F470025

General Info

Members Datasets Scaffolds Average Seq Length
621 328 621 98

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0437580|Ga0466963_0437580_114_470
Length 118
Sequence MDQITNSHHEGIQMELYAIVRRGGWQTAAELEAAAARSTTTGGEMADEIRWIRSYVLDEGGGALGTVCIYEATSPEAIRNHAARADLRVDEVVPIVDTVVVRPDPIPSAGKASGMNDA

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
89 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
186 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
189 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
227 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.67
Nodule 0
Rhizoplane 11.59
Rhizosphere 81.16
Stem 0
Stem Tuber 0
Unclassified 2.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F6ESG4R02JSG9I 2088090003 Bacteria 514
2 Ga0070658_10896260 3300005327 Bacteria 771
3 Ga0070683_100567868 3300005329 Bacteria 1085
4 Ga0070690_101006684 3300005330 Bacteria 657
5 Ga0070670_101901603 3300005331 Unclassified 548
6 Ga0070666_10035692 3300005335 Bacteria 3298
7 Ga0070680_101226823 3300005336 Bacteria 649
8 Ga0070682_100037846 3300005337 Bacteria 2956
9 Ga0070682_101856062 3300005337 Bacteria 527
10 Ga0068868_100113021 3300005338 Bacteria 2208
11 Ga0068868_100483819 3300005338 Bacteria 1082
12 Ga0070691_10338715 3300005341 Bacteria 832
13 Ga0070687_101027947 3300005343 Bacteria 599
14 Ga0070668_100617242 3300005347 Bacteria 950
15 Ga0070671_100215902 3300005355 Bacteria 1627
16 Ga0070671_100402560 3300005355 Bacteria 1171
17 Ga0070671_100662851 3300005355 Bacteria 904
18 Ga0070674_100007347 3300005356 Bacteria 6497
19 Ga0070674_100012545 3300005356 Bacteria 5206
20 Ga0070674_100848830 3300005356 Bacteria 792
21 Ga0070674_101151418 3300005356 Bacteria 687
22 Ga0070674_101497247 3300005356 Bacteria 606
23 Ga0070674_101552457 3300005356 Bacteria 596
24 Ga0070688_101517274 3300005365 Bacteria 545
25 Ga0070659_101000992 3300005366 Bacteria 734
26 Ga0070659_101483576 3300005366 Unclassified 604
27 Ga0070667_100073988 3300005367 Bacteria 2906
28 Ga0070667_100200590 3300005367 Bacteria 1770
29 Ga0070709_10867346 3300005434 Bacteria 712
30 Ga0070709_11150924 3300005434 Unclassified 622
31 Ga0070714_100028433 3300005435 Unclassified 4638
32 Ga0070714_100579240 3300005435 Bacteria 1076
33 Ga0070714_100796963 3300005435 Bacteria 915
34 Ga0070714_100812223 3300005435 Bacteria 906
35 Ga0070714_101616987 3300005435 Bacteria 633
36 Ga0070714_101622502 3300005435 Bacteria 632
37 Ga0070713_100042390 3300005436 Bacteria 3714
38 Ga0070713_100182480 3300005436 Bacteria 1886
39 Ga0070710_10008592 3300005437 Bacteria 4973
40 Ga0070710_10075568 3300005437 Bacteria 1953
41 Ga0070710_10543528 3300005437 Bacteria 801
42 Ga0070701_10056278 3300005438 Bacteria 2057
43 Ga0070711_100440512 3300005439 Bacteria 1065
44 Ga0070705_100197918 3300005440 Bacteria 1375
45 Ga0070694_101859312 3300005444 Bacteria 514
46 Ga0070663_100000561 3300005455 Bacteria 19777
47 Ga0070663_100105229 3300005455 Bacteria 2112
48 Ga0070663_100589433 3300005455 Bacteria 934
49 Ga0070678_100044415 3300005456 Bacteria 3173
50 Ga0070662_101022731 3300005457 Bacteria 708
51 Ga0070681_11007264 3300005458 Bacteria 753
52 Ga0068867_100139113 3300005459 Bacteria 1896
53 Ga0068867_100944010 3300005459 Bacteria 779
54 Ga0068867_101827571 3300005459 Bacteria 572
55 Ga0070685_11237958 3300005466 Bacteria 568
56 Ga0070679_100004461 3300005530 Bacteria 12929
57 Ga0070679_100862002 3300005530 Bacteria 849
58 Ga0070684_100054948 3300005535 Bacteria 3470
59 Ga0070684_100396419 3300005535 Bacteria 1272
60 Ga0070684_101069068 3300005535 Bacteria 758
61 Ga0070697_100625363 3300005536 Bacteria 947
62 Ga0070686_100038896 3300005544 Bacteria 2960
63 Ga0070695_101147003 3300005545 Bacteria 638
64 Ga0070695_101490415 3300005545 Bacteria 563
65 Ga0070696_100066090 3300005546 Bacteria 2536
66 Ga0070693_100655205 3300005547 Bacteria 764
67 Ga0070693_101501770 3300005547 Bacteria 527
68 Ga0070665_100018684 3300005548 Bacteria 6949
69 Ga0070665_100622851 3300005548 Bacteria 1092
70 Ga0070665_101697504 3300005548 Bacteria 639
71 Ga0070704_100323439 3300005549 Bacteria 1293
72 Ga0070704_100793229 3300005549 Bacteria 846
73 Ga0070704_101818084 3300005549 Bacteria 564
74 Ga0070664_100511837 3300005564 Bacteria 1107
75 Ga0068856_100016851 3300005614 Bacteria 7081
76 Ga0068856_100080843 3300005614 Bacteria 3224
77 Ga0068856_100318175 3300005614 Bacteria 1573
78 Ga0068856_102248985 3300005614 Bacteria 554
79 Ga0070702_100243491 3300005615 Bacteria 1215
80 Ga0070702_100416322 3300005615 Bacteria 966
81 Ga0068852_101448465 3300005616 Bacteria 709
82 Ga0068864_101276731 3300005618 Bacteria 734
83 Ga0068866_10129586 3300005718 Bacteria 1433
84 Ga0068866_10211454 3300005718 Bacteria 1165
85 Ga0068866_10432854 3300005718 Bacteria 856
86 Ga0068861_100302437 3300005719 Bacteria 1386
87 Ga0068861_100561039 3300005719 Bacteria 1042
88 Ga0068870_10407609 3300005840 Bacteria 886
89 Ga0068858_100432342 3300005842 Bacteria 1267
90 Ga0068858_100700079 3300005842 Bacteria 986
91 Ga0068860_100013584 3300005843 Bacteria 7983
92 Ga0068862_100404588 3300005844 Bacteria 1277
93 Ga0081455_10016609 3300005937 Bacteria 7097
94 Ga0081455_10018501 3300005937 Bacteria 6633
95 Ga0081455_10158928 3300005937 Bacteria 1734
96 Ga0081455_10266822 3300005937 Bacteria 1244
97 Ga0081455_10563808 3300005937 Bacteria 750
98 Ga0081455_10743111 3300005937 Bacteria 621
99 Ga0081538_10172051 3300005981 Bacteria 943
100 Ga0081540_1015884 3300005983 Bacteria 4745
101 Ga0070717_10008889 3300006028 Bacteria 7523
102 Ga0070717_10022321 3300006028 Bacteria 5000
103 Ga0070717_10058864 3300006028 Unclassified 3177
104 Ga0070717_10404454 3300006028 Bacteria 1227
105 Ga0070717_10917421 3300006028 Bacteria 797
106 Ga0075365_10041987 3300006038 Bacteria 2989
107 Ga0075365_10329318 3300006038 Bacteria 1076
108 Ga0075365_11040510 3300006038 Bacteria 577
109 Ga0075365_11216966 3300006038 Bacteria 530
110 Ga0075368_10015109 3300006042 Bacteria 2859
111 Ga0075363_100054107 3300006048 Bacteria 2147
112 Ga0075363_100888179 3300006048 Unclassified 545
113 Ga0075364_10037975 3300006051 Bacteria 3120
114 Ga0075364_10421481 3300006051 Unclassified 911
115 Ga0075432_10159955 3300006058 Bacteria 870
116 Ga0075432_10409593 3300006058 Bacteria 587
117 Ga0070715_10055136 3300006163 Bacteria 1724
118 Ga0070716_100358353 3300006173 Bacteria 1035
119 Ga0070716_100411904 3300006173 Bacteria 975
120 Ga0070712_100019883 3300006175 Bacteria 4389
121 Ga0070712_100053110 3300006175 Bacteria 2829
122 Ga0070712_100107204 3300006175 Bacteria 2078
123 Ga0070712_100857199 3300006175 Unclassified 782
124 Ga0075362_10346055 3300006177 Bacteria 743
125 Ga0075367_10114010 3300006178 Bacteria 1661
126 Ga0097621_100081953 3300006237 Bacteria 2686
127 Ga0075370_10006851 3300006353 Bacteria 5763
128 Ga0075370_10063009 3300006353 Bacteria 2113
129 Ga0068871_100030122 3300006358 Bacteria 4271
130 Ga0068871_102206893 3300006358 Bacteria 525
131 Ga0075428_100084060 3300006844 Bacteria 3473
132 Ga0075431_100124751 3300006847 Bacteria 2657
133 Ga0075433_10086386 3300006852 Bacteria 2770
134 Ga0075433_10428891 3300006852 Bacteria 1166
135 Ga0075433_11388620 3300006852 Bacteria 608
136 Ga0075434_101100645 3300006871 Bacteria 808
137 Ga0075434_102078258 3300006871 Bacteria 573
138 Ga0075434_102431525 3300006871 Bacteria 526
139 Ga0075434_102514920 3300006871 Unclassified 516
140 Ga0068865_100418590 3300006881 Bacteria 1101
141 Ga0068865_101829599 3300006881 Bacteria 549
142 Ga0105240_11305882 3300009093 Bacteria 765
143 Ga0111539_10025165 3300009094 Bacteria 7296
144 Ga0111539_12973290 3300009094 Bacteria 548
145 Ga0111539_13146438 3300009094 Bacteria 532
146 Ga0105245_10134981 3300009098 Bacteria 2318
147 Ga0105245_10698838 3300009098 Bacteria 1047
148 Ga0105245_10972604 3300009098 Bacteria 892
149 Ga0105245_11403147 3300009098 Bacteria 748
150 Ga0105247_10019530 3300009101 Bacteria 4069
151 Ga0114129_10978759 3300009147 Bacteria 1067
152 Ga0114129_11062333 3300009147 Bacteria 1016
153 Ga0105243_10049261 3300009148 Bacteria 3323
154 Ga0105243_10154554 3300009148 Bacteria 1971
155 Ga0105243_10165959 3300009148 Bacteria 1908
156 Ga0105243_10181701 3300009148 Bacteria 1830
157 Ga0105243_10867577 3300009148 Bacteria 895
158 Ga0105243_11963380 3300009148 Bacteria 619
159 Ga0105241_10174144 3300009174 Bacteria 1779
160 Ga0105241_10643620 3300009174 Bacteria 962
161 Ga0105241_10933515 3300009174 Bacteria 808
162 Ga0105241_11730174 3300009174 Bacteria 608
163 Ga0105242_10009004 3300009176 Bacteria 7668
164 Ga0105242_10654351 3300009176 Bacteria 1022
165 Ga0105248_10008393 3300009177 Bacteria 11339
166 Ga0105248_10891150 3300009177 Bacteria 1004
167 Ga0105248_11605813 3300009177 Bacteria 737
168 Ga0105237_10114454 3300009545 Bacteria 2690
169 Ga0105238_10527352 3300009551 Bacteria 1184
170 Ga0105238_11504732 3300009551 Bacteria 702
171 Ga0105238_12989252 3300009551 Bacteria 508
172 Ga0105249_12724817 3300009553 Unclassified 566
173 Ga0105239_11350362 3300010375 Bacteria 822
174 Ga0105239_12104727 3300010375 Bacteria 656
175 Ga0105246_10077154 3300011119 Bacteria 2363
176 Ga0105246_10259350 3300011119 Bacteria 1384
177 Ga0105246_10662012 3300011119 Bacteria 910
178 Ga0157347_1032871 3300012502 Unclassified 657
179 Ga0157339_1016172 3300012505 Bacteria 744
180 Ga0157371_10602429 3300013102 Bacteria 817
181 Ga0157369_10407749 3300013105 Bacteria 1410
182 Ga0157369_10808903 3300013105 Bacteria 963
183 Ga0157378_10008117 3300013297 Bacteria 9160
184 Ga0157378_10904787 3300013297 Bacteria 913
185 Ga0157378_10945804 3300013297 Bacteria 894
186 Ga0163162_10862862 3300013306 Bacteria 1020
187 Ga0163162_11102478 3300013306 Bacteria 899
188 Ga0163162_11984395 3300013306 Bacteria 667
189 Ga0157372_10359812 3300013307 Bacteria 1696
190 Ga0157372_11025778 3300013307 Bacteria 955
191 Ga0157372_12041665 3300013307 Bacteria 659
192 Ga0157372_12835072 3300013307 Unclassified 556
193 Ga0157375_11194941 3300013308 Bacteria 892
194 Ga0163163_10112580 3300014325 Bacteria 2751
195 Ga0163163_10121719 3300014325 Bacteria 2643
196 Ga0157379_10016605 3300014968 Bacteria 6475
197 Ga0157379_10871285 3300014968 Bacteria 853
198 Ga0157376_10086869 3300014969 Bacteria 2697
199 Ga0157376_11735795 3300014969 Bacteria 660
200 Ga0163161_10379575 3300017792 Bacteria 1129
201 Ga0197907_11174359 3300020069 Bacteria 515
202 Ga0206356_10745467 3300020070 Bacteria 686
203 Ga0206356_11239141 3300020070 Bacteria 1002
204 Ga0206354_11350515 3300020081 Bacteria 579
205 Ga0206353_10815935 3300020082 Bacteria 1120
206 Ga0213873_10138043 3300021358 Bacteria 726
207 Ga0213876_10133847 3300021384 Bacteria 1318
208 Ga0213875_10338456 3300021388 Bacteria 714
209 Ga0224712_10600980 3300022467 Bacteria 537
210 Ga0207642_10323145 3300025899 Bacteria 902
211 Ga0207642_10348492 3300025899 Bacteria 873
212 Ga0207710_10495254 3300025900 Bacteria 634
213 Ga0207680_10004937 3300025903 Bacteria 6351
214 Ga0207685_10034081 3300025905 Bacteria 1847
215 Ga0207685_10034466 3300025905 Bacteria 1839
216 Ga0207699_10058901 3300025906 Bacteria 2299
217 Ga0207699_11269050 3300025906 Bacteria 545
218 Ga0207654_10238566 3300025911 Bacteria 1214
219 Ga0207654_11159346 3300025911 Bacteria 563
220 Ga0207693_10008842 3300025915 Bacteria 8227
221 Ga0207693_10158900 3300025915 Bacteria 1778
222 Ga0207693_10266857 3300025915 Bacteria 1341
223 Ga0207693_10357643 3300025915 Bacteria 1142
224 Ga0207660_10930171 3300025917 Bacteria 709
225 Ga0207657_10131428 3300025919 Bacteria 2051
226 Ga0207649_11298425 3300025920 Bacteria 576
227 Ga0207652_10000866 3300025921 Bacteria 28643
228 Ga0207652_10553086 3300025921 Bacteria 1034
229 Ga0207694_10331169 3300025924 Bacteria 1258
230 Ga0207687_10510758 3300025927 Bacteria 1004
231 Ga0207687_10865815 3300025927 Bacteria 772
232 Ga0207687_10988519 3300025927 Bacteria 721
233 Ga0207700_10182565 3300025928 Bacteria 1758
234 Ga0207664_10102438 3300025929 Bacteria 2367
235 Ga0207664_10134819 3300025929 Unclassified 2083
236 Ga0207664_11340404 3300025929 Bacteria 636
237 Ga0207664_11427447 3300025929 Unclassified 613
238 Ga0207644_10144207 3300025931 Bacteria 1837
239 Ga0207644_10383277 3300025931 Bacteria 1147
240 Ga0207690_10596025 3300025932 Bacteria 902
241 Ga0207690_11273278 3300025932 Unclassified 614
242 Ga0207706_10331948 3300025933 Bacteria 1323
243 Ga0207706_10790646 3300025933 Bacteria 806
244 Ga0207686_10172120 3300025934 Bacteria 1528
245 Ga0207686_10585839 3300025934 Bacteria 876
246 Ga0207709_10054219 3300025935 Bacteria 2471
247 Ga0207709_10065528 3300025935 Bacteria 2285
248 Ga0207709_10072431 3300025935 Bacteria 2192
249 Ga0207709_10274557 3300025935 Bacteria 1242
250 Ga0207709_10572078 3300025935 Bacteria 891
251 Ga0207669_10002481 3300025937 Bacteria 7866
252 Ga0207669_10355514 3300025937 Bacteria 1133
253 Ga0207669_10462153 3300025937 Bacteria 1008
254 Ga0207669_11180408 3300025937 Bacteria 648
255 Ga0207704_11069149 3300025938 Unclassified 685
256 Ga0207665_10665294 3300025939 Bacteria 817
257 Ga0207665_10710531 3300025939 Bacteria 790
258 Ga0207665_10747103 3300025939 Bacteria 771
259 Ga0207711_10079640 3300025941 Bacteria 2860
260 Ga0207711_11878101 3300025941 Bacteria 542
261 Ga0207679_10401523 3300025945 Bacteria 1206
262 Ga0207668_10841668 3300025972 Bacteria 814
263 Ga0207668_11028914 3300025972 Bacteria 737
264 Ga0207640_11478518 3300025981 Bacteria 610
265 Ga0207658_10009795 3300025986 Bacteria 6507
266 Ga0207658_10252637 3300025986 Bacteria 1499
267 Ga0207677_10025348 3300026023 Bacteria 3699
268 Ga0207677_10189912 3300026023 Bacteria 1624
269 Ga0207677_10810312 3300026023 Bacteria 839
270 Ga0207703_10188582 3300026035 Bacteria 1824
271 Ga0207678_10003026 3300026067 Bacteria 15207
272 Ga0207678_10098405 3300026067 Bacteria 2499
273 Ga0207708_10339995 3300026075 Bacteria 1229
274 Ga0207702_10012731 3300026078 Bacteria 7000
275 Ga0207702_10060560 3300026078 Bacteria 3227
276 Ga0207702_10784194 3300026078 Bacteria 942
277 Ga0207702_11292178 3300026078 Bacteria 724
278 Ga0207641_10930826 3300026088 Bacteria 864
279 Ga0207648_10123367 3300026089 Bacteria 2278
280 Ga0207648_10476136 3300026089 Bacteria 1140
281 Ga0207648_11447474 3300026089 Bacteria 646
282 Ga0207676_10963910 3300026095 Bacteria 839
283 Ga0207675_100447136 3300026118 Bacteria 1280
284 Ga0207675_100522764 3300026118 Bacteria 1183
285 Ga0207675_102160583 3300026118 Bacteria 572
286 Ga0207683_10002107 3300026121 Bacteria 17501
287 Ga0207698_11054926 3300026142 Bacteria 824
288 Ga0209813_10031659 3300027866 Bacteria 1563
289 Ga0207428_10981604 3300027907 Unclassified 594
290 Ga0268266_10000775 3300028379 Bacteria 42696
291 Ga0268266_10593385 3300028379 Bacteria 1064
292 Ga0268265_10627075 3300028380 Bacteria 1031
293 Ga0268265_11795091 3300028380 Bacteria 620
294 Ga0268264_10035483 3300028381 Bacteria 4106
295 Ga0265334_10130780 3300028573 Bacteria 893
296 Ga0265338_11187061 3300028800 Bacteria 512
297 Ga0307408_100446462 3300031548 Bacteria 1121
298 Ga0307413_10481867 3300031824 Bacteria 992
299 Ga0307406_11516045 3300031901 Bacteria 590
300 Ga0307409_100361637 3300031995 Bacteria 1373
301 Ga0307409_100982783 3300031995 Bacteria 861
302 Ga0307416_100825380 3300032002 Bacteria 1024
303 Ga0307416_102719405 3300032002 Bacteria 591
304 Ga0373926_0411398 3300035083 Bacteria 535
305 Ga0373944_0091876 3300035089 Unclassified 1015
306 Ga0373952_0180330 3300035092 Bacteria 609
307 Ga0373923_0625871 3300035111 Bacteria 531
308 Ga0373939_0440606 3300035114 Bacteria 547
309 Ga0373953_0387445 3300035117 Bacteria 614
310 Ga0373954_0647299 3300035118 Unclassified 524
311 Ga0373956_0383036 3300035119 Bacteria 671
312 Ga0373960_0068950 3300035121 Bacteria 1090
313 Ga0373943_0493588 3300035170 Bacteria 715
314 Ga0373961_0257817 3300035241 Unclassified 633
315 Ga0373961_0326244 3300035241 Bacteria 574
316 Ga0373931_0645228 3300035691 Bacteria 695
317 Ga0373935_0116189 3300035692 Bacteria 1782
318 Ga0373935_0328393 3300035692 Bacteria 1087
319 Ga0373927_0482375 3300035695 Unclassified 819
320 Ga0373933_0033222 3300035724 Bacteria 3000
321 Ga0373947_0373456 3300035725 Bacteria 959
322 Ga0373937_0028286 3300036401 Bacteria 5071
323 Ga0373925_0378536 3300037068 Bacteria 1152
324 Ga0373925_1214529 3300037068 Bacteria 619
325 Ga0373925_1520396 3300037068 Bacteria 548
326 Ga0395899_0389522 3300037312 Unclassified 924
327 Ga0395900_0429449 3300037418 Bacteria 1281
328 Ga0395900_0977891 3300037418 Bacteria 767
329 Ga0395898_0057118 3300037466 Bacteria 3803
330 Ga0395898_0107817 3300037466 Bacteria 2671
331 Ga0395898_0287397 3300037466 Bacteria 1569
332 Ga0395898_0589972 3300037466 Bacteria 1054
333 Ga0395905_0019511 3300037471 Bacteria 6426
334 Ga0395905_1583094 3300037471 Unclassified 560
335 Ga0436364_0518932 3300037853 Bacteria 1436
336 Ga0436364_0628413 3300037853 Unclassified 2898
337 Ga0436364_0971376 3300037853 Bacteria 2410
338 Ga0436364_1132559 3300037853 Bacteria 1484
339 Ga0395901_0026716 3300038443 Bacteria 5927
340 Ga0395901_0062441 3300038443 Bacteria 3877
341 Ga0395901_0088875 3300038443 Bacteria 3232
342 Ga0395901_0291393 3300038443 Bacteria 1694
343 Ga0395901_0379495 3300038443 Bacteria 1455
344 Ga0395901_0449701 3300038443 Bacteria 1318
345 Ga0395901_1128038 3300038443 Unclassified 753
346 Ga0395901_1890213 3300038443 Bacteria 545
347 Ga0436365_0594382 3300039437 Unclassified 671
348 Ga0436365_0711155 3300039437 Bacteria 3963
349 Ga0436362_1250915 3300039453 Bacteria 1428
350 Ga0451789_0713917 3300041443 Bacteria 555
351 Ga0451804_0947887 3300041463 Bacteria 541
352 Ga0451807_2432494 3300041486 Bacteria 1554
353 Ga0451839_1634149 3300041496 Bacteria 584
354 Ga0451851_0272330 3300041507 Bacteria 646
355 Ga0451853_0814883 3300041512 Bacteria 5891
356 Ga0451577_0046892 3300042876 Bacteria 3864
357 Ga0453683_0272124 3300044673 Unclassified 1081
358 Ga0466961_0204364 3300044693 Bacteria 1221
359 Ga0466961_0265557 3300044693 Unclassified 1052
360 Ga0466961_0824584 3300044693 Bacteria 553
361 Ga0466963_0015355 3300044694 Bacteria 4740
362 Ga0466963_0185292 3300044694 Unclassified 1454
363 Ga0466963_0256456 3300044694 Unclassified 1227
364 Ga0466963_0330163 3300044694 Bacteria 1074
365 Ga0466963_0360962 3300044694 Bacteria 1023
366 Ga0466963_0401049 3300044694 Bacteria 967
367 Ga0466963_0437580 3300044694 Bacteria 922
368 Ga0466963_0505582 3300044694 Bacteria 853
369 Ga0466963_0679354 3300044694 Bacteria 727
370 Ga0466963_1128325 3300044694 Bacteria 551
371 Ga0466964_0287152 3300044706 Bacteria 824
372 Ga0466964_0377431 3300044706 Bacteria 735
373 Ga0466964_0505366 3300044706 Bacteria 650
374 Ga0453684_0441844 3300044712 Unclassified 1449
375 Ga0466971_0176365 3300044719 Bacteria 1004
376 Ga0466968_0285935 3300044735 Bacteria 790
377 Ga0466968_0711257 3300044735 Bacteria 513
378 Ga0466970_0209448 3300044765 Unclassified 1086
379 Ga0466957_0037571 3300044842 Bacteria 2916
380 Ga0466957_0090342 3300044842 Unclassified 1918
381 Ga0466960_0000034 3300044901 Bacteria 45522
382 Ga0466960_0276459 3300044901 Bacteria 940
383 Ga0466960_0414930 3300044901 Bacteria 777
384 Ga0466959_0168244 3300045049 Unclassified 1538
385 Ga0451576_0270649 3300045051 Unclassified 1776
386 Ga0466958_0036647 3300045836 Bacteria 2937
387 Ga0466958_0251636 3300045836 Bacteria 1130
388 Ga0466958_0603112 3300045836 Bacteria 714
389 Ga0466958_0627333 3300045836 Bacteria 699
390 Ga0466958_0950113 3300045836 Bacteria 561
391 Ga0466967_0030197 3300045976 Bacteria 4546
392 Ga0466967_0050345 3300045976 Bacteria 3647
393 Ga0466967_0282541 3300045976 Bacteria 1593
394 Ga0466967_0627868 3300045976 Bacteria 1061
395 Ga0466967_0945713 3300045976 Unclassified 857
396 Ga0466967_1140279 3300045976 Bacteria 777
397 Ga0466967_1503804 3300045976 Bacteria 671
398 Ga0466967_1813416 3300045976 Bacteria 607
399 Ga0495627_148095 3300046453 Unclassified 656
400 Ga0495592_0741822 3300046454 Bacteria 588
401 Ga0495603_0023464 3300046455 Unclassified 3732
402 Ga0495603_0108912 3300046455 Bacteria 1617
403 Ga0495629_0257146 3300046459 Bacteria 1201
404 Ga0495629_0322108 3300046459 Bacteria 1057
405 Ga0495641_0002764 3300046461 Bacteria 13593
406 Ga0495641_0043612 3300046461 Bacteria 2074
407 Ga0495641_0044742 3300046461 Bacteria 2041
408 Ga0495641_0073484 3300046461 Bacteria 1534
409 Ga0495651_0003797 3300046462 Bacteria 11554
410 Ga0495651_0678751 3300046462 Bacteria 644
411 Ga0495653_0008194 3300046463 Bacteria 8560
412 Ga0495653_0513845 3300046463 Bacteria 745
413 Ga0495580_0286688 3300046472 Bacteria 1123
414 Ga0495582_0019015 3300046473 Bacteria 3759
415 Ga0495582_0114704 3300046473 Bacteria 1514
416 Ga0495662_0225880 3300046476 Bacteria 923
417 Ga0495584_0136605 3300046491 Bacteria 1245
418 Ga0495584_0157933 3300046491 Bacteria 1152
419 Ga0495596_0047242 3300046500 Bacteria 1689
420 Ga0495596_0324776 3300046500 Bacteria 599
421 Ga0495607_0168500 3300046501 Bacteria 1108
422 Ga0495583_0285195 3300046506 Unclassified 658
423 Ga0495608_0005127 3300046511 Bacteria 9361
424 Ga0495608_0850426 3300046511 Unclassified 536
425 Ga0495616_0239252 3300046513 Bacteria 784
426 Ga0495618_0045429 3300046514 Bacteria 2771
427 Ga0495628_0008385 3300046516 Bacteria 8865
428 Ga0495628_0896515 3300046516 Bacteria 616
429 Ga0495630_1057387 3300046517 Bacteria 616
430 Ga0495631_0512925 3300046518 Unclassified 511
431 Ga0495637_0060884 3300046520 Bacteria 1549
432 Ga0495644_0162243 3300046523 Bacteria 857
433 Ga0495663_0074847 3300046525 Bacteria 1083
434 Ga0495666_0262223 3300046526 Bacteria 786
435 Ga0495642_0097304 3300046528 Bacteria 1250
436 Ga0495652_0013293 3300046529 Bacteria 7408
437 Ga0495665_0045516 3300046531 Bacteria 2331
438 Ga0495640_0787734 3300046533 Bacteria 567
439 Ga0495586_0633040 3300046535 Bacteria 618
440 Ga0495587_0064013 3300046536 Bacteria 2149
441 Ga0495645_0210812 3300046543 Bacteria 1312
442 Ga0495667_0002822 3300046559 Bacteria 11608
443 Ga0495667_0194055 3300046559 Bacteria 1301
444 Ga0495667_0218032 3300046559 Bacteria 1218
445 Ga0495656_0277005 3300046615 Bacteria 854
446 Ga0495656_0330204 3300046615 Bacteria 787
447 Ga0495656_0380938 3300046615 Bacteria 735
448 Ga0495668_0688716 3300046616 Unclassified 565
449 Ga0495634_0034771 3300046642 Bacteria 3456
450 Ga0495634_0227038 3300046642 Bacteria 1150
451 Ga0495635_0009515 3300046663 Bacteria 6793
452 Ga0495635_0060815 3300046663 Bacteria 2595
453 Ga0495659_0073570 3300046664 Bacteria 1285
454 Ga0495588_0433213 3300046674 Bacteria 690
455 Ga0495657_0015852 3300046675 Bacteria 5504
456 Ga0495657_0190079 3300046675 Bacteria 1256
457 Ga0495599_0014431 3300046678 Bacteria 4892
458 Ga0495646_0008419 3300046680 Bacteria 6549
459 Ga0495647_0002631 3300046681 Bacteria 5691
460 Ga0495658_0008300 3300046683 Bacteria 5146
461 Ga0495658_0827338 3300046683 Bacteria 593
462 Ga0495669_0271877 3300046684 Bacteria 815
463 Ga0495669_0528679 3300046684 Unclassified 574
464 Ga0495613_0016167 3300046689 Bacteria 5558
465 Ga0495613_0028316 3300046689 Bacteria 4166
466 Ga0495624_0504267 3300046690 Bacteria 724
467 Ga0495670_0502634 3300046691 Bacteria 658
468 Ga0495671_0083060 3300046692 Bacteria 1570
469 Ga0495589_0230341 3300046794 Bacteria 869
470 Ga0495600_0001744 3300046809 Bacteria 12154
471 Ga0495581_0002802 3300047315 Bacteria 9951
472 Ga0495604_0008035 3300047317 Bacteria 8360
473 Ga0495674_0007929 3300047319 Bacteria 10135
474 Ga0495674_1017815 3300047319 Bacteria 634
475 Ga0495676_0010518 3300047321 Bacteria 8386
476 Ga0495676_0167999 3300047321 Bacteria 1546
477 Ga0495676_0277308 3300047321 Bacteria 1136
478 Ga0495676_0845164 3300047321 Bacteria 588
479 Ga0495680_0005335 3300047322 Bacteria 12127
480 Ga0495680_0092498 3300047322 Bacteria 2265
481 Ga0495675_0063723 3300047444 Bacteria 2332
482 Ga0495677_0098842 3300047445 Bacteria 1104
483 Ga0495684_0003466 3300047471 Bacteria 12342
484 Ga0495684_0407421 3300047471 Bacteria 953
485 Ga0495593_0071190 3300047673 Bacteria 1806
486 Ga0495602_0406797 3300048088 Bacteria 969
487 Ga0495626_0155107 3300048091 Bacteria 963
488 Ga0496100_0000160 3300048903 Bacteria 37151
489 Ga0496100_0019499 3300048903 Bacteria 4048
490 Ga0496100_0178056 3300048903 Bacteria 1536
491 Ga0496101_0012843 3300048904 Bacteria 5601
492 Ga0496101_0020330 3300048904 Bacteria 4542
493 Ga0496101_0067384 3300048904 Bacteria 2614
494 Ga0496101_1442878 3300048904 Bacteria 536
495 Ga0496102_0019630 3300048905 Bacteria 5955
496 Ga0496102_0095627 3300048905 Bacteria 2754
497 Ga0496102_1307632 3300048905 Bacteria 644
498 Ga0496102_1482635 3300048905 Bacteria 597
499 Ga0496103_0010453 3300048906 Bacteria 5494
500 Ga0496103_0021233 3300048906 Bacteria 3906
501 Ga0496103_0039832 3300048906 Bacteria 2888
502 Ga0496103_0469490 3300048906 Bacteria 806
503 Ga0496104_0005625 3300048907 Bacteria 10977
504 Ga0496104_0016547 3300048907 Bacteria 6702
505 Ga0496104_0018971 3300048907 Bacteria 6284
506 Ga0496104_0026628 3300048907 Bacteria 5343
507 Ga0496104_0122627 3300048907 Bacteria 2495
508 Ga0496104_0533662 3300048907 Unclassified 1084
509 Ga0496104_0753417 3300048907 Bacteria 881
510 Ga0496105_0041755 3300048908 Bacteria 3780
511 Ga0496105_0089089 3300048908 Bacteria 2549
512 Ga0496105_0093197 3300048908 Bacteria 2487
513 Ga0496105_0195632 3300048908 Bacteria 1652
514 Ga0496105_0205147 3300048908 Bacteria 1608
515 Ga0496106_0005055 3300048909 Bacteria 9761
516 Ga0496106_0031262 3300048909 Bacteria 3966
517 Ga0496106_0254517 3300048909 Bacteria 1404
518 Ga0496107_0047242 3300048910 Bacteria 3100
519 Ga0496107_0050246 3300048910 Bacteria 3005
520 Ga0496107_0265948 3300048910 Bacteria 1276
521 Ga0496108_0000293 3300048911 Bacteria 43066
522 Ga0496108_0060335 3300048911 Bacteria 3191
523 Ga0496108_0216495 3300048911 Bacteria 1663
524 Ga0496108_0252766 3300048911 Bacteria 1533
525 Ga0496108_0462469 3300048911 Bacteria 1108
526 Ga0496108_0890852 3300048911 Bacteria 764
527 Ga0496109_0003621 3300048912 Bacteria 12918
528 Ga0496109_0206412 3300048912 Bacteria 1847
529 Ga0496109_0398674 3300048912 Bacteria 1300
530 Ga0496109_1527474 3300048912 Bacteria 602
531 Ga0496110_0112521 3300048913 Bacteria 2447
532 Ga0496110_0120489 3300048913 Bacteria 2363
533 Ga0496110_0241358 3300048913 Bacteria 1644
534 Ga0496110_0489118 3300048913 Bacteria 1121
535 Ga0496110_0801299 3300048913 Bacteria 846
536 Ga0496111_0010620 3300048914 Bacteria 6187
537 Ga0496111_0176726 3300048914 Bacteria 1587
538 Ga0496111_0727557 3300048914 Bacteria 721
539 Ga0496111_0898870 3300048914 Bacteria 638
540 Ga0496112_0026671 3300048915 Bacteria 5565
541 Ga0496112_0134669 3300048915 Bacteria 2441
542 Ga0496112_0376926 3300048915 Bacteria 1360
543 Ga0496112_0661276 3300048915 Bacteria 974
544 Ga0496112_1107156 3300048915 Bacteria 710
545 Ga0496112_1551082 3300048915 Bacteria 576
546 Ga0496113_0002572 3300048916 Bacteria 10598
547 Ga0496113_0114004 3300048916 Bacteria 2107
548 Ga0496113_0387660 3300048916 Bacteria 1121
549 Ga0496113_0782377 3300048916 Bacteria 759
550 Ga0496113_0938104 3300048916 Bacteria 683
551 Ga0496114_0004765 3300048917 Bacteria 10559
552 Ga0496114_0067006 3300048917 Bacteria 3011
553 Ga0496114_0140069 3300048917 Bacteria 2094
554 Ga0496114_0562114 3300048917 Bacteria 1007
555 Ga0496115_0143216 3300048918 Bacteria 1972
556 Ga0496115_0281595 3300048918 Bacteria 1365
557 Ga0496119_0004993 3300048922 Bacteria 12953
558 Ga0496124_0026441 3300048927 Bacteria 5232
559 Ga0496125_0059947 3300048928 Bacteria 3063
560 Ga0496126_0007744 3300048929 Bacteria 11710
561 Ga0496126_0104226 3300048929 Bacteria 2478
562 Ga0501032_0108123 3300049569 Bacteria 1841
563 Ga0501033_0015707 3300049570 Bacteria 5741
564 Ga0501034_0115274 3300049571 Bacteria 2675
565 Ga0501036_0019994 3300049572 Bacteria 5621
566 Ga0501037_0039013 3300049573 Bacteria 3497
567 Ga0501038_0084213 3300049574 Bacteria 2675
568 Ga0501039_0206568 3300049575 Bacteria 1544
569 Ga0501042_0040893 3300049578 Bacteria 3295
570 Ga0501043_0062938 3300049579 Bacteria 2913
571 Ga0501046_0006359 3300049580 Bacteria 10475
572 Ga0501047_0008965 3300049581 Bacteria 9444
573 Ga0501047_0134649 3300049581 Bacteria 2351
574 Ga0501047_0336102 3300049581 Bacteria 1348
575 Ga0501047_0421629 3300049581 Bacteria 1166
576 Ga0501048_0059415 3300049582 Bacteria 2709
577 Ga0501067_0377198 3300049583 Bacteria 791
578 Ga0501067_0466756 3300049583 Bacteria 705
579 Ga0501069_0635660 3300049585 Bacteria 642
580 Ga0501070_0030530 3300049586 Bacteria 4516
581 Ga0501071_0187882 3300049587 Bacteria 1549
582 Ga0501072_1204969 3300049588 Bacteria 588
583 Ga0501073_0036488 3300049589 Bacteria 3492
584 Ga0501073_0712201 3300049589 Bacteria 692
585 Ga0501076_0205205 3300049592 Bacteria 1610
586 Ga0501076_0479610 3300049592 Bacteria 1025
587 Ga0501202_230738 3300049652 Bacteria 515
588 Ga0501083_0033679 3300049744 Bacteria 3506
589 Ga0501083_0604889 3300049744 Bacteria 713
590 Ga0501035_0522168 3300049822 Bacteria 975
591 Ga0501044_0386704 3300049823 Bacteria 1313
592 nmdc:mga03683_393832_c1 3300050489 Bacteria 661
593 nmdc:mga03n38_18927_c1 3300050490 Bacteria 2727
594 nmdc:mga00v17_32357_c1 3300050491 Bacteria 2033
595 nmdc:mga00v17_371262_c1 3300050491 Unclassified 930
596 nmdc:mga0yw44_168720_c1 3300050492 Unclassified 1436
597 nmdc:mga0yw44_268201_c1 3300050492 Bacteria 1139
598 nmdc:mga0yw44_48431_c1 3300050492 Bacteria 2563
599 nmdc:mga0yw44_968412_c1 3300050492 Bacteria 576
600 nmdc:mga06z11_31534_c1 3300050494 Bacteria 2577
601 nmdc:mga06z11_985534_c1 3300050494 Bacteria 514
602 nmdc:mga04h51_4557_c1 3300050495 Bacteria 3462
603 nmdc:mga07m45_154106_c1 3300050496 Bacteria 1333
604 nmdc:mga07m45_50068_c1 3300050496 Bacteria 2028
605 nmdc:mga07m45_775310_c1 3300050496 Bacteria 550
606 nmdc:mga05p37_240199_c1 3300050507 Bacteria 2178
607 nmdc:mga08y16_384306_c1 3300050511 Bacteria 1439
608 nmdc:mga0n895_936446_c1 3300050512 Bacteria 850
609 nmdc:mga0a205_200668_c1 3300050515 Bacteria 1885
610 nmdc:mga0a205_31108_c1 3300050515 Bacteria 5111
611 nmdc:mga0a205_498309_c1 3300050515 Bacteria 1075
612 Ga0495601_0129184 3300053077 Bacteria 1645
613 Ga0495595_0008217 3300053084 Bacteria 4284
614 Ga0495619_0034868 3300053085 Bacteria 3272
615 Ga0500616_0340502 3300053153 Bacteria 612
616 Ga0501084_0067383 3300054114 Bacteria 2996
617 Ga0501082_1393082 3300060353 Bacteria 612
618 Ga0466962_0173384 3300061719 Bacteria 1051
619 Ga0466962_0206352 3300061719 Bacteria 961
620 Ga0530510_1016209 3300061734 Bacteria 635
621 Ga0530510_1327490 3300061734 Bacteria 552

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006175 Ga0070712_100107204 Ga0070712_1001072041 95
2 3300005616 Ga0068852_101448465 Ga0068852_1014484652 96
3 3300006871 Ga0075434_102514920 Ga0075434_1025149202 96
4 3300013105 Ga0157369_10407749 Ga0157369_104077493 96
5 3300025919 Ga0207657_10131428 Ga0207657_101314282 96
6 3300025939 Ga0207665_10710531 Ga0207665_107105312 96
7 3300026142 Ga0207698_11054926 Ga0207698_110549262 96
8 3300035089 Ga0373944_0091876 Ga0373944_0091876_684_974 96
9 3300035695 Ga0373927_0482375 Ga0373927_0482375_58_348 96
10 3300042876 Ga0451577_0046892 Ga0451577_0046892_2679_2972 96
11 3300044673 Ga0453683_0272124 Ga0453683_0272124_182_475 96
12 3300044712 Ga0453684_0441844 Ga0453684_0441844_1138_1431 96
13 3300045051 Ga0451576_0270649 Ga0451576_0270649_295_588 96
14 3300045976 Ga0466967_0282541 Ga0466967_0282541_364_654 96
15 3300046455 Ga0495603_0023464 Ga0495603_0023464_3361_3651 96
16 3300046472 Ga0495580_0286688 Ga0495580_0286688_384_674 96
17 3300046473 Ga0495582_0114704 Ga0495582_0114704_259_549 96
18 3300047321 Ga0495676_0167999 Ga0495676_0167999_1068_1358 96
19 3300049569 Ga0501032_0108123 Ga0501032_0108123_783_1073 96
20 3300049570 Ga0501033_0015707 Ga0501033_0015707_1799_2089 96
21 3300049571 Ga0501034_0115274 Ga0501034_0115274_1871_2161 96
22 3300049572 Ga0501036_0019994 Ga0501036_0019994_2614_2904 96
23 3300049573 Ga0501037_0039013 Ga0501037_0039013_3062_3352 96
24 3300049574 Ga0501038_0084213 Ga0501038_0084213_643_933 96
25 3300049575 Ga0501039_0206568 Ga0501039_0206568_139_429 96
26 3300049578 Ga0501042_0040893 Ga0501042_0040893_2335_2625 96
27 3300049579 Ga0501043_0062938 Ga0501043_0062938_301_591 96
28 3300049580 Ga0501046_0006359 Ga0501046_0006359_8742_9032 96
29 3300049581 Ga0501047_0336102 Ga0501047_0336102_725_1015 96
30 3300049582 Ga0501048_0059415 Ga0501048_0059415_187_477 96
31 3300049586 Ga0501070_0030530 Ga0501070_0030530_11_301 96
32 3300049589 Ga0501073_0036488 Ga0501073_0036488_900_1190 96
33 3300049589 Ga0501073_0712201 Ga0501073_0712201_134_424 96
34 3300049744 Ga0501083_0033679 Ga0501083_0033679_1035_1325 96
35 3300049822 Ga0501035_0522168 Ga0501035_0522168_37_327 96
36 3300049823 Ga0501044_0386704 Ga0501044_0386704_254_544 96
37 3300005330 Ga0070690_101006684 Ga0070690_1010066841 97
38 3300005337 Ga0070682_100037846 Ga0070682_1000378463 97
39 3300005343 Ga0070687_101027947 Ga0070687_1010279472 97
40 3300005355 Ga0070671_100662851 Ga0070671_1006628512 97
41 3300005356 Ga0070674_100012545 Ga0070674_1000125453 97
42 3300005366 Ga0070659_101000992 Ga0070659_1010009921 97
43 3300005367 Ga0070667_100073988 Ga0070667_1000739882 97
44 3300005438 Ga0070701_10056278 Ga0070701_100562783 97
45 3300005440 Ga0070705_100197918 Ga0070705_1001979182 97
46 3300005455 Ga0070663_100105229 Ga0070663_1001052292 97
47 3300005456 Ga0070678_100044415 Ga0070678_1000444152 97
48 3300005544 Ga0070686_100038896 Ga0070686_1000388963 97
49 3300005546 Ga0070696_100066090 Ga0070696_1000660902 97
50 3300005547 Ga0070693_100655205 Ga0070693_1006552052 97
51 3300005548 Ga0070665_100622851 Ga0070665_1006228511 97
52 3300005718 Ga0068866_10129586 Ga0068866_101295861 97
53 3300005718 Ga0068866_10211454 Ga0068866_102114542 97
54 3300005840 Ga0068870_10407609 Ga0068870_104076092 97
55 3300005842 Ga0068858_100432342 Ga0068858_1004323422 97
56 3300005843 Ga0068860_100013584 Ga0068860_1000135844 97
57 3300006237 Ga0097621_100081953 Ga0097621_1000819532 97
58 3300006358 Ga0068871_100030122 Ga0068871_1000301224 97
59 3300006881 Ga0068865_101829599 Ga0068865_1018295991 97
60 3300009098 Ga0105245_10134981 Ga0105245_101349812 97
61 3300009101 Ga0105247_10019530 Ga0105247_100195301 97
62 3300009148 Ga0105243_10154554 Ga0105243_101545543 97
63 3300009148 Ga0105243_11963380 Ga0105243_119633802 97
64 3300009174 Ga0105241_10643620 Ga0105241_106436202 97
65 3300009176 Ga0105242_10009004 Ga0105242_100090044 97
66 3300009176 Ga0105242_10654351 Ga0105242_106543511 97
67 3300009177 Ga0105248_10008393 Ga0105248_100083938 97
68 3300011119 Ga0105246_10259350 Ga0105246_102593502 97
69 3300013297 Ga0157378_10008117 Ga0157378_100081175 97
70 3300013308 Ga0157375_11194941 Ga0157375_111949412 97
71 3300014968 Ga0157379_10016605 Ga0157379_100166054 97
72 3300014969 Ga0157376_10086869 Ga0157376_100868694 97
73 3300025899 Ga0207642_10323145 Ga0207642_103231451 97
74 3300025900 Ga0207710_10495254 Ga0207710_104952541 97
75 3300025905 Ga0207685_10034466 Ga0207685_100344662 97
76 3300025927 Ga0207687_10510758 Ga0207687_105107581 97
77 3300025931 Ga0207644_10383277 Ga0207644_103832772 97
78 3300025934 Ga0207686_10172120 Ga0207686_101721202 97
79 3300025935 Ga0207709_10065528 Ga0207709_100655283 97
80 3300025935 Ga0207709_10572078 Ga0207709_105720781 97
81 3300025937 Ga0207669_10355514 Ga0207669_103555142 97
82 3300025941 Ga0207711_10079640 Ga0207711_100796403 97
83 3300025986 Ga0207658_10252637 Ga0207658_102526372 97
84 3300026035 Ga0207703_10188582 Ga0207703_101885822 97
85 3300026121 Ga0207683_10002107 Ga0207683_100021076 97
86 3300028379 Ga0268266_10593385 Ga0268266_105933852 97
87 3300028381 Ga0268264_10035483 Ga0268264_100354834 97
88 3300037853 Ga0436364_0628413 Ga0436364_0628413_319_612 97
89 3300039437 Ga0436365_0594382 Ga0436365_0594382_15_308 97
90 3300044694 Ga0466963_0437580 Ga0466963_0437580_114_470 97
91 3300044735 Ga0466968_0285935 Ga0466968_0285935_230_586 97
92 3300044765 Ga0466970_0209448 Ga0466970_0209448_579_935 97
93 3300044842 Ga0466957_0090342 Ga0466957_0090342_1002_1358 97
94 3300045049 Ga0466959_0168244 Ga0466959_0168244_466_759 97
95 3300048903 Ga0496100_0019499 Ga0496100_0019499_1083_1376 97
96 3300048904 Ga0496101_0012843 Ga0496101_0012843_390_683 97
97 3300048905 Ga0496102_0019630 Ga0496102_0019630_4003_4296 97
98 3300048906 Ga0496103_0010453 Ga0496103_0010453_3884_4177 97
99 3300048907 Ga0496104_0005625 Ga0496104_0005625_5125_5418 97
100 3300048908 Ga0496105_0205147 Ga0496105_0205147_928_1221 97
101 3300048909 Ga0496106_0005055 Ga0496106_0005055_5336_5629 97
102 3300048910 Ga0496107_0050246 Ga0496107_0050246_1650_1943 97
103 3300048911 Ga0496108_0890852 Ga0496108_0890852_18_311 97
104 3300048917 Ga0496114_0004765 Ga0496114_0004765_6220_6513 97
105 3300048918 Ga0496115_0281595 Ga0496115_0281595_409_702 97
106 3300053153 Ga0500616_0340502 Ga0500616_0340502_61_354 97
107 2088090003 LJN_F6ESG4R02JSG9I LJN_03324960 98
108 3300005327 Ga0070658_10896260 Ga0070658_108962601 98
109 3300005329 Ga0070683_100567868 Ga0070683_1005678682 98
110 3300005331 Ga0070670_101901603 Ga0070670_1019016031 98
111 3300005335 Ga0070666_10035692 Ga0070666_100356922 98
112 3300005336 Ga0070680_101226823 Ga0070680_1012268231 98
113 3300005337 Ga0070682_101856062 Ga0070682_1018560621 98
114 3300005338 Ga0068868_100113021 Ga0068868_1001130212 98
115 3300005338 Ga0068868_100483819 Ga0068868_1004838192 98
116 3300005341 Ga0070691_10338715 Ga0070691_103387151 98
117 3300005347 Ga0070668_100617242 Ga0070668_1006172422 98
118 3300005355 Ga0070671_100215902 Ga0070671_1002159022 98
119 3300005355 Ga0070671_100402560 Ga0070671_1004025602 98
120 3300005356 Ga0070674_100007347 Ga0070674_1000073477 98
121 3300005356 Ga0070674_100848830 Ga0070674_1008488301 98
122 3300005356 Ga0070674_101151418 Ga0070674_1011514181 98
123 3300005356 Ga0070674_101497247 Ga0070674_1014972471 98
124 3300005356 Ga0070674_101552457 Ga0070674_1015524571 98
125 3300005365 Ga0070688_101517274 Ga0070688_1015172741 98
126 3300005366 Ga0070659_101483576 Ga0070659_1014835762 98
127 3300005367 Ga0070667_100200590 Ga0070667_1002005902 98
128 3300005434 Ga0070709_10867346 Ga0070709_108673461 98
129 3300005434 Ga0070709_11150924 Ga0070709_111509242 98
130 3300005435 Ga0070714_100028433 Ga0070714_1000284334 98
131 3300005435 Ga0070714_100579240 Ga0070714_1005792402 98
132 3300005435 Ga0070714_100796963 Ga0070714_1007969632 98
133 3300005435 Ga0070714_100812223 Ga0070714_1008122233 98
134 3300005435 Ga0070714_101616987 Ga0070714_1016169871 98
135 3300005435 Ga0070714_101622502 Ga0070714_1016225022 98
136 3300005436 Ga0070713_100042390 Ga0070713_1000423902 98
137 3300005436 Ga0070713_100182480 Ga0070713_1001824803 98
138 3300005437 Ga0070710_10008592 Ga0070710_100085922 98
139 3300005437 Ga0070710_10075568 Ga0070710_100755682 98
140 3300005437 Ga0070710_10543528 Ga0070710_105435282 98
141 3300005439 Ga0070711_100440512 Ga0070711_1004405122 98
142 3300005444 Ga0070694_101859312 Ga0070694_1018593121 98
143 3300005455 Ga0070663_100000561 Ga0070663_1000005617 98
144 3300005455 Ga0070663_100589433 Ga0070663_1005894332 98
145 3300005457 Ga0070662_101022731 Ga0070662_1010227311 98
146 3300005458 Ga0070681_11007264 Ga0070681_110072641 98
147 3300005459 Ga0068867_100139113 Ga0068867_1001391134 98
148 3300005459 Ga0068867_100944010 Ga0068867_1009440101 98
149 3300005459 Ga0068867_101827571 Ga0068867_1018275711 98
150 3300005466 Ga0070685_11237958 Ga0070685_112379581 98
151 3300005530 Ga0070679_100004461 Ga0070679_1000044615 98
152 3300005530 Ga0070679_100862002 Ga0070679_1008620022 98
153 3300005535 Ga0070684_100054948 Ga0070684_1000549482 98
154 3300005535 Ga0070684_100396419 Ga0070684_1003964192 98
155 3300005535 Ga0070684_101069068 Ga0070684_1010690682 98
156 3300005536 Ga0070697_100625363 Ga0070697_1006253632 98
157 3300005545 Ga0070695_101147003 Ga0070695_1011470031 98
158 3300005545 Ga0070695_101490415 Ga0070695_1014904152 98
159 3300005547 Ga0070693_101501770 Ga0070693_1015017701 98
160 3300005548 Ga0070665_100018684 Ga0070665_1000186846 98
161 3300005548 Ga0070665_101697504 Ga0070665_1016975041 98
162 3300005549 Ga0070704_100323439 Ga0070704_1003234392 98
163 3300005549 Ga0070704_100793229 Ga0070704_1007932291 98
164 3300005549 Ga0070704_101818084 Ga0070704_1018180841 98
165 3300005564 Ga0070664_100511837 Ga0070664_1005118371 98
166 3300005614 Ga0068856_100016851 Ga0068856_10001685110 98
167 3300005614 Ga0068856_100080843 Ga0068856_1000808432 98
168 3300005614 Ga0068856_100318175 Ga0068856_1003181752 98
169 3300005614 Ga0068856_102248985 Ga0068856_1022489851 98
170 3300005615 Ga0070702_100243491 Ga0070702_1002434913 98
171 3300005615 Ga0070702_100416322 Ga0070702_1004163222 98
172 3300005618 Ga0068864_101276731 Ga0068864_1012767311 98
173 3300005718 Ga0068866_10432854 Ga0068866_104328542 98
174 3300005719 Ga0068861_100302437 Ga0068861_1003024372 98
175 3300005719 Ga0068861_100561039 Ga0068861_1005610392 98
176 3300005842 Ga0068858_100700079 Ga0068858_1007000793 98
177 3300005844 Ga0068862_100404588 Ga0068862_1004045882 98
178 3300005937 Ga0081455_10016609 Ga0081455_100166094 98
179 3300005937 Ga0081455_10018501 Ga0081455_100185016 98
180 3300005937 Ga0081455_10158928 Ga0081455_101589283 98
181 3300005937 Ga0081455_10266822 Ga0081455_102668222 98
182 3300005937 Ga0081455_10563808 Ga0081455_105638082 98
183 3300005937 Ga0081455_10743111 Ga0081455_107431111 98
184 3300005981 Ga0081538_10172051 Ga0081538_101720512 98
185 3300005983 Ga0081540_1015884 Ga0081540_10158842 98
186 3300006028 Ga0070717_10008889 Ga0070717_100088895 98
187 3300006028 Ga0070717_10022321 Ga0070717_100223214 98
188 3300006028 Ga0070717_10058864 Ga0070717_100588641 98
189 3300006028 Ga0070717_10404454 Ga0070717_104044542 98
190 3300006028 Ga0070717_10917421 Ga0070717_109174211 98
191 3300006038 Ga0075365_10041987 Ga0075365_100419873 98
192 3300006038 Ga0075365_10329318 Ga0075365_103293182 98
193 3300006038 Ga0075365_11040510 Ga0075365_110405102 98
194 3300006038 Ga0075365_11216966 Ga0075365_112169662 98
195 3300006042 Ga0075368_10015109 Ga0075368_100151093 98
196 3300006048 Ga0075363_100054107 Ga0075363_1000541073 98
197 3300006048 Ga0075363_100888179 Ga0075363_1008881792 98
198 3300006051 Ga0075364_10037975 Ga0075364_100379753 98
199 3300006051 Ga0075364_10421481 Ga0075364_104214811 98
200 3300006058 Ga0075432_10159955 Ga0075432_101599552 98
201 3300006058 Ga0075432_10409593 Ga0075432_104095931 98
202 3300006163 Ga0070715_10055136 Ga0070715_100551362 98
203 3300006173 Ga0070716_100358353 Ga0070716_1003583532 98
204 3300006173 Ga0070716_100411904 Ga0070716_1004119042 98
205 3300006175 Ga0070712_100019883 Ga0070712_1000198833 98
206 3300006175 Ga0070712_100053110 Ga0070712_1000531102 98
207 3300006175 Ga0070712_100857199 Ga0070712_1008571992 98
208 3300006177 Ga0075362_10346055 Ga0075362_103460552 98
209 3300006178 Ga0075367_10114010 Ga0075367_101140102 98
210 3300006353 Ga0075370_10006851 Ga0075370_100068513 98
211 3300006353 Ga0075370_10063009 Ga0075370_100630095 98
212 3300006358 Ga0068871_102206893 Ga0068871_1022068931 98
213 3300006844 Ga0075428_100084060 Ga0075428_1000840605 98
214 3300006847 Ga0075431_100124751 Ga0075431_1001247514 98
215 3300006852 Ga0075433_10086386 Ga0075433_100863862 98
216 3300006852 Ga0075433_10428891 Ga0075433_104288912 98
217 3300006852 Ga0075433_11388620 Ga0075433_113886202 98
218 3300006871 Ga0075434_101100645 Ga0075434_1011006452 98
219 3300006871 Ga0075434_102078258 Ga0075434_1020782581 98
220 3300006871 Ga0075434_102431525 Ga0075434_1024315251 98
221 3300006881 Ga0068865_100418590 Ga0068865_1004185902 98
222 3300009093 Ga0105240_11305882 Ga0105240_113058821 98
223 3300009094 Ga0111539_10025165 Ga0111539_100251655 98
224 3300009094 Ga0111539_12973290 Ga0111539_129732902 98
225 3300009094 Ga0111539_13146438 Ga0111539_131464382 98
226 3300009098 Ga0105245_10698838 Ga0105245_106988382 98
227 3300009098 Ga0105245_10972604 Ga0105245_109726042 98
228 3300009098 Ga0105245_11403147 Ga0105245_114031472 98
229 3300009147 Ga0114129_10978759 Ga0114129_109787592 98
230 3300009147 Ga0114129_11062333 Ga0114129_110623332 98
231 3300009148 Ga0105243_10049261 Ga0105243_100492613 98
232 3300009148 Ga0105243_10165959 Ga0105243_101659594 98
233 3300009148 Ga0105243_10181701 Ga0105243_101817012 98
234 3300009148 Ga0105243_10867577 Ga0105243_108675771 98
235 3300009174 Ga0105241_10174144 Ga0105241_101741442 98
236 3300009174 Ga0105241_10933515 Ga0105241_109335151 98
237 3300009174 Ga0105241_11730174 Ga0105241_117301741 98
238 3300009177 Ga0105248_10891150 Ga0105248_108911501 98
239 3300009177 Ga0105248_11605813 Ga0105248_116058132 98
240 3300009545 Ga0105237_10114454 Ga0105237_101144542 98
241 3300009551 Ga0105238_10527352 Ga0105238_105273523 98
242 3300009551 Ga0105238_11504732 Ga0105238_115047322 98
243 3300009551 Ga0105238_12989252 Ga0105238_129892521 98
244 3300009553 Ga0105249_12724817 Ga0105249_127248172 98
245 3300010375 Ga0105239_11350362 Ga0105239_113503622 98
246 3300010375 Ga0105239_12104727 Ga0105239_121047271 98
247 3300011119 Ga0105246_10077154 Ga0105246_100771543 98
248 3300011119 Ga0105246_10662012 Ga0105246_106620122 98
249 3300012502 Ga0157347_1032871 Ga0157347_10328712 98
250 3300012505 Ga0157339_1016172 Ga0157339_10161722 98
251 3300013102 Ga0157371_10602429 Ga0157371_106024292 98
252 3300013105 Ga0157369_10808903 Ga0157369_108089032 98
253 3300013297 Ga0157378_10904787 Ga0157378_109047872 98
254 3300013297 Ga0157378_10945804 Ga0157378_109458042 98
255 3300013306 Ga0163162_10862862 Ga0163162_108628622 98
256 3300013306 Ga0163162_11102478 Ga0163162_111024782 98
257 3300013306 Ga0163162_11984395 Ga0163162_119843951 98
258 3300013307 Ga0157372_10359812 Ga0157372_103598122 98
259 3300013307 Ga0157372_11025778 Ga0157372_110257781 98
260 3300013307 Ga0157372_12041665 Ga0157372_120416652 98
261 3300013307 Ga0157372_12835072 Ga0157372_128350721 98
262 3300014325 Ga0163163_10112580 Ga0163163_101125801 98
263 3300014325 Ga0163163_10121719 Ga0163163_101217193 98
264 3300014968 Ga0157379_10871285 Ga0157379_108712852 98
265 3300014969 Ga0157376_11735795 Ga0157376_117357952 98
266 3300017792 Ga0163161_10379575 Ga0163161_103795752 98
267 3300020069 Ga0197907_11174359 Ga0197907_111743591 98
268 3300020070 Ga0206356_10745467 Ga0206356_107454671 98
269 3300020070 Ga0206356_11239141 Ga0206356_112391412 98
270 3300020081 Ga0206354_11350515 Ga0206354_113505151 98
271 3300020082 Ga0206353_10815935 Ga0206353_108159352 98
272 3300021358 Ga0213873_10138043 Ga0213873_101380432 98
273 3300021384 Ga0213876_10133847 Ga0213876_101338472 98
274 3300021388 Ga0213875_10338456 Ga0213875_103384562 98
275 3300022467 Ga0224712_10600980 Ga0224712_106009802 98
276 3300025899 Ga0207642_10348492 Ga0207642_103484922 98
277 3300025903 Ga0207680_10004937 Ga0207680_100049375 98
278 3300025905 Ga0207685_10034081 Ga0207685_100340812 98
279 3300025906 Ga0207699_10058901 Ga0207699_100589012 98
280 3300025906 Ga0207699_11269050 Ga0207699_112690501 98
281 3300025911 Ga0207654_10238566 Ga0207654_102385661 98
282 3300025911 Ga0207654_11159346 Ga0207654_111593461 98
283 3300025915 Ga0207693_10008842 Ga0207693_100088422 98
284 3300025915 Ga0207693_10158900 Ga0207693_101589002 98
285 3300025915 Ga0207693_10266857 Ga0207693_102668572 98
286 3300025915 Ga0207693_10357643 Ga0207693_103576432 98
287 3300025917 Ga0207660_10930171 Ga0207660_109301712 98
288 3300025920 Ga0207649_11298425 Ga0207649_112984251 98
289 3300025921 Ga0207652_10000866 Ga0207652_100008665 98
290 3300025921 Ga0207652_10553086 Ga0207652_105530862 98
291 3300025924 Ga0207694_10331169 Ga0207694_103311692 98
292 3300025927 Ga0207687_10865815 Ga0207687_108658152 98
293 3300025927 Ga0207687_10988519 Ga0207687_109885192 98
294 3300025928 Ga0207700_10182565 Ga0207700_101825652 98
295 3300025929 Ga0207664_10102438 Ga0207664_101024382 98
296 3300025929 Ga0207664_10134819 Ga0207664_101348193 98
297 3300025929 Ga0207664_11340404 Ga0207664_113404042 98
298 3300025929 Ga0207664_11427447 Ga0207664_114274471 98
299 3300025931 Ga0207644_10144207 Ga0207644_101442072 98
300 3300025932 Ga0207690_10596025 Ga0207690_105960252 98
301 3300025932 Ga0207690_11273278 Ga0207690_112732781 98
302 3300025933 Ga0207706_10331948 Ga0207706_103319482 98
303 3300025933 Ga0207706_10790646 Ga0207706_107906462 98
304 3300025934 Ga0207686_10585839 Ga0207686_105858391 98
305 3300025935 Ga0207709_10054219 Ga0207709_100542192 98
306 3300025935 Ga0207709_10072431 Ga0207709_100724312 98
307 3300025935 Ga0207709_10274557 Ga0207709_102745572 98
308 3300025937 Ga0207669_10002481 Ga0207669_100024819 98
309 3300025937 Ga0207669_10462153 Ga0207669_104621532 98
310 3300025937 Ga0207669_11180408 Ga0207669_111804082 98
311 3300025938 Ga0207704_11069149 Ga0207704_110691492 98
312 3300025939 Ga0207665_10665294 Ga0207665_106652942 98
313 3300025939 Ga0207665_10747103 Ga0207665_107471032 98
314 3300025941 Ga0207711_11878101 Ga0207711_118781012 98
315 3300025945 Ga0207679_10401523 Ga0207679_104015232 98
316 3300025972 Ga0207668_10841668 Ga0207668_108416682 98
317 3300025972 Ga0207668_11028914 Ga0207668_110289142 98
318 3300025981 Ga0207640_11478518 Ga0207640_114785181 98
319 3300025986 Ga0207658_10009795 Ga0207658_100097953 98
320 3300026023 Ga0207677_10025348 Ga0207677_100253482 98
321 3300026023 Ga0207677_10189912 Ga0207677_101899122 98
322 3300026023 Ga0207677_10810312 Ga0207677_108103121 98
323 3300026067 Ga0207678_10003026 Ga0207678_100030267 98
324 3300026067 Ga0207678_10098405 Ga0207678_100984053 98
325 3300026075 Ga0207708_10339995 Ga0207708_103399953 98
326 3300026078 Ga0207702_10012731 Ga0207702_100127312 98
327 3300026078 Ga0207702_10060560 Ga0207702_100605602 98
328 3300026078 Ga0207702_10784194 Ga0207702_107841942 98
329 3300026078 Ga0207702_11292178 Ga0207702_112921782 98
330 3300026088 Ga0207641_10930826 Ga0207641_109308261 98
331 3300026089 Ga0207648_10123367 Ga0207648_101233674 98
332 3300026089 Ga0207648_10476136 Ga0207648_104761362 98
333 3300026089 Ga0207648_11447474 Ga0207648_114474741 98
334 3300026095 Ga0207676_10963910 Ga0207676_109639102 98
335 3300026118 Ga0207675_100447136 Ga0207675_1004471363 98
336 3300026118 Ga0207675_100522764 Ga0207675_1005227642 98
337 3300026118 Ga0207675_102160583 Ga0207675_1021605832 98
338 3300027866 Ga0209813_10031659 Ga0209813_100316592 98
339 3300027907 Ga0207428_10981604 Ga0207428_109816042 98
340 3300028379 Ga0268266_10000775 Ga0268266_1000077531 98
341 3300028380 Ga0268265_10627075 Ga0268265_106270751 98
342 3300028380 Ga0268265_11795091 Ga0268265_117950911 98
343 3300028573 Ga0265334_10130780 Ga0265334_101307802 98
344 3300028800 Ga0265338_11187061 Ga0265338_111870612 98
345 3300031548 Ga0307408_100446462 Ga0307408_1004464622 98
346 3300031824 Ga0307413_10481867 Ga0307413_104818672 98
347 3300031901 Ga0307406_11516045 Ga0307406_115160451 98
348 3300031995 Ga0307409_100361637 Ga0307409_1003616371 98
349 3300031995 Ga0307409_100982783 Ga0307409_1009827831 98
350 3300032002 Ga0307416_100825380 Ga0307416_1008253802 98
351 3300032002 Ga0307416_102719405 Ga0307416_1027194051 98
352 3300035083 Ga0373926_0411398 Ga0373926_0411398_10_306 98
353 3300035092 Ga0373952_0180330 Ga0373952_0180330_18_314 98
354 3300035111 Ga0373923_0625871 Ga0373923_0625871_202_498 98
355 3300035114 Ga0373939_0440606 Ga0373939_0440606_95_391 98
356 3300035117 Ga0373953_0387445 Ga0373953_0387445_220_516 98
357 3300035118 Ga0373954_0647299 Ga0373954_0647299_34_330 98
358 3300035119 Ga0373956_0383036 Ga0373956_0383036_126_422 98
359 3300035121 Ga0373960_0068950 Ga0373960_0068950_544_840 98
360 3300035170 Ga0373943_0493588 Ga0373943_0493588_237_533 98
361 3300035241 Ga0373961_0257817 Ga0373961_0257817_143_439 98
362 3300035241 Ga0373961_0326244 Ga0373961_0326244_170_466 98
363 3300035691 Ga0373931_0645228 Ga0373931_0645228_291_587 98
364 3300035692 Ga0373935_0116189 Ga0373935_0116189_70_366 98
365 3300035692 Ga0373935_0328393 Ga0373935_0328393_709_1005 98
366 3300035724 Ga0373933_0033222 Ga0373933_0033222_628_924 98
367 3300035725 Ga0373947_0373456 Ga0373947_0373456_212_508 98
368 3300036401 Ga0373937_0028286 Ga0373937_0028286_4667_4963 98
369 3300037068 Ga0373925_0378536 Ga0373925_0378536_729_1025 98
370 3300037068 Ga0373925_1214529 Ga0373925_1214529_21_317 98
371 3300037068 Ga0373925_1520396 Ga0373925_1520396_151_447 98
372 3300037312 Ga0395899_0389522 Ga0395899_0389522_446_742 98
373 3300037418 Ga0395900_0429449 Ga0395900_0429449_342_641 98
374 3300037418 Ga0395900_0977891 Ga0395900_0977891_426_722 98
375 3300037466 Ga0395898_0057118 Ga0395898_0057118_175_471 98
376 3300037466 Ga0395898_0107817 Ga0395898_0107817_1450_1788 98
377 3300037466 Ga0395898_0287397 Ga0395898_0287397_283_579 98
378 3300037466 Ga0395898_0589972 Ga0395898_0589972_418_714 98
379 3300037471 Ga0395905_0019511 Ga0395905_0019511_455_751 98
380 3300037471 Ga0395905_1583094 Ga0395905_1583094_195_491 98
381 3300037853 Ga0436364_0518932 Ga0436364_0518932_1024_1320 98
382 3300037853 Ga0436364_0971376 Ga0436364_0971376_1846_2142 98
383 3300037853 Ga0436364_1132559 Ga0436364_1132559_355_651 98
384 3300038443 Ga0395901_0026716 Ga0395901_0026716_2143_2481 98
385 3300038443 Ga0395901_0062441 Ga0395901_0062441_2614_2910 98
386 3300038443 Ga0395901_0088875 Ga0395901_0088875_228_524 98
387 3300038443 Ga0395901_0291393 Ga0395901_0291393_1254_1550 98
388 3300038443 Ga0395901_0379495 Ga0395901_0379495_53_352 98
389 3300038443 Ga0395901_0449701 Ga0395901_0449701_720_1016 98
390 3300038443 Ga0395901_1128038 Ga0395901_1128038_288_584 98
391 3300038443 Ga0395901_1890213 Ga0395901_1890213_186_482 98
392 3300039437 Ga0436365_0711155 Ga0436365_0711155_1241_1537 98
393 3300039453 Ga0436362_1250915 Ga0436362_1250915_897_1193 98
394 3300041443 Ga0451789_0713917 Ga0451789_0713917_214_510 98
395 3300041463 Ga0451804_0947887 Ga0451804_0947887_156_461 98
396 3300041486 Ga0451807_2432494 Ga0451807_2432494_843_1139 98
397 3300041496 Ga0451839_1634149 Ga0451839_1634149_187_492 98
398 3300041507 Ga0451851_0272330 Ga0451851_0272330_118_441 98
399 3300041512 Ga0451853_0814883 Ga0451853_0814883_3041_3346 98
400 3300044693 Ga0466961_0204364 Ga0466961_0204364_605_901 98
401 3300044693 Ga0466961_0265557 Ga0466961_0265557_176_472 98
402 3300044693 Ga0466961_0824584 Ga0466961_0824584_95_391 98
403 3300044694 Ga0466963_0015355 Ga0466963_0015355_2248_2547 98
404 3300044694 Ga0466963_0185292 Ga0466963_0185292_897_1193 98
405 3300044694 Ga0466963_0256456 Ga0466963_0256456_869_1165 98
406 3300044694 Ga0466963_0330163 Ga0466963_0330163_296_592 98
407 3300044694 Ga0466963_0360962 Ga0466963_0360962_555_851 98
408 3300044694 Ga0466963_0401049 Ga0466963_0401049_624_920 98
409 3300044694 Ga0466963_0505582 Ga0466963_0505582_500_808 98
410 3300044694 Ga0466963_0679354 Ga0466963_0679354_25_321 98
411 3300044694 Ga0466963_1128325 Ga0466963_1128325_39_389 98
412 3300044706 Ga0466964_0287152 Ga0466964_0287152_222_518 98
413 3300044706 Ga0466964_0377431 Ga0466964_0377431_34_330 98
414 3300044706 Ga0466964_0505366 Ga0466964_0505366_21_344 98
415 3300044719 Ga0466971_0176365 Ga0466971_0176365_16_312 98
416 3300044735 Ga0466968_0711257 Ga0466968_0711257_88_384 98
417 3300044842 Ga0466957_0037571 Ga0466957_0037571_2234_2533 98
418 3300044901 Ga0466960_0000034 Ga0466960_0000034_25653_25955 98
419 3300044901 Ga0466960_0276459 Ga0466960_0276459_512_808 98
420 3300044901 Ga0466960_0414930 Ga0466960_0414930_376_678 98
421 3300045836 Ga0466958_0036647 Ga0466958_0036647_661_957 98
422 3300045836 Ga0466958_0251636 Ga0466958_0251636_260_559 98
423 3300045836 Ga0466958_0603112 Ga0466958_0603112_300_596 98
424 3300045836 Ga0466958_0627333 Ga0466958_0627333_373_669 98
425 3300045836 Ga0466958_0950113 Ga0466958_0950113_226_522 98
426 3300045976 Ga0466967_0030197 Ga0466967_0030197_1483_1806 98
427 3300045976 Ga0466967_0050345 Ga0466967_0050345_1595_1894 98
428 3300045976 Ga0466967_0627868 Ga0466967_0627868_310_606 98
429 3300045976 Ga0466967_0945713 Ga0466967_0945713_479_775 98
430 3300045976 Ga0466967_1140279 Ga0466967_1140279_206_502 98
431 3300045976 Ga0466967_1503804 Ga0466967_1503804_280_576 98
432 3300045976 Ga0466967_1813416 Ga0466967_1813416_201_497 98
433 3300046453 Ga0495627_148095 Ga0495627_148095_330_635 98
434 3300046454 Ga0495592_0741822 Ga0495592_0741822_258_554 98
435 3300046455 Ga0495603_0108912 Ga0495603_0108912_434_730 98
436 3300046459 Ga0495629_0257146 Ga0495629_0257146_562_858 98
437 3300046459 Ga0495629_0322108 Ga0495629_0322108_228_524 98
438 3300046461 Ga0495641_0002764 Ga0495641_0002764_6059_6355 98
439 3300046461 Ga0495641_0043612 Ga0495641_0043612_539_835 98
440 3300046461 Ga0495641_0044742 Ga0495641_0044742_1114_1410 98
441 3300046461 Ga0495641_0073484 Ga0495641_0073484_746_1042 98
442 3300046462 Ga0495651_0003797 Ga0495651_0003797_4681_4977 98
443 3300046462 Ga0495651_0678751 Ga0495651_0678751_164_460 98
444 3300046463 Ga0495653_0008194 Ga0495653_0008194_2006_2302 98
445 3300046463 Ga0495653_0513845 Ga0495653_0513845_207_503 98
446 3300046473 Ga0495582_0019015 Ga0495582_0019015_642_938 98
447 3300046476 Ga0495662_0225880 Ga0495662_0225880_17_313 98
448 3300046491 Ga0495584_0136605 Ga0495584_0136605_843_1139 98
449 3300046491 Ga0495584_0157933 Ga0495584_0157933_592_888 98
450 3300046500 Ga0495596_0047242 Ga0495596_0047242_17_313 98
451 3300046500 Ga0495596_0324776 Ga0495596_0324776_47_343 98
452 3300046501 Ga0495607_0168500 Ga0495607_0168500_193_489 98
453 3300046506 Ga0495583_0285195 Ga0495583_0285195_340_636 98
454 3300046511 Ga0495608_0005127 Ga0495608_0005127_1957_2253 98
455 3300046511 Ga0495608_0850426 Ga0495608_0850426_81_377 98
456 3300046513 Ga0495616_0239252 Ga0495616_0239252_472_768 98
457 3300046514 Ga0495618_0045429 Ga0495618_0045429_485_781 98
458 3300046516 Ga0495628_0008385 Ga0495628_0008385_3579_3875 98
459 3300046516 Ga0495628_0896515 Ga0495628_0896515_77_373 98
460 3300046517 Ga0495630_1057387 Ga0495630_1057387_305_601 98
461 3300046518 Ga0495631_0512925 Ga0495631_0512925_163_459 98
462 3300046520 Ga0495637_0060884 Ga0495637_0060884_653_949 98
463 3300046523 Ga0495644_0162243 Ga0495644_0162243_144_440 98
464 3300046525 Ga0495663_0074847 Ga0495663_0074847_464_760 98
465 3300046526 Ga0495666_0262223 Ga0495666_0262223_44_340 98
466 3300046528 Ga0495642_0097304 Ga0495642_0097304_529_825 98
467 3300046529 Ga0495652_0013293 Ga0495652_0013293_1274_1570 98
468 3300046531 Ga0495665_0045516 Ga0495665_0045516_1706_2002 98
469 3300046533 Ga0495640_0787734 Ga0495640_0787734_185_481 98
470 3300046535 Ga0495586_0633040 Ga0495586_0633040_35_331 98
471 3300046536 Ga0495587_0064013 Ga0495587_0064013_543_839 98
472 3300046543 Ga0495645_0210812 Ga0495645_0210812_247_543 98
473 3300046559 Ga0495667_0002822 Ga0495667_0002822_4422_4718 98
474 3300046559 Ga0495667_0194055 Ga0495667_0194055_442_738 98
475 3300046559 Ga0495667_0218032 Ga0495667_0218032_732_1028 98
476 3300046615 Ga0495656_0277005 Ga0495656_0277005_118_414 98
477 3300046615 Ga0495656_0330204 Ga0495656_0330204_271_576 98
478 3300046615 Ga0495656_0380938 Ga0495656_0380938_93_389 98
479 3300046616 Ga0495668_0688716 Ga0495668_0688716_234_530 98
480 3300046642 Ga0495634_0034771 Ga0495634_0034771_2197_2493 98
481 3300046642 Ga0495634_0227038 Ga0495634_0227038_619_915 98
482 3300046663 Ga0495635_0009515 Ga0495635_0009515_228_524 98
483 3300046663 Ga0495635_0060815 Ga0495635_0060815_2119_2415 98
484 3300046664 Ga0495659_0073570 Ga0495659_0073570_433_729 98
485 3300046674 Ga0495588_0433213 Ga0495588_0433213_49_345 98
486 3300046675 Ga0495657_0015852 Ga0495657_0015852_972_1268 98
487 3300046675 Ga0495657_0190079 Ga0495657_0190079_55_351 98
488 3300046678 Ga0495599_0014431 Ga0495599_0014431_4574_4870 98
489 3300046680 Ga0495646_0008419 Ga0495646_0008419_81_377 98
490 3300046681 Ga0495647_0002631 Ga0495647_0002631_3673_3969 98
491 3300046683 Ga0495658_0008300 Ga0495658_0008300_3324_3620 98
492 3300046683 Ga0495658_0827338 Ga0495658_0827338_209_505 98
493 3300046684 Ga0495669_0271877 Ga0495669_0271877_22_318 98
494 3300046684 Ga0495669_0528679 Ga0495669_0528679_109_405 98
495 3300046689 Ga0495613_0016167 Ga0495613_0016167_2346_2642 98
496 3300046689 Ga0495613_0028316 Ga0495613_0028316_229_525 98
497 3300046690 Ga0495624_0504267 Ga0495624_0504267_408_704 98
498 3300046691 Ga0495670_0502634 Ga0495670_0502634_16_312 98
499 3300046692 Ga0495671_0083060 Ga0495671_0083060_1172_1468 98
500 3300046794 Ga0495589_0230341 Ga0495589_0230341_62_358 98
501 3300046809 Ga0495600_0001744 Ga0495600_0001744_7520_7816 98
502 3300047315 Ga0495581_0002802 Ga0495581_0002802_3410_3706 98
503 3300047317 Ga0495604_0008035 Ga0495604_0008035_6253_6549 98
504 3300047319 Ga0495674_0007929 Ga0495674_0007929_4896_5192 98
505 3300047319 Ga0495674_1017815 Ga0495674_1017815_313_609 98
506 3300047321 Ga0495676_0010518 Ga0495676_0010518_4618_4914 98
507 3300047321 Ga0495676_0277308 Ga0495676_0277308_39_335 98
508 3300047321 Ga0495676_0845164 Ga0495676_0845164_180_476 98
509 3300047322 Ga0495680_0005335 Ga0495680_0005335_5440_5736 98
510 3300047322 Ga0495680_0092498 Ga0495680_0092498_1902_2198 98
511 3300047444 Ga0495675_0063723 Ga0495675_0063723_538_834 98
512 3300047445 Ga0495677_0098842 Ga0495677_0098842_485_781 98
513 3300047471 Ga0495684_0003466 Ga0495684_0003466_1653_1949 98
514 3300047471 Ga0495684_0407421 Ga0495684_0407421_45_341 98
515 3300047673 Ga0495593_0071190 Ga0495593_0071190_271_567 98
516 3300048088 Ga0495602_0406797 Ga0495602_0406797_219_515 98
517 3300048091 Ga0495626_0155107 Ga0495626_0155107_524_820 98
518 3300048903 Ga0496100_0000160 Ga0496100_0000160_25630_25926 98
519 3300048903 Ga0496100_0178056 Ga0496100_0178056_1115_1411 98
520 3300048904 Ga0496101_0020330 Ga0496101_0020330_1087_1383 98
521 3300048904 Ga0496101_0067384 Ga0496101_0067384_426_722 98
522 3300048904 Ga0496101_1442878 Ga0496101_1442878_163_459 98
523 3300048905 Ga0496102_0095627 Ga0496102_0095627_2033_2329 98
524 3300048905 Ga0496102_1307632 Ga0496102_1307632_133_429 98
525 3300048905 Ga0496102_1482635 Ga0496102_1482635_265_582 98
526 3300048906 Ga0496103_0021233 Ga0496103_0021233_2585_2902 98
527 3300048906 Ga0496103_0039832 Ga0496103_0039832_2095_2391 98
528 3300048906 Ga0496103_0469490 Ga0496103_0469490_258_554 98
529 3300048907 Ga0496104_0016547 Ga0496104_0016547_4923_5219 98
530 3300048907 Ga0496104_0018971 Ga0496104_0018971_4691_4987 98
531 3300048907 Ga0496104_0026628 Ga0496104_0026628_933_1229 98
532 3300048907 Ga0496104_0122627 Ga0496104_0122627_550_846 98
533 3300048907 Ga0496104_0533662 Ga0496104_0533662_473_769 98
534 3300048907 Ga0496104_0753417 Ga0496104_0753417_10_306 98
535 3300048908 Ga0496105_0041755 Ga0496105_0041755_3077_3373 98
536 3300048908 Ga0496105_0089089 Ga0496105_0089089_1407_1703 98
537 3300048908 Ga0496105_0093197 Ga0496105_0093197_1255_1551 98
538 3300048908 Ga0496105_0195632 Ga0496105_0195632_1290_1586 98
539 3300048909 Ga0496106_0031262 Ga0496106_0031262_136_432 98
540 3300048909 Ga0496106_0254517 Ga0496106_0254517_985_1281 98
541 3300048910 Ga0496107_0047242 Ga0496107_0047242_2102_2398 98
542 3300048910 Ga0496107_0265948 Ga0496107_0265948_115_411 98
543 3300048911 Ga0496108_0000293 Ga0496108_0000293_11308_11604 98
544 3300048911 Ga0496108_0060335 Ga0496108_0060335_1368_1664 98
545 3300048911 Ga0496108_0216495 Ga0496108_0216495_890_1186 98
546 3300048911 Ga0496108_0252766 Ga0496108_0252766_1217_1513 98
547 3300048911 Ga0496108_0462469 Ga0496108_0462469_678_974 98
548 3300048912 Ga0496109_0003621 Ga0496109_0003621_11188_11484 98
549 3300048912 Ga0496109_0206412 Ga0496109_0206412_597_893 98
550 3300048912 Ga0496109_0398674 Ga0496109_0398674_32_328 98
551 3300048912 Ga0496109_1527474 Ga0496109_1527474_50_346 98
552 3300048913 Ga0496110_0112521 Ga0496110_0112521_1758_2054 98
553 3300048913 Ga0496110_0120489 Ga0496110_0120489_135_431 98
554 3300048913 Ga0496110_0241358 Ga0496110_0241358_339_635 98
555 3300048913 Ga0496110_0489118 Ga0496110_0489118_246_542 98
556 3300048913 Ga0496110_0801299 Ga0496110_0801299_214_510 98
557 3300048914 Ga0496111_0010620 Ga0496111_0010620_616_912 98
558 3300048914 Ga0496111_0176726 Ga0496111_0176726_920_1216 98
559 3300048914 Ga0496111_0727557 Ga0496111_0727557_61_357 98
560 3300048914 Ga0496111_0898870 Ga0496111_0898870_159_455 98
561 3300048915 Ga0496112_0026671 Ga0496112_0026671_4475_4771 98
562 3300048915 Ga0496112_0134669 Ga0496112_0134669_1835_2131 98
563 3300048915 Ga0496112_0376926 Ga0496112_0376926_689_988 98
564 3300048915 Ga0496112_0661276 Ga0496112_0661276_289_615 98
565 3300048915 Ga0496112_1107156 Ga0496112_1107156_182_478 98
566 3300048915 Ga0496112_1551082 Ga0496112_1551082_117_413 98
567 3300048916 Ga0496113_0002572 Ga0496113_0002572_5744_6040 98
568 3300048916 Ga0496113_0114004 Ga0496113_0114004_942_1238 98
569 3300048916 Ga0496113_0387660 Ga0496113_0387660_697_993 98
570 3300048916 Ga0496113_0782377 Ga0496113_0782377_196_492 98
571 3300048916 Ga0496113_0938104 Ga0496113_0938104_94_390 98
572 3300048917 Ga0496114_0067006 Ga0496114_0067006_2429_2725 98
573 3300048917 Ga0496114_0140069 Ga0496114_0140069_1750_2046 98
574 3300048917 Ga0496114_0562114 Ga0496114_0562114_680_976 98
575 3300048918 Ga0496115_0143216 Ga0496115_0143216_1056_1352 98
576 3300048922 Ga0496119_0004993 Ga0496119_0004993_3034_3330 98
577 3300048927 Ga0496124_0026441 Ga0496124_0026441_295_591 98
578 3300048928 Ga0496125_0059947 Ga0496125_0059947_1091_1387 98
579 3300048929 Ga0496126_0007744 Ga0496126_0007744_1442_1738 98
580 3300048929 Ga0496126_0104226 Ga0496126_0104226_1673_1969 98
581 3300049581 Ga0501047_0008965 Ga0501047_0008965_3641_3937 98
582 3300049581 Ga0501047_0134649 Ga0501047_0134649_1909_2205 98
583 3300049581 Ga0501047_0421629 Ga0501047_0421629_52_348 98
584 3300049583 Ga0501067_0377198 Ga0501067_0377198_244_543 98
585 3300049583 Ga0501067_0466756 Ga0501067_0466756_86_382 98
586 3300049585 Ga0501069_0635660 Ga0501069_0635660_152_451 98
587 3300049587 Ga0501071_0187882 Ga0501071_0187882_928_1224 98
588 3300049588 Ga0501072_1204969 Ga0501072_1204969_51_347 98
589 3300049592 Ga0501076_0205205 Ga0501076_0205205_1016_1312 98
590 3300049592 Ga0501076_0479610 Ga0501076_0479610_398_700 98
591 3300049652 Ga0501202_230738 Ga0501202_230738_44_340 98
592 3300049744 Ga0501083_0604889 Ga0501083_0604889_290_589 98
593 3300050489 nmdc:mga03683_393832_c1 nmdc:mga03683_393832_c1_355_651 98
594 3300050490 nmdc:mga03n38_18927_c1 nmdc:mga03n38_18927_c1_1880_2176 98
595 3300050491 nmdc:mga00v17_32357_c1 nmdc:mga00v17_32357_c1_505_801 98
596 3300050491 nmdc:mga00v17_371262_c1 nmdc:mga00v17_371262_c1_582_878 98
597 3300050492 nmdc:mga0yw44_168720_c1 nmdc:mga0yw44_168720_c1_147_443 98
598 3300050492 nmdc:mga0yw44_268201_c1 nmdc:mga0yw44_268201_c1_232_528 98
599 3300050492 nmdc:mga0yw44_48431_c1 nmdc:mga0yw44_48431_c1_1766_2062 98
600 3300050492 nmdc:mga0yw44_968412_c1 nmdc:mga0yw44_968412_c1_193_495 98
601 3300050494 nmdc:mga06z11_31534_c1 nmdc:mga06z11_31534_c1_1354_1650 98
602 3300050494 nmdc:mga06z11_985534_c1 nmdc:mga06z11_985534_c1_14_310 98
603 3300050495 nmdc:mga04h51_4557_c1 nmdc:mga04h51_4557_c1_2208_2504 98
604 3300050496 nmdc:mga07m45_154106_c1 nmdc:mga07m45_154106_c1_203_499 98
605 3300050496 nmdc:mga07m45_50068_c1 nmdc:mga07m45_50068_c1_143_439 98
606 3300050496 nmdc:mga07m45_775310_c1 nmdc:mga07m45_775310_c1_237_533 98
607 3300050507 nmdc:mga05p37_240199_c1 nmdc:mga05p37_240199_c1_1841_2137 98
608 3300050511 nmdc:mga08y16_384306_c1 nmdc:mga08y16_384306_c1_1062_1358 98
609 3300050512 nmdc:mga0n895_936446_c1 nmdc:mga0n895_936446_c1_119_424 98
610 3300050515 nmdc:mga0a205_200668_c1 nmdc:mga0a205_200668_c1_1162_1458 98
611 3300050515 nmdc:mga0a205_31108_c1 nmdc:mga0a205_31108_c1_1179_1484 98
612 3300050515 nmdc:mga0a205_498309_c1 nmdc:mga0a205_498309_c1_301_597 98
613 3300053077 Ga0495601_0129184 Ga0495601_0129184_340_636 98
614 3300053084 Ga0495595_0008217 Ga0495595_0008217_3930_4226 98
615 3300053085 Ga0495619_0034868 Ga0495619_0034868_2778_3074 98
616 3300054114 Ga0501084_0067383 Ga0501084_0067383_205_501 98
617 3300060353 Ga0501082_1393082 Ga0501082_1393082_199_495 98
618 3300061719 Ga0466962_0173384 Ga0466962_0173384_397_747 98
619 3300061719 Ga0466962_0206352 Ga0466962_0206352_469_765 98
620 3300061734 Ga0530510_1016209 Ga0530510_1016209_246_542 98
621 3300061734 Ga0530510_1327490 Ga0530510_1327490_133_429 98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

17

95

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.855 3 87
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.8362 3 87
7qa5-assembly1.cif.gz_A solution structure of the c terminal domain of mgtc (pa4635) from pseudomonas aeruginosa 0.7009 2 86
7csl-assembly2.cif.gz_D crystal structure of the archaeal ef1a-ef1b complex 0.6928 1 83
3ab4-assembly1.cif.gz_A crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine 0.6791 2 74
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8462 4 87 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.8273 4 87 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7794 1 83 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7381 1 83 3.30.70.3090
4moaA03 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Pesticidal crystal protein, central domain 0.6895 36 62 2.100.10.10
ID Description Score Start End GO Terms
AF-B1ZTA8-F1-model_v4 DUF4242 domain-containing protein 0.9576 1 96
AF-A0A7Y2XFY1-F1-model_v4 DUF4242 domain-containing protein 0.9575 1 93
AF-A0A1G7HQU9-F1-model_v4 DUF4242 domain-containing protein 0.956 1 94
AF-A0A369TIF7-F1-model_v4 DUF4242 domain-containing protein 0.9537 1 94
AF-A0A7Y2XFY1-F1-model_v4 DUF4242 domain-containing protein 0.9476 1 93

Feature Viewer

pLDDT pTM Quality
93.05 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map