034_0133340
1164 Ga0501034_0376664
1165 Ga0501036_0028555
1166 Ga0501036_0112043
1167 Ga0501037_0001123
1168 Ga0501037_0021147
1169 Ga0501038_0040259
1170 Ga0501039_0001048
1171 Ga0501043_0000606
1172 Ga0501046_0046954
1173 Ga0501047_0011816
1174 Ga0501048_0001136
1175 Ga0501067_0032745
1176 Ga0501068_0259777
1177 Ga0501069_0045568
1178 Ga0501070_0010023
1179 Ga0501070_0010888
1180 Ga0501070_0278793
1181 Ga0501073_0285299
1182 Ga0501077_0487817
1183 Ga0501080_0106032
1184 Ga0501083_0298287
1185 Ga0501035_0005336
1186 Ga0501035_0016732
1187 Ga0501035_0051207
1188 Ga0501044_0003964
1189 Ga0501044_0005770
1190 Ga0501044_0064865
1191 Ga0501044_0247111
1192 nmdc:mga03683_137033_c1
1193 nmdc:mga03683_25099_c1
1194 nmdc:mga03683_351858_c1
1195 nmdc:mga03n38_16295_c1
1196 nmdc:mga03n38_19381_c1
1197 nmdc:mga03n38_3929_c1
1198 nmdc:mga03n38_50588_c1
1199 nmdc:mga03n38_57008_c1
1200 nmdc:mga03n38_86483_c1
1201 nmdc:mga00v17_111706_c1
1202 nmdc:mga00v17_22223_c1
1203 nmdc:mga00v17_238766_c1
1204 nmdc:mga00v17_25871_c1
1205 nmdc:mga00v17_34043_c1
1206 nmdc:mga00v17_53892_c1
1207 nmdc:mga0yw44_185365_c1
1208 nmdc:mga0yw44_324316_c1
1209 nmdc:mga06z11_196919_c1
1210 nmdc:mga06z11_235732_c1
1211 nmdc:mga06z11_25478_c1
1212 nmdc:mga04h51_221262_c1
1213 nmdc:mga04h51_28299_c1
1214 nmdc:mga07m45_331609_c1
1215 nmdc:mga07m45_44666_c1
1216 nmdc:mga07m45_47943_c1
1217 nmdc:mga07m45_62574_c1
1218 nmdc:mga07m45_9488_c1
1219 nmdc:mga05p37_201265_c1
1220 nmdc:mga09592_433287_c1
1221 nmdc:mga0qj67_28730_c1
1222 nmdc:mga0qj67_62485_c1
1223 nmdc:mga0qj67_8753_c1
1224 nmdc:mga06r32_129091_c1
1225 nmdc:mga0sz30_2463_c1
1226 nmdc:mga0sz30_2692_c2
1227 nmdc:mga0sz30_332630_c1
1228 Ga0500610_0003698
1229 Ga0500556_0013962
1230 Ga0500556_0058531
1231 Ga0500616_0003817
1232 Ga0500620_106382
1233 Ga0466962_0005252
1234 Ga0466962_0256767
1235 2644488687
1236 2644636695
1237 2738664976
1238 2739144110
1239 2842137813
1240 2902795769
1241 2902811841
1242 2902838571
1243 2929215661
1244 2939589352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

38

84

0.98

PF17920

TetR_C_16

Tetracyclin repressor-like, C-terminal domain

104

211

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2np3-assembly1.cif.gz_A crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3. 0.7626 58 196
2np3-assembly1.cif.gz_A crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3. 0.7104 58 196
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.6014 18 120
2ao9-assembly1.cif.gz_E structural genomics, the crystal structure of a phage protein (phbc6a51) from bacillus cereus atcc 14579 0.542 23 72
5nz1-assembly2.cif.gz_C structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with sutezolid 0.5263 19 200
ID Description Score Start End Superfamily
4jykB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9951 19 68 1.10.10.60
6mj1A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9928 19 61 1.10.10.60
1jt6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9902 19 65 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9892 22 68 1.10.10.60
2wv1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9876 19 61 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1T8QL61-F1-model_v4 TetR family transcriptional regulator 0.9094 74 204 GO:0003677
AF-A0A1T8QL61-F1-model_v4 TetR family transcriptional regulator 0.8965 74 204 GO:0003677
AF-A0A5S4ZH51-F1-model_v4 deleted 0.885 24 201
AF-A0A6P1HV43-F1-model_v4 Transcriptional regulator, TetR family 0.88 42 202 GO:0003677
GO:0006355
AF-A0A6P1HV43-F1-model_v4 Transcriptional regulator, TetR family 0.8701 42 202 GO:0003677
GO:0006355

Map