F470025
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 621 | 328 | 621 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0437580|Ga0466963_0437580_114_470 |
| Length | 118 |
| Sequence | MDQITNSHHEGIQMELYAIVRRGGWQTAAELEAAAARSTTTGGEMADEIRWIRSYVLDEGGGALGTVCIYEATSPEAIRNHAARADLRVDEVVPIVDTVVVRPDPIPSAGKASGMNDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 89 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 162 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 164 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 173 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 185 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 189 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 198 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 199 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 307 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 328 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.03 |
| Metatranscriptomes | 0.97 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.67 |
| Nodule | 0 |
| Rhizoplane | 11.59 |
| Rhizosphere | 81.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJN_F6ESG4R02JSG9I | 2088090003 | Bacteria | 514 |
| 2 | Ga0070658_10896260 | 3300005327 | Bacteria | 771 |
| 3 | Ga0070683_100567868 | 3300005329 | Bacteria | 1085 |
| 4 | Ga0070690_101006684 | 3300005330 | Bacteria | 657 |
| 5 | Ga0070670_101901603 | 3300005331 | Unclassified | 548 |
| 6 | Ga0070666_10035692 | 3300005335 | Bacteria | 3298 |
| 7 | Ga0070680_101226823 | 3300005336 | Bacteria | 649 |
| 8 | Ga0070682_100037846 | 3300005337 | Bacteria | 2956 |
| 9 | Ga0070682_101856062 | 3300005337 | Bacteria | 527 |
| 10 | Ga0068868_100113021 | 3300005338 | Bacteria | 2208 |
| 11 | Ga0068868_100483819 | 3300005338 | Bacteria | 1082 |
| 12 | Ga0070691_10338715 | 3300005341 | Bacteria | 832 |
| 13 | Ga0070687_101027947 | 3300005343 | Bacteria | 599 |
| 14 | Ga0070668_100617242 | 3300005347 | Bacteria | 950 |
| 15 | Ga0070671_100215902 | 3300005355 | Bacteria | 1627 |
| 16 | Ga0070671_100402560 | 3300005355 | Bacteria | 1171 |
| 17 | Ga0070671_100662851 | 3300005355 | Bacteria | 904 |
| 18 | Ga0070674_100007347 | 3300005356 | Bacteria | 6497 |
| 19 | Ga0070674_100012545 | 3300005356 | Bacteria | 5206 |
| 20 | Ga0070674_100848830 | 3300005356 | Bacteria | 792 |
| 21 | Ga0070674_101151418 | 3300005356 | Bacteria | 687 |
| 22 | Ga0070674_101497247 | 3300005356 | Bacteria | 606 |
| 23 | Ga0070674_101552457 | 3300005356 | Bacteria | 596 |
| 24 | Ga0070688_101517274 | 3300005365 | Bacteria | 545 |
| 25 | Ga0070659_101000992 | 3300005366 | Bacteria | 734 |
| 26 | Ga0070659_101483576 | 3300005366 | Unclassified | 604 |
| 27 | Ga0070667_100073988 | 3300005367 | Bacteria | 2906 |
| 28 | Ga0070667_100200590 | 3300005367 | Bacteria | 1770 |
| 29 | Ga0070709_10867346 | 3300005434 | Bacteria | 712 |
| 30 | Ga0070709_11150924 | 3300005434 | Unclassified | 622 |
| 31 | Ga0070714_100028433 | 3300005435 | Unclassified | 4638 |
| 32 | Ga0070714_100579240 | 3300005435 | Bacteria | 1076 |
| 33 | Ga0070714_100796963 | 3300005435 | Bacteria | 915 |
| 34 | Ga0070714_100812223 | 3300005435 | Bacteria | 906 |
| 35 | Ga0070714_101616987 | 3300005435 | Bacteria | 633 |
| 36 | Ga0070714_101622502 | 3300005435 | Bacteria | 632 |
| 37 | Ga0070713_100042390 | 3300005436 | Bacteria | 3714 |
| 38 | Ga0070713_100182480 | 3300005436 | Bacteria | 1886 |
| 39 | Ga0070710_10008592 | 3300005437 | Bacteria | 4973 |
| 40 | Ga0070710_10075568 | 3300005437 | Bacteria | 1953 |
| 41 | Ga0070710_10543528 | 3300005437 | Bacteria | 801 |
| 42 | Ga0070701_10056278 | 3300005438 | Bacteria | 2057 |
| 43 | Ga0070711_100440512 | 3300005439 | Bacteria | 1065 |
| 44 | Ga0070705_100197918 | 3300005440 | Bacteria | 1375 |
| 45 | Ga0070694_101859312 | 3300005444 | Bacteria | 514 |
| 46 | Ga0070663_100000561 | 3300005455 | Bacteria | 19777 |
| 47 | Ga0070663_100105229 | 3300005455 | Bacteria | 2112 |
| 48 | Ga0070663_100589433 | 3300005455 | Bacteria | 934 |
| 49 | Ga0070678_100044415 | 3300005456 | Bacteria | 3173 |
| 50 | Ga0070662_101022731 | 3300005457 | Bacteria | 708 |
| 51 | Ga0070681_11007264 | 3300005458 | Bacteria | 753 |
| 52 | Ga0068867_100139113 | 3300005459 | Bacteria | 1896 |
| 53 | Ga0068867_100944010 | 3300005459 | Bacteria | 779 |
| 54 | Ga0068867_101827571 | 3300005459 | Bacteria | 572 |
| 55 | Ga0070685_11237958 | 3300005466 | Bacteria | 568 |
| 56 | Ga0070679_100004461 | 3300005530 | Bacteria | 12929 |
| 57 | Ga0070679_100862002 | 3300005530 | Bacteria | 849 |
| 58 | Ga0070684_100054948 | 3300005535 | Bacteria | 3470 |
| 59 | Ga0070684_100396419 | 3300005535 | Bacteria | 1272 |
| 60 | Ga0070684_101069068 | 3300005535 | Bacteria | 758 |
| 61 | Ga0070697_100625363 | 3300005536 | Bacteria | 947 |
| 62 | Ga0070686_100038896 | 3300005544 | Bacteria | 2960 |
| 63 | Ga0070695_101147003 | 3300005545 | Bacteria | 638 |
| 64 | Ga0070695_101490415 | 3300005545 | Bacteria | 563 |
| 65 | Ga0070696_100066090 | 3300005546 | Bacteria | 2536 |
| 66 | Ga0070693_100655205 | 3300005547 | Bacteria | 764 |
| 67 | Ga0070693_101501770 | 3300005547 | Bacteria | 527 |
| 68 | Ga0070665_100018684 | 3300005548 | Bacteria | 6949 |
| 69 | Ga0070665_100622851 | 3300005548 | Bacteria | 1092 |
| 70 | Ga0070665_101697504 | 3300005548 | Bacteria | 639 |
| 71 | Ga0070704_100323439 | 3300005549 | Bacteria | 1293 |
| 72 | Ga0070704_100793229 | 3300005549 | Bacteria | 846 |
| 73 | Ga0070704_101818084 | 3300005549 | Bacteria | 564 |
| 74 | Ga0070664_100511837 | 3300005564 | Bacteria | 1107 |
| 75 | Ga0068856_100016851 | 3300005614 | Bacteria | 7081 |
| 76 | Ga0068856_100080843 | 3300005614 | Bacteria | 3224 |
| 77 | Ga0068856_100318175 | 3300005614 | Bacteria | 1573 |
| 78 | Ga0068856_102248985 | 3300005614 | Bacteria | 554 |
| 79 | Ga0070702_100243491 | 3300005615 | Bacteria | 1215 |
| 80 | Ga0070702_100416322 | 3300005615 | Bacteria | 966 |
| 81 | Ga0068852_101448465 | 3300005616 | Bacteria | 709 |
| 82 | Ga0068864_101276731 | 3300005618 | Bacteria | 734 |
| 83 | Ga0068866_10129586 | 3300005718 | Bacteria | 1433 |
| 84 | Ga0068866_10211454 | 3300005718 | Bacteria | 1165 |
| 85 | Ga0068866_10432854 | 3300005718 | Bacteria | 856 |
| 86 | Ga0068861_100302437 | 3300005719 | Bacteria | 1386 |
| 87 | Ga0068861_100561039 | 3300005719 | Bacteria | 1042 |
| 88 | Ga0068870_10407609 | 3300005840 | Bacteria | 886 |
| 89 | Ga0068858_100432342 | 3300005842 | Bacteria | 1267 |
| 90 | Ga0068858_100700079 | 3300005842 | Bacteria | 986 |
| 91 | Ga0068860_100013584 | 3300005843 | Bacteria | 7983 |
| 92 | Ga0068862_100404588 | 3300005844 | Bacteria | 1277 |
| 93 | Ga0081455_10016609 | 3300005937 | Bacteria | 7097 |
| 94 | Ga0081455_10018501 | 3300005937 | Bacteria | 6633 |
| 95 | Ga0081455_10158928 | 3300005937 | Bacteria | 1734 |
| 96 | Ga0081455_10266822 | 3300005937 | Bacteria | 1244 |
| 97 | Ga0081455_10563808 | 3300005937 | Bacteria | 750 |
| 98 | Ga0081455_10743111 | 3300005937 | Bacteria | 621 |
| 99 | Ga0081538_10172051 | 3300005981 | Bacteria | 943 |
| 100 | Ga0081540_1015884 | 3300005983 | Bacteria | 4745 |
| 101 | Ga0070717_10008889 | 3300006028 | Bacteria | 7523 |
| 102 | Ga0070717_10022321 | 3300006028 | Bacteria | 5000 |
| 103 | Ga0070717_10058864 | 3300006028 | Unclassified | 3177 |
| 104 | Ga0070717_10404454 | 3300006028 | Bacteria | 1227 |
| 105 | Ga0070717_10917421 | 3300006028 | Bacteria | 797 |
| 106 | Ga0075365_10041987 | 3300006038 | Bacteria | 2989 |
| 107 | Ga0075365_10329318 | 3300006038 | Bacteria | 1076 |
| 108 | Ga0075365_11040510 | 3300006038 | Bacteria | 577 |
| 109 | Ga0075365_11216966 | 3300006038 | Bacteria | 530 |
| 110 | Ga0075368_10015109 | 3300006042 | Bacteria | 2859 |
| 111 | Ga0075363_100054107 | 3300006048 | Bacteria | 2147 |
| 112 | Ga0075363_100888179 | 3300006048 | Unclassified | 545 |
| 113 | Ga0075364_10037975 | 3300006051 | Bacteria | 3120 |
| 114 | Ga0075364_10421481 | 3300006051 | Unclassified | 911 |
| 115 | Ga0075432_10159955 | 3300006058 | Bacteria | 870 |
| 116 | Ga0075432_10409593 | 3300006058 | Bacteria | 587 |
| 117 | Ga0070715_10055136 | 3300006163 | Bacteria | 1724 |
| 118 | Ga0070716_100358353 | 3300006173 | Bacteria | 1035 |
| 119 | Ga0070716_100411904 | 3300006173 | Bacteria | 975 |
| 120 | Ga0070712_100019883 | 3300006175 | Bacteria | 4389 |
| 121 | Ga0070712_100053110 | 3300006175 | Bacteria | 2829 |
| 122 | Ga0070712_100107204 | 3300006175 | Bacteria | 2078 |
| 123 | Ga0070712_100857199 | 3300006175 | Unclassified | 782 |
| 124 | Ga0075362_10346055 | 3300006177 | Bacteria | 743 |
| 125 | Ga0075367_10114010 | 3300006178 | Bacteria | 1661 |
| 126 | Ga0097621_100081953 | 3300006237 | Bacteria | 2686 |
| 127 | Ga0075370_10006851 | 3300006353 | Bacteria | 5763 |
| 128 | Ga0075370_10063009 | 3300006353 | Bacteria | 2113 |
| 129 | Ga0068871_100030122 | 3300006358 | Bacteria | 4271 |
| 130 | Ga0068871_102206893 | 3300006358 | Bacteria | 525 |
| 131 | Ga0075428_100084060 | 3300006844 | Bacteria | 3473 |
| 132 | Ga0075431_100124751 | 3300006847 | Bacteria | 2657 |
| 133 | Ga0075433_10086386 | 3300006852 | Bacteria | 2770 |
| 134 | Ga0075433_10428891 | 3300006852 | Bacteria | 1166 |
| 135 | Ga0075433_11388620 | 3300006852 | Bacteria | 608 |
| 136 | Ga0075434_101100645 | 3300006871 | Bacteria | 808 |
| 137 | Ga0075434_102078258 | 3300006871 | Bacteria | 573 |
| 138 | Ga0075434_102431525 | 3300006871 | Bacteria | 526 |
| 139 | Ga0075434_102514920 | 3300006871 | Unclassified | 516 |
| 140 | Ga0068865_100418590 | 3300006881 | Bacteria | 1101 |
| 141 | Ga0068865_101829599 | 3300006881 | Bacteria | 549 |
| 142 | Ga0105240_11305882 | 3300009093 | Bacteria | 765 |
| 143 | Ga0111539_10025165 | 3300009094 | Bacteria | 7296 |
| 144 | Ga0111539_12973290 | 3300009094 | Bacteria | 548 |
| 145 | Ga0111539_13146438 | 3300009094 | Bacteria | 532 |
| 146 | Ga0105245_10134981 | 3300009098 | Bacteria | 2318 |
| 147 | Ga0105245_10698838 | 3300009098 | Bacteria | 1047 |
| 148 | Ga0105245_10972604 | 3300009098 | Bacteria | 892 |
| 149 | Ga0105245_11403147 | 3300009098 | Bacteria | 748 |
| 150 | Ga0105247_10019530 | 3300009101 | Bacteria | 4069 |
| 151 | Ga0114129_10978759 | 3300009147 | Bacteria | 1067 |
| 152 | Ga0114129_11062333 | 3300009147 | Bacteria | 1016 |
| 153 | Ga0105243_10049261 | 3300009148 | Bacteria | 3323 |
| 154 | Ga0105243_10154554 | 3300009148 | Bacteria | 1971 |
| 155 | Ga0105243_10165959 | 3300009148 | Bacteria | 1908 |
| 156 | Ga0105243_10181701 | 3300009148 | Bacteria | 1830 |
| 157 | Ga0105243_10867577 | 3300009148 | Bacteria | 895 |
| 158 | Ga0105243_11963380 | 3300009148 | Bacteria | 619 |
| 159 | Ga0105241_10174144 | 3300009174 | Bacteria | 1779 |
| 160 | Ga0105241_10643620 | 3300009174 | Bacteria | 962 |
| 161 | Ga0105241_10933515 | 3300009174 | Bacteria | 808 |
| 162 | Ga0105241_11730174 | 3300009174 | Bacteria | 608 |
| 163 | Ga0105242_10009004 | 3300009176 | Bacteria | 7668 |
| 164 | Ga0105242_10654351 | 3300009176 | Bacteria | 1022 |
| 165 | Ga0105248_10008393 | 3300009177 | Bacteria | 11339 |
| 166 | Ga0105248_10891150 | 3300009177 | Bacteria | 1004 |
| 167 | Ga0105248_11605813 | 3300009177 | Bacteria | 737 |
| 168 | Ga0105237_10114454 | 3300009545 | Bacteria | 2690 |
| 169 | Ga0105238_10527352 | 3300009551 | Bacteria | 1184 |
| 170 | Ga0105238_11504732 | 3300009551 | Bacteria | 702 |
| 171 | Ga0105238_12989252 | 3300009551 | Bacteria | 508 |
| 172 | Ga0105249_12724817 | 3300009553 | Unclassified | 566 |
| 173 | Ga0105239_11350362 | 3300010375 | Bacteria | 822 |
| 174 | Ga0105239_12104727 | 3300010375 | Bacteria | 656 |
| 175 | Ga0105246_10077154 | 3300011119 | Bacteria | 2363 |
| 176 | Ga0105246_10259350 | 3300011119 | Bacteria | 1384 |
| 177 | Ga0105246_10662012 | 3300011119 | Bacteria | 910 |
| 178 | Ga0157347_1032871 | 3300012502 | Unclassified | 657 |
| 179 | Ga0157339_1016172 | 3300012505 | Bacteria | 744 |
| 180 | Ga0157371_10602429 | 3300013102 | Bacteria | 817 |
| 181 | Ga0157369_10407749 | 3300013105 | Bacteria | 1410 |
| 182 | Ga0157369_10808903 | 3300013105 | Bacteria | 963 |
| 183 | Ga0157378_10008117 | 3300013297 | Bacteria | 9160 |
| 184 | Ga0157378_10904787 | 3300013297 | Bacteria | 913 |
| 185 | Ga0157378_10945804 | 3300013297 | Bacteria | 894 |
| 186 | Ga0163162_10862862 | 3300013306 | Bacteria | 1020 |
| 187 | Ga0163162_11102478 | 3300013306 | Bacteria | 899 |
| 188 | Ga0163162_11984395 | 3300013306 | Bacteria | 667 |
| 189 | Ga0157372_10359812 | 3300013307 | Bacteria | 1696 |
| 190 | Ga0157372_11025778 | 3300013307 | Bacteria | 955 |
| 191 | Ga0157372_12041665 | 3300013307 | Bacteria | 659 |
| 192 | Ga0157372_12835072 | 3300013307 | Unclassified | 556 |
| 193 | Ga0157375_11194941 | 3300013308 | Bacteria | 892 |
| 194 | Ga0163163_10112580 | 3300014325 | Bacteria | 2751 |
| 195 | Ga0163163_10121719 | 3300014325 | Bacteria | 2643 |
| 196 | Ga0157379_10016605 | 3300014968 | Bacteria | 6475 |
| 197 | Ga0157379_10871285 | 3300014968 | Bacteria | 853 |
| 198 | Ga0157376_10086869 | 3300014969 | Bacteria | 2697 |
| 199 | Ga0157376_11735795 | 3300014969 | Bacteria | 660 |
| 200 | Ga0163161_10379575 | 3300017792 | Bacteria | 1129 |
| 201 | Ga0197907_11174359 | 3300020069 | Bacteria | 515 |
| 202 | Ga0206356_10745467 | 3300020070 | Bacteria | 686 |
| 203 | Ga0206356_11239141 | 3300020070 | Bacteria | 1002 |
| 204 | Ga0206354_11350515 | 3300020081 | Bacteria | 579 |
| 205 | Ga0206353_10815935 | 3300020082 | Bacteria | 1120 |
| 206 | Ga0213873_10138043 | 3300021358 | Bacteria | 726 |
| 207 | Ga0213876_10133847 | 3300021384 | Bacteria | 1318 |
| 208 | Ga0213875_10338456 | 3300021388 | Bacteria | 714 |
| 209 | Ga0224712_10600980 | 3300022467 | Bacteria | 537 |
| 210 | Ga0207642_10323145 | 3300025899 | Bacteria | 902 |
| 211 | Ga0207642_10348492 | 3300025899 | Bacteria | 873 |
| 212 | Ga0207710_10495254 | 3300025900 | Bacteria | 634 |
| 213 | Ga0207680_10004937 | 3300025903 | Bacteria | 6351 |
| 214 | Ga0207685_10034081 | 3300025905 | Bacteria | 1847 |
| 215 | Ga0207685_10034466 | 3300025905 | Bacteria | 1839 |
| 216 | Ga0207699_10058901 | 3300025906 | Bacteria | 2299 |
| 217 | Ga0207699_11269050 | 3300025906 | Bacteria | 545 |
| 218 | Ga0207654_10238566 | 3300025911 | Bacteria | 1214 |
| 219 | Ga0207654_11159346 | 3300025911 | Bacteria | 563 |
| 220 | Ga0207693_10008842 | 3300025915 | Bacteria | 8227 |
| 221 | Ga0207693_10158900 | 3300025915 | Bacteria | 1778 |
| 222 | Ga0207693_10266857 | 3300025915 | Bacteria | 1341 |
| 223 | Ga0207693_10357643 | 3300025915 | Bacteria | 1142 |
| 224 | Ga0207660_10930171 | 3300025917 | Bacteria | 709 |
| 225 | Ga0207657_10131428 | 3300025919 | Bacteria | 2051 |
| 226 | Ga0207649_11298425 | 3300025920 | Bacteria | 576 |
| 227 | Ga0207652_10000866 | 3300025921 | Bacteria | 28643 |
| 228 | Ga0207652_10553086 | 3300025921 | Bacteria | 1034 |
| 229 | Ga0207694_10331169 | 3300025924 | Bacteria | 1258 |
| 230 | Ga0207687_10510758 | 3300025927 | Bacteria | 1004 |
| 231 | Ga0207687_10865815 | 3300025927 | Bacteria | 772 |
| 232 | Ga0207687_10988519 | 3300025927 | Bacteria | 721 |
| 233 | Ga0207700_10182565 | 3300025928 | Bacteria | 1758 |
| 234 | Ga0207664_10102438 | 3300025929 | Bacteria | 2367 |
| 235 | Ga0207664_10134819 | 3300025929 | Unclassified | 2083 |
| 236 | Ga0207664_11340404 | 3300025929 | Bacteria | 636 |
| 237 | Ga0207664_11427447 | 3300025929 | Unclassified | 613 |
| 238 | Ga0207644_10144207 | 3300025931 | Bacteria | 1837 |
| 239 | Ga0207644_10383277 | 3300025931 | Bacteria | 1147 |
| 240 | Ga0207690_10596025 | 3300025932 | Bacteria | 902 |
| 241 | Ga0207690_11273278 | 3300025932 | Unclassified | 614 |
| 242 | Ga0207706_10331948 | 3300025933 | Bacteria | 1323 |
| 243 | Ga0207706_10790646 | 3300025933 | Bacteria | 806 |
| 244 | Ga0207686_10172120 | 3300025934 | Bacteria | 1528 |
| 245 | Ga0207686_10585839 | 3300025934 | Bacteria | 876 |
| 246 | Ga0207709_10054219 | 3300025935 | Bacteria | 2471 |
| 247 | Ga0207709_10065528 | 3300025935 | Bacteria | 2285 |
| 248 | Ga0207709_10072431 | 3300025935 | Bacteria | 2192 |
| 249 | Ga0207709_10274557 | 3300025935 | Bacteria | 1242 |
| 250 | Ga0207709_10572078 | 3300025935 | Bacteria | 891 |
| 251 | Ga0207669_10002481 | 3300025937 | Bacteria | 7866 |
| 252 | Ga0207669_10355514 | 3300025937 | Bacteria | 1133 |
| 253 | Ga0207669_10462153 | 3300025937 | Bacteria | 1008 |
| 254 | Ga0207669_11180408 | 3300025937 | Bacteria | 648 |
| 255 | Ga0207704_11069149 | 3300025938 | Unclassified | 685 |
| 256 | Ga0207665_10665294 | 3300025939 | Bacteria | 817 |
| 257 | Ga0207665_10710531 | 3300025939 | Bacteria | 790 |
| 258 | Ga0207665_10747103 | 3300025939 | Bacteria | 771 |
| 259 | Ga0207711_10079640 | 3300025941 | Bacteria | 2860 |
| 260 | Ga0207711_11878101 | 3300025941 | Bacteria | 542 |
| 261 | Ga0207679_10401523 | 3300025945 | Bacteria | 1206 |
| 262 | Ga0207668_10841668 | 3300025972 | Bacteria | 814 |
| 263 | Ga0207668_11028914 | 3300025972 | Bacteria | 737 |
| 264 | Ga0207640_11478518 | 3300025981 | Bacteria | 610 |
| 265 | Ga0207658_10009795 | 3300025986 | Bacteria | 6507 |
| 266 | Ga0207658_10252637 | 3300025986 | Bacteria | 1499 |
| 267 | Ga0207677_10025348 | 3300026023 | Bacteria | 3699 |
| 268 | Ga0207677_10189912 | 3300026023 | Bacteria | 1624 |
| 269 | Ga0207677_10810312 | 3300026023 | Bacteria | 839 |
| 270 | Ga0207703_10188582 | 3300026035 | Bacteria | 1824 |
| 271 | Ga0207678_10003026 | 3300026067 | Bacteria | 15207 |
| 272 | Ga0207678_10098405 | 3300026067 | Bacteria | 2499 |
| 273 | Ga0207708_10339995 | 3300026075 | Bacteria | 1229 |
| 274 | Ga0207702_10012731 | 3300026078 | Bacteria | 7000 |
| 275 | Ga0207702_10060560 | 3300026078 | Bacteria | 3227 |
| 276 | Ga0207702_10784194 | 3300026078 | Bacteria | 942 |
| 277 | Ga0207702_11292178 | 3300026078 | Bacteria | 724 |
| 278 | Ga0207641_10930826 | 3300026088 | Bacteria | 864 |
| 279 | Ga0207648_10123367 | 3300026089 | Bacteria | 2278 |
| 280 | Ga0207648_10476136 | 3300026089 | Bacteria | 1140 |
| 281 | Ga0207648_11447474 | 3300026089 | Bacteria | 646 |
| 282 | Ga0207676_10963910 | 3300026095 | Bacteria | 839 |
| 283 | Ga0207675_100447136 | 3300026118 | Bacteria | 1280 |
| 284 | Ga0207675_100522764 | 3300026118 | Bacteria | 1183 |
| 285 | Ga0207675_102160583 | 3300026118 | Bacteria | 572 |
| 286 | Ga0207683_10002107 | 3300026121 | Bacteria | 17501 |
| 287 | Ga0207698_11054926 | 3300026142 | Bacteria | 824 |
| 288 | Ga0209813_10031659 | 3300027866 | Bacteria | 1563 |
| 289 | Ga0207428_10981604 | 3300027907 | Unclassified | 594 |
| 290 | Ga0268266_10000775 | 3300028379 | Bacteria | 42696 |
| 291 | Ga0268266_10593385 | 3300028379 | Bacteria | 1064 |
| 292 | Ga0268265_10627075 | 3300028380 | Bacteria | 1031 |
| 293 | Ga0268265_11795091 | 3300028380 | Bacteria | 620 |
| 294 | Ga0268264_10035483 | 3300028381 | Bacteria | 4106 |
| 295 | Ga0265334_10130780 | 3300028573 | Bacteria | 893 |
| 296 | Ga0265338_11187061 | 3300028800 | Bacteria | 512 |
| 297 | Ga0307408_100446462 | 3300031548 | Bacteria | 1121 |
| 298 | Ga0307413_10481867 | 3300031824 | Bacteria | 992 |
| 299 | Ga0307406_11516045 | 3300031901 | Bacteria | 590 |
| 300 | Ga0307409_100361637 | 3300031995 | Bacteria | 1373 |
| 301 | Ga0307409_100982783 | 3300031995 | Bacteria | 861 |
| 302 | Ga0307416_100825380 | 3300032002 | Bacteria | 1024 |
| 303 | Ga0307416_102719405 | 3300032002 | Bacteria | 591 |
| 304 | Ga0373926_0411398 | 3300035083 | Bacteria | 535 |
| 305 | Ga0373944_0091876 | 3300035089 | Unclassified | 1015 |
| 306 | Ga0373952_0180330 | 3300035092 | Bacteria | 609 |
| 307 | Ga0373923_0625871 | 3300035111 | Bacteria | 531 |
| 308 | Ga0373939_0440606 | 3300035114 | Bacteria | 547 |
| 309 | Ga0373953_0387445 | 3300035117 | Bacteria | 614 |
| 310 | Ga0373954_0647299 | 3300035118 | Unclassified | 524 |
| 311 | Ga0373956_0383036 | 3300035119 | Bacteria | 671 |
| 312 | Ga0373960_0068950 | 3300035121 | Bacteria | 1090 |
| 313 | Ga0373943_0493588 | 3300035170 | Bacteria | 715 |
| 314 | Ga0373961_0257817 | 3300035241 | Unclassified | 633 |
| 315 | Ga0373961_0326244 | 3300035241 | Bacteria | 574 |
| 316 | Ga0373931_0645228 | 3300035691 | Bacteria | 695 |
| 317 | Ga0373935_0116189 | 3300035692 | Bacteria | 1782 |
| 318 | Ga0373935_0328393 | 3300035692 | Bacteria | 1087 |
| 319 | Ga0373927_0482375 | 3300035695 | Unclassified | 819 |
| 320 | Ga0373933_0033222 | 3300035724 | Bacteria | 3000 |
| 321 | Ga0373947_0373456 | 3300035725 | Bacteria | 959 |
| 322 | Ga0373937_0028286 | 3300036401 | Bacteria | 5071 |
| 323 | Ga0373925_0378536 | 3300037068 | Bacteria | 1152 |
| 324 | Ga0373925_1214529 | 3300037068 | Bacteria | 619 |
| 325 | Ga0373925_1520396 | 3300037068 | Bacteria | 548 |
| 326 | Ga0395899_0389522 | 3300037312 | Unclassified | 924 |
| 327 | Ga0395900_0429449 | 3300037418 | Bacteria | 1281 |
| 328 | Ga0395900_0977891 | 3300037418 | Bacteria | 767 |
| 329 | Ga0395898_0057118 | 3300037466 | Bacteria | 3803 |
| 330 | Ga0395898_0107817 | 3300037466 | Bacteria | 2671 |
| 331 | Ga0395898_0287397 | 3300037466 | Bacteria | 1569 |
| 332 | Ga0395898_0589972 | 3300037466 | Bacteria | 1054 |
| 333 | Ga0395905_0019511 | 3300037471 | Bacteria | 6426 |
| 334 | Ga0395905_1583094 | 3300037471 | Unclassified | 560 |
| 335 | Ga0436364_0518932 | 3300037853 | Bacteria | 1436 |
| 336 | Ga0436364_0628413 | 3300037853 | Unclassified | 2898 |
| 337 | Ga0436364_0971376 | 3300037853 | Bacteria | 2410 |
| 338 | Ga0436364_1132559 | 3300037853 | Bacteria | 1484 |
| 339 | Ga0395901_0026716 | 3300038443 | Bacteria | 5927 |
| 340 | Ga0395901_0062441 | 3300038443 | Bacteria | 3877 |
| 341 | Ga0395901_0088875 | 3300038443 | Bacteria | 3232 |
| 342 | Ga0395901_0291393 | 3300038443 | Bacteria | 1694 |
| 343 | Ga0395901_0379495 | 3300038443 | Bacteria | 1455 |
| 344 | Ga0395901_0449701 | 3300038443 | Bacteria | 1318 |
| 345 | Ga0395901_1128038 | 3300038443 | Unclassified | 753 |
| 346 | Ga0395901_1890213 | 3300038443 | Bacteria | 545 |
| 347 | Ga0436365_0594382 | 3300039437 | Unclassified | 671 |
| 348 | Ga0436365_0711155 | 3300039437 | Bacteria | 3963 |
| 349 | Ga0436362_1250915 | 3300039453 | Bacteria | 1428 |
| 350 | Ga0451789_0713917 | 3300041443 | Bacteria | 555 |
| 351 | Ga0451804_0947887 | 3300041463 | Bacteria | 541 |
| 352 | Ga0451807_2432494 | 3300041486 | Bacteria | 1554 |
| 353 | Ga0451839_1634149 | 3300041496 | Bacteria | 584 |
| 354 | Ga0451851_0272330 | 3300041507 | Bacteria | 646 |
| 355 | Ga0451853_0814883 | 3300041512 | Bacteria | 5891 |
| 356 | Ga0451577_0046892 | 3300042876 | Bacteria | 3864 |
| 357 | Ga0453683_0272124 | 3300044673 | Unclassified | 1081 |
| 358 | Ga0466961_0204364 | 3300044693 | Bacteria | 1221 |
| 359 | Ga0466961_0265557 | 3300044693 | Unclassified | 1052 |
| 360 | Ga0466961_0824584 | 3300044693 | Bacteria | 553 |
| 361 | Ga0466963_0015355 | 3300044694 | Bacteria | 4740 |
| 362 | Ga0466963_0185292 | 3300044694 | Unclassified | 1454 |
| 363 | Ga0466963_0256456 | 3300044694 | Unclassified | 1227 |
| 364 | Ga0466963_0330163 | 3300044694 | Bacteria | 1074 |
| 365 | Ga0466963_0360962 | 3300044694 | Bacteria | 1023 |
| 366 | Ga0466963_0401049 | 3300044694 | Bacteria | 967 |
| 367 | Ga0466963_0437580 | 3300044694 | Bacteria | 922 |
| 368 | Ga0466963_0505582 | 3300044694 | Bacteria | 853 |
| 369 | Ga0466963_0679354 | 3300044694 | Bacteria | 727 |
| 370 | Ga0466963_1128325 | 3300044694 | Bacteria | 551 |
| 371 | Ga0466964_0287152 | 3300044706 | Bacteria | 824 |
| 372 | Ga0466964_0377431 | 3300044706 | Bacteria | 735 |
| 373 | Ga0466964_0505366 | 3300044706 | Bacteria | 650 |
| 374 | Ga0453684_0441844 | 3300044712 | Unclassified | 1449 |
| 375 | Ga0466971_0176365 | 3300044719 | Bacteria | 1004 |
| 376 | Ga0466968_0285935 | 3300044735 | Bacteria | 790 |
| 377 | Ga0466968_0711257 | 3300044735 | Bacteria | 513 |
| 378 | Ga0466970_0209448 | 3300044765 | Unclassified | 1086 |
| 379 | Ga0466957_0037571 | 3300044842 | Bacteria | 2916 |
| 380 | Ga0466957_0090342 | 3300044842 | Unclassified | 1918 |
| 381 | Ga0466960_0000034 | 3300044901 | Bacteria | 45522 |
| 382 | Ga0466960_0276459 | 3300044901 | Bacteria | 940 |
| 383 | Ga0466960_0414930 | 3300044901 | Bacteria | 777 |
| 384 | Ga0466959_0168244 | 3300045049 | Unclassified | 1538 |
| 385 | Ga0451576_0270649 | 3300045051 | Unclassified | 1776 |
| 386 | Ga0466958_0036647 | 3300045836 | Bacteria | 2937 |
| 387 | Ga0466958_0251636 | 3300045836 | Bacteria | 1130 |
| 388 | Ga0466958_0603112 | 3300045836 | Bacteria | 714 |
| 389 | Ga0466958_0627333 | 3300045836 | Bacteria | 699 |
| 390 | Ga0466958_0950113 | 3300045836 | Bacteria | 561 |
| 391 | Ga0466967_0030197 | 3300045976 | Bacteria | 4546 |
| 392 | Ga0466967_0050345 | 3300045976 | Bacteria | 3647 |
| 393 | Ga0466967_0282541 | 3300045976 | Bacteria | 1593 |
| 394 | Ga0466967_0627868 | 3300045976 | Bacteria | 1061 |
| 395 | Ga0466967_0945713 | 3300045976 | Unclassified | 857 |
| 396 | Ga0466967_1140279 | 3300045976 | Bacteria | 777 |
| 397 | Ga0466967_1503804 | 3300045976 | Bacteria | 671 |
| 398 | Ga0466967_1813416 | 3300045976 | Bacteria | 607 |
| 399 | Ga0495627_148095 | 3300046453 | Unclassified | 656 |
| 400 | Ga0495592_0741822 | 3300046454 | Bacteria | 588 |
| 401 | Ga0495603_0023464 | 3300046455 | Unclassified | 3732 |
| 402 | Ga0495603_0108912 | 3300046455 | Bacteria | 1617 |
| 403 | Ga0495629_0257146 | 3300046459 | Bacteria | 1201 |
| 404 | Ga0495629_0322108 | 3300046459 | Bacteria | 1057 |
| 405 | Ga0495641_0002764 | 3300046461 | Bacteria | 13593 |
| 406 | Ga0495641_0043612 | 3300046461 | Bacteria | 2074 |
| 407 | Ga0495641_0044742 | 3300046461 | Bacteria | 2041 |
| 408 | Ga0495641_0073484 | 3300046461 | Bacteria | 1534 |
| 409 | Ga0495651_0003797 | 3300046462 | Bacteria | 11554 |
| 410 | Ga0495651_0678751 | 3300046462 | Bacteria | 644 |
| 411 | Ga0495653_0008194 | 3300046463 | Bacteria | 8560 |
| 412 | Ga0495653_0513845 | 3300046463 | Bacteria | 745 |
| 413 | Ga0495580_0286688 | 3300046472 | Bacteria | 1123 |
| 414 | Ga0495582_0019015 | 3300046473 | Bacteria | 3759 |
| 415 | Ga0495582_0114704 | 3300046473 | Bacteria | 1514 |
| 416 | Ga0495662_0225880 | 3300046476 | Bacteria | 923 |
| 417 | Ga0495584_0136605 | 3300046491 | Bacteria | 1245 |
| 418 | Ga0495584_0157933 | 3300046491 | Bacteria | 1152 |
| 419 | Ga0495596_0047242 | 3300046500 | Bacteria | 1689 |
| 420 | Ga0495596_0324776 | 3300046500 | Bacteria | 599 |
| 421 | Ga0495607_0168500 | 3300046501 | Bacteria | 1108 |
| 422 | Ga0495583_0285195 | 3300046506 | Unclassified | 658 |
| 423 | Ga0495608_0005127 | 3300046511 | Bacteria | 9361 |
| 424 | Ga0495608_0850426 | 3300046511 | Unclassified | 536 |
| 425 | Ga0495616_0239252 | 3300046513 | Bacteria | 784 |
| 426 | Ga0495618_0045429 | 3300046514 | Bacteria | 2771 |
| 427 | Ga0495628_0008385 | 3300046516 | Bacteria | 8865 |
| 428 | Ga0495628_0896515 | 3300046516 | Bacteria | 616 |
| 429 | Ga0495630_1057387 | 3300046517 | Bacteria | 616 |
| 430 | Ga0495631_0512925 | 3300046518 | Unclassified | 511 |
| 431 | Ga0495637_0060884 | 3300046520 | Bacteria | 1549 |
| 432 | Ga0495644_0162243 | 3300046523 | Bacteria | 857 |
| 433 | Ga0495663_0074847 | 3300046525 | Bacteria | 1083 |
| 434 | Ga0495666_0262223 | 3300046526 | Bacteria | 786 |
| 435 | Ga0495642_0097304 | 3300046528 | Bacteria | 1250 |
| 436 | Ga0495652_0013293 | 3300046529 | Bacteria | 7408 |
| 437 | Ga0495665_0045516 | 3300046531 | Bacteria | 2331 |
| 438 | Ga0495640_0787734 | 3300046533 | Bacteria | 567 |
| 439 | Ga0495586_0633040 | 3300046535 | Bacteria | 618 |
| 440 | Ga0495587_0064013 | 3300046536 | Bacteria | 2149 |
| 441 | Ga0495645_0210812 | 3300046543 | Bacteria | 1312 |
| 442 | Ga0495667_0002822 | 3300046559 | Bacteria | 11608 |
| 443 | Ga0495667_0194055 | 3300046559 | Bacteria | 1301 |
| 444 | Ga0495667_0218032 | 3300046559 | Bacteria | 1218 |
| 445 | Ga0495656_0277005 | 3300046615 | Bacteria | 854 |
| 446 | Ga0495656_0330204 | 3300046615 | Bacteria | 787 |
| 447 | Ga0495656_0380938 | 3300046615 | Bacteria | 735 |
| 448 | Ga0495668_0688716 | 3300046616 | Unclassified | 565 |
| 449 | Ga0495634_0034771 | 3300046642 | Bacteria | 3456 |
| 450 | Ga0495634_0227038 | 3300046642 | Bacteria | 1150 |
| 451 | Ga0495635_0009515 | 3300046663 | Bacteria | 6793 |
| 452 | Ga0495635_0060815 | 3300046663 | Bacteria | 2595 |
| 453 | Ga0495659_0073570 | 3300046664 | Bacteria | 1285 |
| 454 | Ga0495588_0433213 | 3300046674 | Bacteria | 690 |
| 455 | Ga0495657_0015852 | 3300046675 | Bacteria | 5504 |
| 456 | Ga0495657_0190079 | 3300046675 | Bacteria | 1256 |
| 457 | Ga0495599_0014431 | 3300046678 | Bacteria | 4892 |
| 458 | Ga0495646_0008419 | 3300046680 | Bacteria | 6549 |
| 459 | Ga0495647_0002631 | 3300046681 | Bacteria | 5691 |
| 460 | Ga0495658_0008300 | 3300046683 | Bacteria | 5146 |
| 461 | Ga0495658_0827338 | 3300046683 | Bacteria | 593 |
| 462 | Ga0495669_0271877 | 3300046684 | Bacteria | 815 |
| 463 | Ga0495669_0528679 | 3300046684 | Unclassified | 574 |
| 464 | Ga0495613_0016167 | 3300046689 | Bacteria | 5558 |
| 465 | Ga0495613_0028316 | 3300046689 | Bacteria | 4166 |
| 466 | Ga0495624_0504267 | 3300046690 | Bacteria | 724 |
| 467 | Ga0495670_0502634 | 3300046691 | Bacteria | 658 |
| 468 | Ga0495671_0083060 | 3300046692 | Bacteria | 1570 |
| 469 | Ga0495589_0230341 | 3300046794 | Bacteria | 869 |
| 470 | Ga0495600_0001744 | 3300046809 | Bacteria | 12154 |
| 471 | Ga0495581_0002802 | 3300047315 | Bacteria | 9951 |
| 472 | Ga0495604_0008035 | 3300047317 | Bacteria | 8360 |
| 473 | Ga0495674_0007929 | 3300047319 | Bacteria | 10135 |
| 474 | Ga0495674_1017815 | 3300047319 | Bacteria | 634 |
| 475 | Ga0495676_0010518 | 3300047321 | Bacteria | 8386 |
| 476 | Ga0495676_0167999 | 3300047321 | Bacteria | 1546 |
| 477 | Ga0495676_0277308 | 3300047321 | Bacteria | 1136 |
| 478 | Ga0495676_0845164 | 3300047321 | Bacteria | 588 |
| 479 | Ga0495680_0005335 | 3300047322 | Bacteria | 12127 |
| 480 | Ga0495680_0092498 | 3300047322 | Bacteria | 2265 |
| 481 | Ga0495675_0063723 | 3300047444 | Bacteria | 2332 |
| 482 | Ga0495677_0098842 | 3300047445 | Bacteria | 1104 |
| 483 | Ga0495684_0003466 | 3300047471 | Bacteria | 12342 |
| 484 | Ga0495684_0407421 | 3300047471 | Bacteria | 953 |
| 485 | Ga0495593_0071190 | 3300047673 | Bacteria | 1806 |
| 486 | Ga0495602_0406797 | 3300048088 | Bacteria | 969 |
| 487 | Ga0495626_0155107 | 3300048091 | Bacteria | 963 |
| 488 | Ga0496100_0000160 | 3300048903 | Bacteria | 37151 |
| 489 | Ga0496100_0019499 | 3300048903 | Bacteria | 4048 |
| 490 | Ga0496100_0178056 | 3300048903 | Bacteria | 1536 |
| 491 | Ga0496101_0012843 | 3300048904 | Bacteria | 5601 |
| 492 | Ga0496101_0020330 | 3300048904 | Bacteria | 4542 |
| 493 | Ga0496101_0067384 | 3300048904 | Bacteria | 2614 |
| 494 | Ga0496101_1442878 | 3300048904 | Bacteria | 536 |
| 495 | Ga0496102_0019630 | 3300048905 | Bacteria | 5955 |
| 496 | Ga0496102_0095627 | 3300048905 | Bacteria | 2754 |
| 497 | Ga0496102_1307632 | 3300048905 | Bacteria | 644 |
| 498 | Ga0496102_1482635 | 3300048905 | Bacteria | 597 |
| 499 | Ga0496103_0010453 | 3300048906 | Bacteria | 5494 |
| 500 | Ga0496103_0021233 | 3300048906 | Bacteria | 3906 |
| 501 | Ga0496103_0039832 | 3300048906 | Bacteria | 2888 |
| 502 | Ga0496103_0469490 | 3300048906 | Bacteria | 806 |
| 503 | Ga0496104_0005625 | 3300048907 | Bacteria | 10977 |
| 504 | Ga0496104_0016547 | 3300048907 | Bacteria | 6702 |
| 505 | Ga0496104_0018971 | 3300048907 | Bacteria | 6284 |
| 506 | Ga0496104_0026628 | 3300048907 | Bacteria | 5343 |
| 507 | Ga0496104_0122627 | 3300048907 | Bacteria | 2495 |
| 508 | Ga0496104_0533662 | 3300048907 | Unclassified | 1084 |
| 509 | Ga0496104_0753417 | 3300048907 | Bacteria | 881 |
| 510 | Ga0496105_0041755 | 3300048908 | Bacteria | 3780 |
| 511 | Ga0496105_0089089 | 3300048908 | Bacteria | 2549 |
| 512 | Ga0496105_0093197 | 3300048908 | Bacteria | 2487 |
| 513 | Ga0496105_0195632 | 3300048908 | Bacteria | 1652 |
| 514 | Ga0496105_0205147 | 3300048908 | Bacteria | 1608 |
| 515 | Ga0496106_0005055 | 3300048909 | Bacteria | 9761 |
| 516 | Ga0496106_0031262 | 3300048909 | Bacteria | 3966 |
| 517 | Ga0496106_0254517 | 3300048909 | Bacteria | 1404 |
| 518 | Ga0496107_0047242 | 3300048910 | Bacteria | 3100 |
| 519 | Ga0496107_0050246 | 3300048910 | Bacteria | 3005 |
| 520 | Ga0496107_0265948 | 3300048910 | Bacteria | 1276 |
| 521 | Ga0496108_0000293 | 3300048911 | Bacteria | 43066 |
| 522 | Ga0496108_0060335 | 3300048911 | Bacteria | 3191 |
| 523 | Ga0496108_0216495 | 3300048911 | Bacteria | 1663 |
| 524 | Ga0496108_0252766 | 3300048911 | Bacteria | 1533 |
| 525 | Ga0496108_0462469 | 3300048911 | Bacteria | 1108 |
| 526 | Ga0496108_0890852 | 3300048911 | Bacteria | 764 |
| 527 | Ga0496109_0003621 | 3300048912 | Bacteria | 12918 |
| 528 | Ga0496109_0206412 | 3300048912 | Bacteria | 1847 |
| 529 | Ga0496109_0398674 | 3300048912 | Bacteria | 1300 |
| 530 | Ga0496109_1527474 | 3300048912 | Bacteria | 602 |
| 531 | Ga0496110_0112521 | 3300048913 | Bacteria | 2447 |
| 532 | Ga0496110_0120489 | 3300048913 | Bacteria | 2363 |
| 533 | Ga0496110_0241358 | 3300048913 | Bacteria | 1644 |
| 534 | Ga0496110_0489118 | 3300048913 | Bacteria | 1121 |
| 535 | Ga0496110_0801299 | 3300048913 | Bacteria | 846 |
| 536 | Ga0496111_0010620 | 3300048914 | Bacteria | 6187 |
| 537 | Ga0496111_0176726 | 3300048914 | Bacteria | 1587 |
| 538 | Ga0496111_0727557 | 3300048914 | Bacteria | 721 |
| 539 | Ga0496111_0898870 | 3300048914 | Bacteria | 638 |
| 540 | Ga0496112_0026671 | 3300048915 | Bacteria | 5565 |
| 541 | Ga0496112_0134669 | 3300048915 | Bacteria | 2441 |
| 542 | Ga0496112_0376926 | 3300048915 | Bacteria | 1360 |
| 543 | Ga0496112_0661276 | 3300048915 | Bacteria | 974 |
| 544 | Ga0496112_1107156 | 3300048915 | Bacteria | 710 |
| 545 | Ga0496112_1551082 | 3300048915 | Bacteria | 576 |
| 546 | Ga0496113_0002572 | 3300048916 | Bacteria | 10598 |
| 547 | Ga0496113_0114004 | 3300048916 | Bacteria | 2107 |
| 548 | Ga0496113_0387660 | 3300048916 | Bacteria | 1121 |
| 549 | Ga0496113_0782377 | 3300048916 | Bacteria | 759 |
| 550 | Ga0496113_0938104 | 3300048916 | Bacteria | 683 |
| 551 | Ga0496114_0004765 | 3300048917 | Bacteria | 10559 |
| 552 | Ga0496114_0067006 | 3300048917 | Bacteria | 3011 |
| 553 | Ga0496114_0140069 | 3300048917 | Bacteria | 2094 |
| 554 | Ga0496114_0562114 | 3300048917 | Bacteria | 1007 |
| 555 | Ga0496115_0143216 | 3300048918 | Bacteria | 1972 |
| 556 | Ga0496115_0281595 | 3300048918 | Bacteria | 1365 |
| 557 | Ga0496119_0004993 | 3300048922 | Bacteria | 12953 |
| 558 | Ga0496124_0026441 | 3300048927 | Bacteria | 5232 |
| 559 | Ga0496125_0059947 | 3300048928 | Bacteria | 3063 |
| 560 | Ga0496126_0007744 | 3300048929 | Bacteria | 11710 |
| 561 | Ga0496126_0104226 | 3300048929 | Bacteria | 2478 |
| 562 | Ga0501032_0108123 | 3300049569 | Bacteria | 1841 |
| 563 | Ga0501033_0015707 | 3300049570 | Bacteria | 5741 |
| 564 | Ga0501034_0115274 | 3300049571 | Bacteria | 2675 |
| 565 | Ga0501036_0019994 | 3300049572 | Bacteria | 5621 |
| 566 | Ga0501037_0039013 | 3300049573 | Bacteria | 3497 |
| 567 | Ga0501038_0084213 | 3300049574 | Bacteria | 2675 |
| 568 | Ga0501039_0206568 | 3300049575 | Bacteria | 1544 |
| 569 | Ga0501042_0040893 | 3300049578 | Bacteria | 3295 |
| 570 | Ga0501043_0062938 | 3300049579 | Bacteria | 2913 |
| 571 | Ga0501046_0006359 | 3300049580 | Bacteria | 10475 |
| 572 | Ga0501047_0008965 | 3300049581 | Bacteria | 9444 |
| 573 | Ga0501047_0134649 | 3300049581 | Bacteria | 2351 |
| 574 | Ga0501047_0336102 | 3300049581 | Bacteria | 1348 |
| 575 | Ga0501047_0421629 | 3300049581 | Bacteria | 1166 |
| 576 | Ga0501048_0059415 | 3300049582 | Bacteria | 2709 |
| 577 | Ga0501067_0377198 | 3300049583 | Bacteria | 791 |
| 578 | Ga0501067_0466756 | 3300049583 | Bacteria | 705 |
| 579 | Ga0501069_0635660 | 3300049585 | Bacteria | 642 |
| 580 | Ga0501070_0030530 | 3300049586 | Bacteria | 4516 |
| 581 | Ga0501071_0187882 | 3300049587 | Bacteria | 1549 |
| 582 | Ga0501072_1204969 | 3300049588 | Bacteria | 588 |
| 583 | Ga0501073_0036488 | 3300049589 | Bacteria | 3492 |
| 584 | Ga0501073_0712201 | 3300049589 | Bacteria | 692 |
| 585 | Ga0501076_0205205 | 3300049592 | Bacteria | 1610 |
| 586 | Ga0501076_0479610 | 3300049592 | Bacteria | 1025 |
| 587 | Ga0501202_230738 | 3300049652 | Bacteria | 515 |
| 588 | Ga0501083_0033679 | 3300049744 | Bacteria | 3506 |
| 589 | Ga0501083_0604889 | 3300049744 | Bacteria | 713 |
| 590 | Ga0501035_0522168 | 3300049822 | Bacteria | 975 |
| 591 | Ga0501044_0386704 | 3300049823 | Bacteria | 1313 |
| 592 | nmdc:mga03683_393832_c1 | 3300050489 | Bacteria | 661 |
| 593 | nmdc:mga03n38_18927_c1 | 3300050490 | Bacteria | 2727 |
| 594 | nmdc:mga00v17_32357_c1 | 3300050491 | Bacteria | 2033 |
| 595 | nmdc:mga00v17_371262_c1 | 3300050491 | Unclassified | 930 |
| 596 | nmdc:mga0yw44_168720_c1 | 3300050492 | Unclassified | 1436 |
| 597 | nmdc:mga0yw44_268201_c1 | 3300050492 | Bacteria | 1139 |
| 598 | nmdc:mga0yw44_48431_c1 | 3300050492 | Bacteria | 2563 |
| 599 | nmdc:mga0yw44_968412_c1 | 3300050492 | Bacteria | 576 |
| 600 | nmdc:mga06z11_31534_c1 | 3300050494 | Bacteria | 2577 |
| 601 | nmdc:mga06z11_985534_c1 | 3300050494 | Bacteria | 514 |
| 602 | nmdc:mga04h51_4557_c1 | 3300050495 | Bacteria | 3462 |
| 603 | nmdc:mga07m45_154106_c1 | 3300050496 | Bacteria | 1333 |
| 604 | nmdc:mga07m45_50068_c1 | 3300050496 | Bacteria | 2028 |
| 605 | nmdc:mga07m45_775310_c1 | 3300050496 | Bacteria | 550 |
| 606 | nmdc:mga05p37_240199_c1 | 3300050507 | Bacteria | 2178 |
| 607 | nmdc:mga08y16_384306_c1 | 3300050511 | Bacteria | 1439 |
| 608 | nmdc:mga0n895_936446_c1 | 3300050512 | Bacteria | 850 |
| 609 | nmdc:mga0a205_200668_c1 | 3300050515 | Bacteria | 1885 |
| 610 | nmdc:mga0a205_31108_c1 | 3300050515 | Bacteria | 5111 |
| 611 | nmdc:mga0a205_498309_c1 | 3300050515 | Bacteria | 1075 |
| 612 | Ga0495601_0129184 | 3300053077 | Bacteria | 1645 |
| 613 | Ga0495595_0008217 | 3300053084 | Bacteria | 4284 |
| 614 | Ga0495619_0034868 | 3300053085 | Bacteria | 3272 |
| 615 | Ga0500616_0340502 | 3300053153 | Bacteria | 612 |
| 616 | Ga0501084_0067383 | 3300054114 | Bacteria | 2996 |
| 617 | Ga0501082_1393082 | 3300060353 | Bacteria | 612 |
| 618 | Ga0466962_0173384 | 3300061719 | Bacteria | 1051 |
| 619 | Ga0466962_0206352 | 3300061719 | Bacteria | 961 |
| 620 | Ga0530510_1016209 | 3300061734 | Bacteria | 635 |
| 621 | Ga0530510_1327490 | 3300061734 | Bacteria | 552 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006175 | Ga0070712_100107204 | Ga0070712_1001072041 | 95 |
| 2 | 3300005616 | Ga0068852_101448465 | Ga0068852_1014484652 | 96 |
| 3 | 3300006871 | Ga0075434_102514920 | Ga0075434_1025149202 | 96 |
| 4 | 3300013105 | Ga0157369_10407749 | Ga0157369_104077493 | 96 |
| 5 | 3300025919 | Ga0207657_10131428 | Ga0207657_101314282 | 96 |
| 6 | 3300025939 | Ga0207665_10710531 | Ga0207665_107105312 | 96 |
| 7 | 3300026142 | Ga0207698_11054926 | Ga0207698_110549262 | 96 |
| 8 | 3300035089 | Ga0373944_0091876 | Ga0373944_0091876_684_974 | 96 |
| 9 | 3300035695 | Ga0373927_0482375 | Ga0373927_0482375_58_348 | 96 |
| 10 | 3300042876 | Ga0451577_0046892 | Ga0451577_0046892_2679_2972 | 96 |
| 11 | 3300044673 | Ga0453683_0272124 | Ga0453683_0272124_182_475 | 96 |
| 12 | 3300044712 | Ga0453684_0441844 | Ga0453684_0441844_1138_1431 | 96 |
| 13 | 3300045051 | Ga0451576_0270649 | Ga0451576_0270649_295_588 | 96 |
| 14 | 3300045976 | Ga0466967_0282541 | Ga0466967_0282541_364_654 | 96 |
| 15 | 3300046455 | Ga0495603_0023464 | Ga0495603_0023464_3361_3651 | 96 |
| 16 | 3300046472 | Ga0495580_0286688 | Ga0495580_0286688_384_674 | 96 |
| 17 | 3300046473 | Ga0495582_0114704 | Ga0495582_0114704_259_549 | 96 |
| 18 | 3300047321 | Ga0495676_0167999 | Ga0495676_0167999_1068_1358 | 96 |
| 19 | 3300049569 | Ga0501032_0108123 | Ga0501032_0108123_783_1073 | 96 |
| 20 | 3300049570 | Ga0501033_0015707 | Ga0501033_0015707_1799_2089 | 96 |
| 21 | 3300049571 | Ga0501034_0115274 | Ga0501034_0115274_1871_2161 | 96 |
| 22 | 3300049572 | Ga0501036_0019994 | Ga0501036_0019994_2614_2904 | 96 |
| 23 | 3300049573 | Ga0501037_0039013 | Ga0501037_0039013_3062_3352 | 96 |
| 24 | 3300049574 | Ga0501038_0084213 | Ga0501038_0084213_643_933 | 96 |
| 25 | 3300049575 | Ga0501039_0206568 | Ga0501039_0206568_139_429 | 96 |
| 26 | 3300049578 | Ga0501042_0040893 | Ga0501042_0040893_2335_2625 | 96 |
| 27 | 3300049579 | Ga0501043_0062938 | Ga0501043_0062938_301_591 | 96 |
| 28 | 3300049580 | Ga0501046_0006359 | Ga0501046_0006359_8742_9032 | 96 |
| 29 | 3300049581 | Ga0501047_0336102 | Ga0501047_0336102_725_1015 | 96 |
| 30 | 3300049582 | Ga0501048_0059415 | Ga0501048_0059415_187_477 | 96 |
| 31 | 3300049586 | Ga0501070_0030530 | Ga0501070_0030530_11_301 | 96 |
| 32 | 3300049589 | Ga0501073_0036488 | Ga0501073_0036488_900_1190 | 96 |
| 33 | 3300049589 | Ga0501073_0712201 | Ga0501073_0712201_134_424 | 96 |
| 34 | 3300049744 | Ga0501083_0033679 | Ga0501083_0033679_1035_1325 | 96 |
| 35 | 3300049822 | Ga0501035_0522168 | Ga0501035_0522168_37_327 | 96 |
| 36 | 3300049823 | Ga0501044_0386704 | Ga0501044_0386704_254_544 | 96 |
| 37 | 3300005330 | Ga0070690_101006684 | Ga0070690_1010066841 | 97 |
| 38 | 3300005337 | Ga0070682_100037846 | Ga0070682_1000378463 | 97 |
| 39 | 3300005343 | Ga0070687_101027947 | Ga0070687_1010279472 | 97 |
| 40 | 3300005355 | Ga0070671_100662851 | Ga0070671_1006628512 | 97 |
| 41 | 3300005356 | Ga0070674_100012545 | Ga0070674_1000125453 | 97 |
| 42 | 3300005366 | Ga0070659_101000992 | Ga0070659_1010009921 | 97 |
| 43 | 3300005367 | Ga0070667_100073988 | Ga0070667_1000739882 | 97 |
| 44 | 3300005438 | Ga0070701_10056278 | Ga0070701_100562783 | 97 |
| 45 | 3300005440 | Ga0070705_100197918 | Ga0070705_1001979182 | 97 |
| 46 | 3300005455 | Ga0070663_100105229 | Ga0070663_1001052292 | 97 |
| 47 | 3300005456 | Ga0070678_100044415 | Ga0070678_1000444152 | 97 |
| 48 | 3300005544 | Ga0070686_100038896 | Ga0070686_1000388963 | 97 |
| 49 | 3300005546 | Ga0070696_100066090 | Ga0070696_1000660902 | 97 |
| 50 | 3300005547 | Ga0070693_100655205 | Ga0070693_1006552052 | 97 |
| 51 | 3300005548 | Ga0070665_100622851 | Ga0070665_1006228511 | 97 |
| 52 | 3300005718 | Ga0068866_10129586 | Ga0068866_101295861 | 97 |
| 53 | 3300005718 | Ga0068866_10211454 | Ga0068866_102114542 | 97 |
| 54 | 3300005840 | Ga0068870_10407609 | Ga0068870_104076092 | 97 |
| 55 | 3300005842 | Ga0068858_100432342 | Ga0068858_1004323422 | 97 |
| 56 | 3300005843 | Ga0068860_100013584 | Ga0068860_1000135844 | 97 |
| 57 | 3300006237 | Ga0097621_100081953 | Ga0097621_1000819532 | 97 |
| 58 | 3300006358 | Ga0068871_100030122 | Ga0068871_1000301224 | 97 |
| 59 | 3300006881 | Ga0068865_101829599 | Ga0068865_1018295991 | 97 |
| 60 | 3300009098 | Ga0105245_10134981 | Ga0105245_101349812 | 97 |
| 61 | 3300009101 | Ga0105247_10019530 | Ga0105247_100195301 | 97 |
| 62 | 3300009148 | Ga0105243_10154554 | Ga0105243_101545543 | 97 |
| 63 | 3300009148 | Ga0105243_11963380 | Ga0105243_119633802 | 97 |
| 64 | 3300009174 | Ga0105241_10643620 | Ga0105241_106436202 | 97 |
| 65 | 3300009176 | Ga0105242_10009004 | Ga0105242_100090044 | 97 |
| 66 | 3300009176 | Ga0105242_10654351 | Ga0105242_106543511 | 97 |
| 67 | 3300009177 | Ga0105248_10008393 | Ga0105248_100083938 | 97 |
| 68 | 3300011119 | Ga0105246_10259350 | Ga0105246_102593502 | 97 |
| 69 | 3300013297 | Ga0157378_10008117 | Ga0157378_100081175 | 97 |
| 70 | 3300013308 | Ga0157375_11194941 | Ga0157375_111949412 | 97 |
| 71 | 3300014968 | Ga0157379_10016605 | Ga0157379_100166054 | 97 |
| 72 | 3300014969 | Ga0157376_10086869 | Ga0157376_100868694 | 97 |
| 73 | 3300025899 | Ga0207642_10323145 | Ga0207642_103231451 | 97 |
| 74 | 3300025900 | Ga0207710_10495254 | Ga0207710_104952541 | 97 |
| 75 | 3300025905 | Ga0207685_10034466 | Ga0207685_100344662 | 97 |
| 76 | 3300025927 | Ga0207687_10510758 | Ga0207687_105107581 | 97 |
| 77 | 3300025931 | Ga0207644_10383277 | Ga0207644_103832772 | 97 |
| 78 | 3300025934 | Ga0207686_10172120 | Ga0207686_101721202 | 97 |
| 79 | 3300025935 | Ga0207709_10065528 | Ga0207709_100655283 | 97 |
| 80 | 3300025935 | Ga0207709_10572078 | Ga0207709_105720781 | 97 |
| 81 | 3300025937 | Ga0207669_10355514 | Ga0207669_103555142 | 97 |
| 82 | 3300025941 | Ga0207711_10079640 | Ga0207711_100796403 | 97 |
| 83 | 3300025986 | Ga0207658_10252637 | Ga0207658_102526372 | 97 |
| 84 | 3300026035 | Ga0207703_10188582 | Ga0207703_101885822 | 97 |
| 85 | 3300026121 | Ga0207683_10002107 | Ga0207683_100021076 | 97 |
| 86 | 3300028379 | Ga0268266_10593385 | Ga0268266_105933852 | 97 |
| 87 | 3300028381 | Ga0268264_10035483 | Ga0268264_100354834 | 97 |
| 88 | 3300037853 | Ga0436364_0628413 | Ga0436364_0628413_319_612 | 97 |
| 89 | 3300039437 | Ga0436365_0594382 | Ga0436365_0594382_15_308 | 97 |
| 90 | 3300044694 | Ga0466963_0437580 | Ga0466963_0437580_114_470 | 97 |
| 91 | 3300044735 | Ga0466968_0285935 | Ga0466968_0285935_230_586 | 97 |
| 92 | 3300044765 | Ga0466970_0209448 | Ga0466970_0209448_579_935 | 97 |
| 93 | 3300044842 | Ga0466957_0090342 | Ga0466957_0090342_1002_1358 | 97 |
| 94 | 3300045049 | Ga0466959_0168244 | Ga0466959_0168244_466_759 | 97 |
| 95 | 3300048903 | Ga0496100_0019499 | Ga0496100_0019499_1083_1376 | 97 |
| 96 | 3300048904 | Ga0496101_0012843 | Ga0496101_0012843_390_683 | 97 |
| 97 | 3300048905 | Ga0496102_0019630 | Ga0496102_0019630_4003_4296 | 97 |
| 98 | 3300048906 | Ga0496103_0010453 | Ga0496103_0010453_3884_4177 | 97 |
| 99 | 3300048907 | Ga0496104_0005625 | Ga0496104_0005625_5125_5418 | 97 |
| 100 | 3300048908 | Ga0496105_0205147 | Ga0496105_0205147_928_1221 | 97 |
| 101 | 3300048909 | Ga0496106_0005055 | Ga0496106_0005055_5336_5629 | 97 |
| 102 | 3300048910 | Ga0496107_0050246 | Ga0496107_0050246_1650_1943 | 97 |
| 103 | 3300048911 | Ga0496108_0890852 | Ga0496108_0890852_18_311 | 97 |
| 104 | 3300048917 | Ga0496114_0004765 | Ga0496114_0004765_6220_6513 | 97 |
| 105 | 3300048918 | Ga0496115_0281595 | Ga0496115_0281595_409_702 | 97 |
| 106 | 3300053153 | Ga0500616_0340502 | Ga0500616_0340502_61_354 | 97 |
| 107 | 2088090003 | LJN_F6ESG4R02JSG9I | LJN_03324960 | 98 |
| 108 | 3300005327 | Ga0070658_10896260 | Ga0070658_108962601 | 98 |
| 109 | 3300005329 | Ga0070683_100567868 | Ga0070683_1005678682 | 98 |
| 110 | 3300005331 | Ga0070670_101901603 | Ga0070670_1019016031 | 98 |
| 111 | 3300005335 | Ga0070666_10035692 | Ga0070666_100356922 | 98 |
| 112 | 3300005336 | Ga0070680_101226823 | Ga0070680_1012268231 | 98 |
| 113 | 3300005337 | Ga0070682_101856062 | Ga0070682_1018560621 | 98 |
| 114 | 3300005338 | Ga0068868_100113021 | Ga0068868_1001130212 | 98 |
| 115 | 3300005338 | Ga0068868_100483819 | Ga0068868_1004838192 | 98 |
| 116 | 3300005341 | Ga0070691_10338715 | Ga0070691_103387151 | 98 |
| 117 | 3300005347 | Ga0070668_100617242 | Ga0070668_1006172422 | 98 |
| 118 | 3300005355 | Ga0070671_100215902 | Ga0070671_1002159022 | 98 |
| 119 | 3300005355 | Ga0070671_100402560 | Ga0070671_1004025602 | 98 |
| 120 | 3300005356 | Ga0070674_100007347 | Ga0070674_1000073477 | 98 |
| 121 | 3300005356 | Ga0070674_100848830 | Ga0070674_1008488301 | 98 |
| 122 | 3300005356 | Ga0070674_101151418 | Ga0070674_1011514181 | 98 |
| 123 | 3300005356 | Ga0070674_101497247 | Ga0070674_1014972471 | 98 |
| 124 | 3300005356 | Ga0070674_101552457 | Ga0070674_1015524571 | 98 |
| 125 | 3300005365 | Ga0070688_101517274 | Ga0070688_1015172741 | 98 |
| 126 | 3300005366 | Ga0070659_101483576 | Ga0070659_1014835762 | 98 |
| 127 | 3300005367 | Ga0070667_100200590 | Ga0070667_1002005902 | 98 |
| 128 | 3300005434 | Ga0070709_10867346 | Ga0070709_108673461 | 98 |
| 129 | 3300005434 | Ga0070709_11150924 | Ga0070709_111509242 | 98 |
| 130 | 3300005435 | Ga0070714_100028433 | Ga0070714_1000284334 | 98 |
| 131 | 3300005435 | Ga0070714_100579240 | Ga0070714_1005792402 | 98 |
| 132 | 3300005435 | Ga0070714_100796963 | Ga0070714_1007969632 | 98 |
| 133 | 3300005435 | Ga0070714_100812223 | Ga0070714_1008122233 | 98 |
| 134 | 3300005435 | Ga0070714_101616987 | Ga0070714_1016169871 | 98 |
| 135 | 3300005435 | Ga0070714_101622502 | Ga0070714_1016225022 | 98 |
| 136 | 3300005436 | Ga0070713_100042390 | Ga0070713_1000423902 | 98 |
| 137 | 3300005436 | Ga0070713_100182480 | Ga0070713_1001824803 | 98 |
| 138 | 3300005437 | Ga0070710_10008592 | Ga0070710_100085922 | 98 |
| 139 | 3300005437 | Ga0070710_10075568 | Ga0070710_100755682 | 98 |
| 140 | 3300005437 | Ga0070710_10543528 | Ga0070710_105435282 | 98 |
| 141 | 3300005439 | Ga0070711_100440512 | Ga0070711_1004405122 | 98 |
| 142 | 3300005444 | Ga0070694_101859312 | Ga0070694_1018593121 | 98 |
| 143 | 3300005455 | Ga0070663_100000561 | Ga0070663_1000005617 | 98 |
| 144 | 3300005455 | Ga0070663_100589433 | Ga0070663_1005894332 | 98 |
| 145 | 3300005457 | Ga0070662_101022731 | Ga0070662_1010227311 | 98 |
| 146 | 3300005458 | Ga0070681_11007264 | Ga0070681_110072641 | 98 |
| 147 | 3300005459 | Ga0068867_100139113 | Ga0068867_1001391134 | 98 |
| 148 | 3300005459 | Ga0068867_100944010 | Ga0068867_1009440101 | 98 |
| 149 | 3300005459 | Ga0068867_101827571 | Ga0068867_1018275711 | 98 |
| 150 | 3300005466 | Ga0070685_11237958 | Ga0070685_112379581 | 98 |
| 151 | 3300005530 | Ga0070679_100004461 | Ga0070679_1000044615 | 98 |
| 152 | 3300005530 | Ga0070679_100862002 | Ga0070679_1008620022 | 98 |
| 153 | 3300005535 | Ga0070684_100054948 | Ga0070684_1000549482 | 98 |
| 154 | 3300005535 | Ga0070684_100396419 | Ga0070684_1003964192 | 98 |
| 155 | 3300005535 | Ga0070684_101069068 | Ga0070684_1010690682 | 98 |
| 156 | 3300005536 | Ga0070697_100625363 | Ga0070697_1006253632 | 98 |
| 157 | 3300005545 | Ga0070695_101147003 | Ga0070695_1011470031 | 98 |
| 158 | 3300005545 | Ga0070695_101490415 | Ga0070695_1014904152 | 98 |
| 159 | 3300005547 | Ga0070693_101501770 | Ga0070693_1015017701 | 98 |
| 160 | 3300005548 | Ga0070665_100018684 | Ga0070665_1000186846 | 98 |
| 161 | 3300005548 | Ga0070665_101697504 | Ga0070665_1016975041 | 98 |
| 162 | 3300005549 | Ga0070704_100323439 | Ga0070704_1003234392 | 98 |
| 163 | 3300005549 | Ga0070704_100793229 | Ga0070704_1007932291 | 98 |
| 164 | 3300005549 | Ga0070704_101818084 | Ga0070704_1018180841 | 98 |
| 165 | 3300005564 | Ga0070664_100511837 | Ga0070664_1005118371 | 98 |
| 166 | 3300005614 | Ga0068856_100016851 | Ga0068856_10001685110 | 98 |
| 167 | 3300005614 | Ga0068856_100080843 | Ga0068856_1000808432 | 98 |
| 168 | 3300005614 | Ga0068856_100318175 | Ga0068856_1003181752 | 98 |
| 169 | 3300005614 | Ga0068856_102248985 | Ga0068856_1022489851 | 98 |
| 170 | 3300005615 | Ga0070702_100243491 | Ga0070702_1002434913 | 98 |
| 171 | 3300005615 | Ga0070702_100416322 | Ga0070702_1004163222 | 98 |
| 172 | 3300005618 | Ga0068864_101276731 | Ga0068864_1012767311 | 98 |
| 173 | 3300005718 | Ga0068866_10432854 | Ga0068866_104328542 | 98 |
| 174 | 3300005719 | Ga0068861_100302437 | Ga0068861_1003024372 | 98 |
| 175 | 3300005719 | Ga0068861_100561039 | Ga0068861_1005610392 | 98 |
| 176 | 3300005842 | Ga0068858_100700079 | Ga0068858_1007000793 | 98 |
| 177 | 3300005844 | Ga0068862_100404588 | Ga0068862_1004045882 | 98 |
| 178 | 3300005937 | Ga0081455_10016609 | Ga0081455_100166094 | 98 |
| 179 | 3300005937 | Ga0081455_10018501 | Ga0081455_100185016 | 98 |
| 180 | 3300005937 | Ga0081455_10158928 | Ga0081455_101589283 | 98 |
| 181 | 3300005937 | Ga0081455_10266822 | Ga0081455_102668222 | 98 |
| 182 | 3300005937 | Ga0081455_10563808 | Ga0081455_105638082 | 98 |
| 183 | 3300005937 | Ga0081455_10743111 | Ga0081455_107431111 | 98 |
| 184 | 3300005981 | Ga0081538_10172051 | Ga0081538_101720512 | 98 |
| 185 | 3300005983 | Ga0081540_1015884 | Ga0081540_10158842 | 98 |
| 186 | 3300006028 | Ga0070717_10008889 | Ga0070717_100088895 | 98 |
| 187 | 3300006028 | Ga0070717_10022321 | Ga0070717_100223214 | 98 |
| 188 | 3300006028 | Ga0070717_10058864 | Ga0070717_100588641 | 98 |
| 189 | 3300006028 | Ga0070717_10404454 | Ga0070717_104044542 | 98 |
| 190 | 3300006028 | Ga0070717_10917421 | Ga0070717_109174211 | 98 |
| 191 | 3300006038 | Ga0075365_10041987 | Ga0075365_100419873 | 98 |
| 192 | 3300006038 | Ga0075365_10329318 | Ga0075365_103293182 | 98 |
| 193 | 3300006038 | Ga0075365_11040510 | Ga0075365_110405102 | 98 |
| 194 | 3300006038 | Ga0075365_11216966 | Ga0075365_112169662 | 98 |
| 195 | 3300006042 | Ga0075368_10015109 | Ga0075368_100151093 | 98 |
| 196 | 3300006048 | Ga0075363_100054107 | Ga0075363_1000541073 | 98 |
| 197 | 3300006048 | Ga0075363_100888179 | Ga0075363_1008881792 | 98 |
| 198 | 3300006051 | Ga0075364_10037975 | Ga0075364_100379753 | 98 |
| 199 | 3300006051 | Ga0075364_10421481 | Ga0075364_104214811 | 98 |
| 200 | 3300006058 | Ga0075432_10159955 | Ga0075432_101599552 | 98 |
| 201 | 3300006058 | Ga0075432_10409593 | Ga0075432_104095931 | 98 |
| 202 | 3300006163 | Ga0070715_10055136 | Ga0070715_100551362 | 98 |
| 203 | 3300006173 | Ga0070716_100358353 | Ga0070716_1003583532 | 98 |
| 204 | 3300006173 | Ga0070716_100411904 | Ga0070716_1004119042 | 98 |
| 205 | 3300006175 | Ga0070712_100019883 | Ga0070712_1000198833 | 98 |
| 206 | 3300006175 | Ga0070712_100053110 | Ga0070712_1000531102 | 98 |
| 207 | 3300006175 | Ga0070712_100857199 | Ga0070712_1008571992 | 98 |
| 208 | 3300006177 | Ga0075362_10346055 | Ga0075362_103460552 | 98 |
| 209 | 3300006178 | Ga0075367_10114010 | Ga0075367_101140102 | 98 |
| 210 | 3300006353 | Ga0075370_10006851 | Ga0075370_100068513 | 98 |
| 211 | 3300006353 | Ga0075370_10063009 | Ga0075370_100630095 | 98 |
| 212 | 3300006358 | Ga0068871_102206893 | Ga0068871_1022068931 | 98 |
| 213 | 3300006844 | Ga0075428_100084060 | Ga0075428_1000840605 | 98 |
| 214 | 3300006847 | Ga0075431_100124751 | Ga0075431_1001247514 | 98 |
| 215 | 3300006852 | Ga0075433_10086386 | Ga0075433_100863862 | 98 |
| 216 | 3300006852 | Ga0075433_10428891 | Ga0075433_104288912 | 98 |
| 217 | 3300006852 | Ga0075433_11388620 | Ga0075433_113886202 | 98 |
| 218 | 3300006871 | Ga0075434_101100645 | Ga0075434_1011006452 | 98 |
| 219 | 3300006871 | Ga0075434_102078258 | Ga0075434_1020782581 | 98 |
| 220 | 3300006871 | Ga0075434_102431525 | Ga0075434_1024315251 | 98 |
| 221 | 3300006881 | Ga0068865_100418590 | Ga0068865_1004185902 | 98 |
| 222 | 3300009093 | Ga0105240_11305882 | Ga0105240_113058821 | 98 |
| 223 | 3300009094 | Ga0111539_10025165 | Ga0111539_100251655 | 98 |
| 224 | 3300009094 | Ga0111539_12973290 | Ga0111539_129732902 | 98 |
| 225 | 3300009094 | Ga0111539_13146438 | Ga0111539_131464382 | 98 |
| 226 | 3300009098 | Ga0105245_10698838 | Ga0105245_106988382 | 98 |
| 227 | 3300009098 | Ga0105245_10972604 | Ga0105245_109726042 | 98 |
| 228 | 3300009098 | Ga0105245_11403147 | Ga0105245_114031472 | 98 |
| 229 | 3300009147 | Ga0114129_10978759 | Ga0114129_109787592 | 98 |
| 230 | 3300009147 | Ga0114129_11062333 | Ga0114129_110623332 | 98 |
| 231 | 3300009148 | Ga0105243_10049261 | Ga0105243_100492613 | 98 |
| 232 | 3300009148 | Ga0105243_10165959 | Ga0105243_101659594 | 98 |
| 233 | 3300009148 | Ga0105243_10181701 | Ga0105243_101817012 | 98 |
| 234 | 3300009148 | Ga0105243_10867577 | Ga0105243_108675771 | 98 |
| 235 | 3300009174 | Ga0105241_10174144 | Ga0105241_101741442 | 98 |
| 236 | 3300009174 | Ga0105241_10933515 | Ga0105241_109335151 | 98 |
| 237 | 3300009174 | Ga0105241_11730174 | Ga0105241_117301741 | 98 |
| 238 | 3300009177 | Ga0105248_10891150 | Ga0105248_108911501 | 98 |
| 239 | 3300009177 | Ga0105248_11605813 | Ga0105248_116058132 | 98 |
| 240 | 3300009545 | Ga0105237_10114454 | Ga0105237_101144542 | 98 |
| 241 | 3300009551 | Ga0105238_10527352 | Ga0105238_105273523 | 98 |
| 242 | 3300009551 | Ga0105238_11504732 | Ga0105238_115047322 | 98 |
| 243 | 3300009551 | Ga0105238_12989252 | Ga0105238_129892521 | 98 |
| 244 | 3300009553 | Ga0105249_12724817 | Ga0105249_127248172 | 98 |
| 245 | 3300010375 | Ga0105239_11350362 | Ga0105239_113503622 | 98 |
| 246 | 3300010375 | Ga0105239_12104727 | Ga0105239_121047271 | 98 |
| 247 | 3300011119 | Ga0105246_10077154 | Ga0105246_100771543 | 98 |
| 248 | 3300011119 | Ga0105246_10662012 | Ga0105246_106620122 | 98 |
| 249 | 3300012502 | Ga0157347_1032871 | Ga0157347_10328712 | 98 |
| 250 | 3300012505 | Ga0157339_1016172 | Ga0157339_10161722 | 98 |
| 251 | 3300013102 | Ga0157371_10602429 | Ga0157371_106024292 | 98 |
| 252 | 3300013105 | Ga0157369_10808903 | Ga0157369_108089032 | 98 |
| 253 | 3300013297 | Ga0157378_10904787 | Ga0157378_109047872 | 98 |
| 254 | 3300013297 | Ga0157378_10945804 | Ga0157378_109458042 | 98 |
| 255 | 3300013306 | Ga0163162_10862862 | Ga0163162_108628622 | 98 |
| 256 | 3300013306 | Ga0163162_11102478 | Ga0163162_111024782 | 98 |
| 257 | 3300013306 | Ga0163162_11984395 | Ga0163162_119843951 | 98 |
| 258 | 3300013307 | Ga0157372_10359812 | Ga0157372_103598122 | 98 |
| 259 | 3300013307 | Ga0157372_11025778 | Ga0157372_110257781 | 98 |
| 260 | 3300013307 | Ga0157372_12041665 | Ga0157372_120416652 | 98 |
| 261 | 3300013307 | Ga0157372_12835072 | Ga0157372_128350721 | 98 |
| 262 | 3300014325 | Ga0163163_10112580 | Ga0163163_101125801 | 98 |
| 263 | 3300014325 | Ga0163163_10121719 | Ga0163163_101217193 | 98 |
| 264 | 3300014968 | Ga0157379_10871285 | Ga0157379_108712852 | 98 |
| 265 | 3300014969 | Ga0157376_11735795 | Ga0157376_117357952 | 98 |
| 266 | 3300017792 | Ga0163161_10379575 | Ga0163161_103795752 | 98 |
| 267 | 3300020069 | Ga0197907_11174359 | Ga0197907_111743591 | 98 |
| 268 | 3300020070 | Ga0206356_10745467 | Ga0206356_107454671 | 98 |
| 269 | 3300020070 | Ga0206356_11239141 | Ga0206356_112391412 | 98 |
| 270 | 3300020081 | Ga0206354_11350515 | Ga0206354_113505151 | 98 |
| 271 | 3300020082 | Ga0206353_10815935 | Ga0206353_108159352 | 98 |
| 272 | 3300021358 | Ga0213873_10138043 | Ga0213873_101380432 | 98 |
| 273 | 3300021384 | Ga0213876_10133847 | Ga0213876_101338472 | 98 |
| 274 | 3300021388 | Ga0213875_10338456 | Ga0213875_103384562 | 98 |
| 275 | 3300022467 | Ga0224712_10600980 | Ga0224712_106009802 | 98 |
| 276 | 3300025899 | Ga0207642_10348492 | Ga0207642_103484922 | 98 |
| 277 | 3300025903 | Ga0207680_10004937 | Ga0207680_100049375 | 98 |
| 278 | 3300025905 | Ga0207685_10034081 | Ga0207685_100340812 | 98 |
| 279 | 3300025906 | Ga0207699_10058901 | Ga0207699_100589012 | 98 |
| 280 | 3300025906 | Ga0207699_11269050 | Ga0207699_112690501 | 98 |
| 281 | 3300025911 | Ga0207654_10238566 | Ga0207654_102385661 | 98 |
| 282 | 3300025911 | Ga0207654_11159346 | Ga0207654_111593461 | 98 |
| 283 | 3300025915 | Ga0207693_10008842 | Ga0207693_100088422 | 98 |
| 284 | 3300025915 | Ga0207693_10158900 | Ga0207693_101589002 | 98 |
| 285 | 3300025915 | Ga0207693_10266857 | Ga0207693_102668572 | 98 |
| 286 | 3300025915 | Ga0207693_10357643 | Ga0207693_103576432 | 98 |
| 287 | 3300025917 | Ga0207660_10930171 | Ga0207660_109301712 | 98 |
| 288 | 3300025920 | Ga0207649_11298425 | Ga0207649_112984251 | 98 |
| 289 | 3300025921 | Ga0207652_10000866 | Ga0207652_100008665 | 98 |
| 290 | 3300025921 | Ga0207652_10553086 | Ga0207652_105530862 | 98 |
| 291 | 3300025924 | Ga0207694_10331169 | Ga0207694_103311692 | 98 |
| 292 | 3300025927 | Ga0207687_10865815 | Ga0207687_108658152 | 98 |
| 293 | 3300025927 | Ga0207687_10988519 | Ga0207687_109885192 | 98 |
| 294 | 3300025928 | Ga0207700_10182565 | Ga0207700_101825652 | 98 |
| 295 | 3300025929 | Ga0207664_10102438 | Ga0207664_101024382 | 98 |
| 296 | 3300025929 | Ga0207664_10134819 | Ga0207664_101348193 | 98 |
| 297 | 3300025929 | Ga0207664_11340404 | Ga0207664_113404042 | 98 |
| 298 | 3300025929 | Ga0207664_11427447 | Ga0207664_114274471 | 98 |
| 299 | 3300025931 | Ga0207644_10144207 | Ga0207644_101442072 | 98 |
| 300 | 3300025932 | Ga0207690_10596025 | Ga0207690_105960252 | 98 |
| 301 | 3300025932 | Ga0207690_11273278 | Ga0207690_112732781 | 98 |
| 302 | 3300025933 | Ga0207706_10331948 | Ga0207706_103319482 | 98 |
| 303 | 3300025933 | Ga0207706_10790646 | Ga0207706_107906462 | 98 |
| 304 | 3300025934 | Ga0207686_10585839 | Ga0207686_105858391 | 98 |
| 305 | 3300025935 | Ga0207709_10054219 | Ga0207709_100542192 | 98 |
| 306 | 3300025935 | Ga0207709_10072431 | Ga0207709_100724312 | 98 |
| 307 | 3300025935 | Ga0207709_10274557 | Ga0207709_102745572 | 98 |
| 308 | 3300025937 | Ga0207669_10002481 | Ga0207669_100024819 | 98 |
| 309 | 3300025937 | Ga0207669_10462153 | Ga0207669_104621532 | 98 |
| 310 | 3300025937 | Ga0207669_11180408 | Ga0207669_111804082 | 98 |
| 311 | 3300025938 | Ga0207704_11069149 | Ga0207704_110691492 | 98 |
| 312 | 3300025939 | Ga0207665_10665294 | Ga0207665_106652942 | 98 |
| 313 | 3300025939 | Ga0207665_10747103 | Ga0207665_107471032 | 98 |
| 314 | 3300025941 | Ga0207711_11878101 | Ga0207711_118781012 | 98 |
| 315 | 3300025945 | Ga0207679_10401523 | Ga0207679_104015232 | 98 |
| 316 | 3300025972 | Ga0207668_10841668 | Ga0207668_108416682 | 98 |
| 317 | 3300025972 | Ga0207668_11028914 | Ga0207668_110289142 | 98 |
| 318 | 3300025981 | Ga0207640_11478518 | Ga0207640_114785181 | 98 |
| 319 | 3300025986 | Ga0207658_10009795 | Ga0207658_100097953 | 98 |
| 320 | 3300026023 | Ga0207677_10025348 | Ga0207677_100253482 | 98 |
| 321 | 3300026023 | Ga0207677_10189912 | Ga0207677_101899122 | 98 |
| 322 | 3300026023 | Ga0207677_10810312 | Ga0207677_108103121 | 98 |
| 323 | 3300026067 | Ga0207678_10003026 | Ga0207678_100030267 | 98 |
| 324 | 3300026067 | Ga0207678_10098405 | Ga0207678_100984053 | 98 |
| 325 | 3300026075 | Ga0207708_10339995 | Ga0207708_103399953 | 98 |
| 326 | 3300026078 | Ga0207702_10012731 | Ga0207702_100127312 | 98 |
| 327 | 3300026078 | Ga0207702_10060560 | Ga0207702_100605602 | 98 |
| 328 | 3300026078 | Ga0207702_10784194 | Ga0207702_107841942 | 98 |
| 329 | 3300026078 | Ga0207702_11292178 | Ga0207702_112921782 | 98 |
| 330 | 3300026088 | Ga0207641_10930826 | Ga0207641_109308261 | 98 |
| 331 | 3300026089 | Ga0207648_10123367 | Ga0207648_101233674 | 98 |
| 332 | 3300026089 | Ga0207648_10476136 | Ga0207648_104761362 | 98 |
| 333 | 3300026089 | Ga0207648_11447474 | Ga0207648_114474741 | 98 |
| 334 | 3300026095 | Ga0207676_10963910 | Ga0207676_109639102 | 98 |
| 335 | 3300026118 | Ga0207675_100447136 | Ga0207675_1004471363 | 98 |
| 336 | 3300026118 | Ga0207675_100522764 | Ga0207675_1005227642 | 98 |
| 337 | 3300026118 | Ga0207675_102160583 | Ga0207675_1021605832 | 98 |
| 338 | 3300027866 | Ga0209813_10031659 | Ga0209813_100316592 | 98 |
| 339 | 3300027907 | Ga0207428_10981604 | Ga0207428_109816042 | 98 |
| 340 | 3300028379 | Ga0268266_10000775 | Ga0268266_1000077531 | 98 |
| 341 | 3300028380 | Ga0268265_10627075 | Ga0268265_106270751 | 98 |
| 342 | 3300028380 | Ga0268265_11795091 | Ga0268265_117950911 | 98 |
| 343 | 3300028573 | Ga0265334_10130780 | Ga0265334_101307802 | 98 |
| 344 | 3300028800 | Ga0265338_11187061 | Ga0265338_111870612 | 98 |
| 345 | 3300031548 | Ga0307408_100446462 | Ga0307408_1004464622 | 98 |
| 346 | 3300031824 | Ga0307413_10481867 | Ga0307413_104818672 | 98 |
| 347 | 3300031901 | Ga0307406_11516045 | Ga0307406_115160451 | 98 |
| 348 | 3300031995 | Ga0307409_100361637 | Ga0307409_1003616371 | 98 |
| 349 | 3300031995 | Ga0307409_100982783 | Ga0307409_1009827831 | 98 |
| 350 | 3300032002 | Ga0307416_100825380 | Ga0307416_1008253802 | 98 |
| 351 | 3300032002 | Ga0307416_102719405 | Ga0307416_1027194051 | 98 |
| 352 | 3300035083 | Ga0373926_0411398 | Ga0373926_0411398_10_306 | 98 |
| 353 | 3300035092 | Ga0373952_0180330 | Ga0373952_0180330_18_314 | 98 |
| 354 | 3300035111 | Ga0373923_0625871 | Ga0373923_0625871_202_498 | 98 |
| 355 | 3300035114 | Ga0373939_0440606 | Ga0373939_0440606_95_391 | 98 |
| 356 | 3300035117 | Ga0373953_0387445 | Ga0373953_0387445_220_516 | 98 |
| 357 | 3300035118 | Ga0373954_0647299 | Ga0373954_0647299_34_330 | 98 |
| 358 | 3300035119 | Ga0373956_0383036 | Ga0373956_0383036_126_422 | 98 |
| 359 | 3300035121 | Ga0373960_0068950 | Ga0373960_0068950_544_840 | 98 |
| 360 | 3300035170 | Ga0373943_0493588 | Ga0373943_0493588_237_533 | 98 |
| 361 | 3300035241 | Ga0373961_0257817 | Ga0373961_0257817_143_439 | 98 |
| 362 | 3300035241 | Ga0373961_0326244 | Ga0373961_0326244_170_466 | 98 |
| 363 | 3300035691 | Ga0373931_0645228 | Ga0373931_0645228_291_587 | 98 |
| 364 | 3300035692 | Ga0373935_0116189 | Ga0373935_0116189_70_366 | 98 |
| 365 | 3300035692 | Ga0373935_0328393 | Ga0373935_0328393_709_1005 | 98 |
| 366 | 3300035724 | Ga0373933_0033222 | Ga0373933_0033222_628_924 | 98 |
| 367 | 3300035725 | Ga0373947_0373456 | Ga0373947_0373456_212_508 | 98 |
| 368 | 3300036401 | Ga0373937_0028286 | Ga0373937_0028286_4667_4963 | 98 |
| 369 | 3300037068 | Ga0373925_0378536 | Ga0373925_0378536_729_1025 | 98 |
| 370 | 3300037068 | Ga0373925_1214529 | Ga0373925_1214529_21_317 | 98 |
| 371 | 3300037068 | Ga0373925_1520396 | Ga0373925_1520396_151_447 | 98 |
| 372 | 3300037312 | Ga0395899_0389522 | Ga0395899_0389522_446_742 | 98 |
| 373 | 3300037418 | Ga0395900_0429449 | Ga0395900_0429449_342_641 | 98 |
| 374 | 3300037418 | Ga0395900_0977891 | Ga0395900_0977891_426_722 | 98 |
| 375 | 3300037466 | Ga0395898_0057118 | Ga0395898_0057118_175_471 | 98 |
| 376 | 3300037466 | Ga0395898_0107817 | Ga0395898_0107817_1450_1788 | 98 |
| 377 | 3300037466 | Ga0395898_0287397 | Ga0395898_0287397_283_579 | 98 |
| 378 | 3300037466 | Ga0395898_0589972 | Ga0395898_0589972_418_714 | 98 |
| 379 | 3300037471 | Ga0395905_0019511 | Ga0395905_0019511_455_751 | 98 |
| 380 | 3300037471 | Ga0395905_1583094 | Ga0395905_1583094_195_491 | 98 |
| 381 | 3300037853 | Ga0436364_0518932 | Ga0436364_0518932_1024_1320 | 98 |
| 382 | 3300037853 | Ga0436364_0971376 | Ga0436364_0971376_1846_2142 | 98 |
| 383 | 3300037853 | Ga0436364_1132559 | Ga0436364_1132559_355_651 | 98 |
| 384 | 3300038443 | Ga0395901_0026716 | Ga0395901_0026716_2143_2481 | 98 |
| 385 | 3300038443 | Ga0395901_0062441 | Ga0395901_0062441_2614_2910 | 98 |
| 386 | 3300038443 | Ga0395901_0088875 | Ga0395901_0088875_228_524 | 98 |
| 387 | 3300038443 | Ga0395901_0291393 | Ga0395901_0291393_1254_1550 | 98 |
| 388 | 3300038443 | Ga0395901_0379495 | Ga0395901_0379495_53_352 | 98 |
| 389 | 3300038443 | Ga0395901_0449701 | Ga0395901_0449701_720_1016 | 98 |
| 390 | 3300038443 | Ga0395901_1128038 | Ga0395901_1128038_288_584 | 98 |
| 391 | 3300038443 | Ga0395901_1890213 | Ga0395901_1890213_186_482 | 98 |
| 392 | 3300039437 | Ga0436365_0711155 | Ga0436365_0711155_1241_1537 | 98 |
| 393 | 3300039453 | Ga0436362_1250915 | Ga0436362_1250915_897_1193 | 98 |
| 394 | 3300041443 | Ga0451789_0713917 | Ga0451789_0713917_214_510 | 98 |
| 395 | 3300041463 | Ga0451804_0947887 | Ga0451804_0947887_156_461 | 98 |
| 396 | 3300041486 | Ga0451807_2432494 | Ga0451807_2432494_843_1139 | 98 |
| 397 | 3300041496 | Ga0451839_1634149 | Ga0451839_1634149_187_492 | 98 |
| 398 | 3300041507 | Ga0451851_0272330 | Ga0451851_0272330_118_441 | 98 |
| 399 | 3300041512 | Ga0451853_0814883 | Ga0451853_0814883_3041_3346 | 98 |
| 400 | 3300044693 | Ga0466961_0204364 | Ga0466961_0204364_605_901 | 98 |
| 401 | 3300044693 | Ga0466961_0265557 | Ga0466961_0265557_176_472 | 98 |
| 402 | 3300044693 | Ga0466961_0824584 | Ga0466961_0824584_95_391 | 98 |
| 403 | 3300044694 | Ga0466963_0015355 | Ga0466963_0015355_2248_2547 | 98 |
| 404 | 3300044694 | Ga0466963_0185292 | Ga0466963_0185292_897_1193 | 98 |
| 405 | 3300044694 | Ga0466963_0256456 | Ga0466963_0256456_869_1165 | 98 |
| 406 | 3300044694 | Ga0466963_0330163 | Ga0466963_0330163_296_592 | 98 |
| 407 | 3300044694 | Ga0466963_0360962 | Ga0466963_0360962_555_851 | 98 |
| 408 | 3300044694 | Ga0466963_0401049 | Ga0466963_0401049_624_920 | 98 |
| 409 | 3300044694 | Ga0466963_0505582 | Ga0466963_0505582_500_808 | 98 |
| 410 | 3300044694 | Ga0466963_0679354 | Ga0466963_0679354_25_321 | 98 |
| 411 | 3300044694 | Ga0466963_1128325 | Ga0466963_1128325_39_389 | 98 |
| 412 | 3300044706 | Ga0466964_0287152 | Ga0466964_0287152_222_518 | 98 |
| 413 | 3300044706 | Ga0466964_0377431 | Ga0466964_0377431_34_330 | 98 |
| 414 | 3300044706 | Ga0466964_0505366 | Ga0466964_0505366_21_344 | 98 |
| 415 | 3300044719 | Ga0466971_0176365 | Ga0466971_0176365_16_312 | 98 |
| 416 | 3300044735 | Ga0466968_0711257 | Ga0466968_0711257_88_384 | 98 |
| 417 | 3300044842 | Ga0466957_0037571 | Ga0466957_0037571_2234_2533 | 98 |
| 418 | 3300044901 | Ga0466960_0000034 | Ga0466960_0000034_25653_25955 | 98 |
| 419 | 3300044901 | Ga0466960_0276459 | Ga0466960_0276459_512_808 | 98 |
| 420 | 3300044901 | Ga0466960_0414930 | Ga0466960_0414930_376_678 | 98 |
| 421 | 3300045836 | Ga0466958_0036647 | Ga0466958_0036647_661_957 | 98 |
| 422 | 3300045836 | Ga0466958_0251636 | Ga0466958_0251636_260_559 | 98 |
| 423 | 3300045836 | Ga0466958_0603112 | Ga0466958_0603112_300_596 | 98 |
| 424 | 3300045836 | Ga0466958_0627333 | Ga0466958_0627333_373_669 | 98 |
| 425 | 3300045836 | Ga0466958_0950113 | Ga0466958_0950113_226_522 | 98 |
| 426 | 3300045976 | Ga0466967_0030197 | Ga0466967_0030197_1483_1806 | 98 |
| 427 | 3300045976 | Ga0466967_0050345 | Ga0466967_0050345_1595_1894 | 98 |
| 428 | 3300045976 | Ga0466967_0627868 | Ga0466967_0627868_310_606 | 98 |
| 429 | 3300045976 | Ga0466967_0945713 | Ga0466967_0945713_479_775 | 98 |
| 430 | 3300045976 | Ga0466967_1140279 | Ga0466967_1140279_206_502 | 98 |
| 431 | 3300045976 | Ga0466967_1503804 | Ga0466967_1503804_280_576 | 98 |
| 432 | 3300045976 | Ga0466967_1813416 | Ga0466967_1813416_201_497 | 98 |
| 433 | 3300046453 | Ga0495627_148095 | Ga0495627_148095_330_635 | 98 |
| 434 | 3300046454 | Ga0495592_0741822 | Ga0495592_0741822_258_554 | 98 |
| 435 | 3300046455 | Ga0495603_0108912 | Ga0495603_0108912_434_730 | 98 |
| 436 | 3300046459 | Ga0495629_0257146 | Ga0495629_0257146_562_858 | 98 |
| 437 | 3300046459 | Ga0495629_0322108 | Ga0495629_0322108_228_524 | 98 |
| 438 | 3300046461 | Ga0495641_0002764 | Ga0495641_0002764_6059_6355 | 98 |
| 439 | 3300046461 | Ga0495641_0043612 | Ga0495641_0043612_539_835 | 98 |
| 440 | 3300046461 | Ga0495641_0044742 | Ga0495641_0044742_1114_1410 | 98 |
| 441 | 3300046461 | Ga0495641_0073484 | Ga0495641_0073484_746_1042 | 98 |
| 442 | 3300046462 | Ga0495651_0003797 | Ga0495651_0003797_4681_4977 | 98 |
| 443 | 3300046462 | Ga0495651_0678751 | Ga0495651_0678751_164_460 | 98 |
| 444 | 3300046463 | Ga0495653_0008194 | Ga0495653_0008194_2006_2302 | 98 |
| 445 | 3300046463 | Ga0495653_0513845 | Ga0495653_0513845_207_503 | 98 |
| 446 | 3300046473 | Ga0495582_0019015 | Ga0495582_0019015_642_938 | 98 |
| 447 | 3300046476 | Ga0495662_0225880 | Ga0495662_0225880_17_313 | 98 |
| 448 | 3300046491 | Ga0495584_0136605 | Ga0495584_0136605_843_1139 | 98 |
| 449 | 3300046491 | Ga0495584_0157933 | Ga0495584_0157933_592_888 | 98 |
| 450 | 3300046500 | Ga0495596_0047242 | Ga0495596_0047242_17_313 | 98 |
| 451 | 3300046500 | Ga0495596_0324776 | Ga0495596_0324776_47_343 | 98 |
| 452 | 3300046501 | Ga0495607_0168500 | Ga0495607_0168500_193_489 | 98 |
| 453 | 3300046506 | Ga0495583_0285195 | Ga0495583_0285195_340_636 | 98 |
| 454 | 3300046511 | Ga0495608_0005127 | Ga0495608_0005127_1957_2253 | 98 |
| 455 | 3300046511 | Ga0495608_0850426 | Ga0495608_0850426_81_377 | 98 |
| 456 | 3300046513 | Ga0495616_0239252 | Ga0495616_0239252_472_768 | 98 |
| 457 | 3300046514 | Ga0495618_0045429 | Ga0495618_0045429_485_781 | 98 |
| 458 | 3300046516 | Ga0495628_0008385 | Ga0495628_0008385_3579_3875 | 98 |
| 459 | 3300046516 | Ga0495628_0896515 | Ga0495628_0896515_77_373 | 98 |
| 460 | 3300046517 | Ga0495630_1057387 | Ga0495630_1057387_305_601 | 98 |
| 461 | 3300046518 | Ga0495631_0512925 | Ga0495631_0512925_163_459 | 98 |
| 462 | 3300046520 | Ga0495637_0060884 | Ga0495637_0060884_653_949 | 98 |
| 463 | 3300046523 | Ga0495644_0162243 | Ga0495644_0162243_144_440 | 98 |
| 464 | 3300046525 | Ga0495663_0074847 | Ga0495663_0074847_464_760 | 98 |
| 465 | 3300046526 | Ga0495666_0262223 | Ga0495666_0262223_44_340 | 98 |
| 466 | 3300046528 | Ga0495642_0097304 | Ga0495642_0097304_529_825 | 98 |
| 467 | 3300046529 | Ga0495652_0013293 | Ga0495652_0013293_1274_1570 | 98 |
| 468 | 3300046531 | Ga0495665_0045516 | Ga0495665_0045516_1706_2002 | 98 |
| 469 | 3300046533 | Ga0495640_0787734 | Ga0495640_0787734_185_481 | 98 |
| 470 | 3300046535 | Ga0495586_0633040 | Ga0495586_0633040_35_331 | 98 |
| 471 | 3300046536 | Ga0495587_0064013 | Ga0495587_0064013_543_839 | 98 |
| 472 | 3300046543 | Ga0495645_0210812 | Ga0495645_0210812_247_543 | 98 |
| 473 | 3300046559 | Ga0495667_0002822 | Ga0495667_0002822_4422_4718 | 98 |
| 474 | 3300046559 | Ga0495667_0194055 | Ga0495667_0194055_442_738 | 98 |
| 475 | 3300046559 | Ga0495667_0218032 | Ga0495667_0218032_732_1028 | 98 |
| 476 | 3300046615 | Ga0495656_0277005 | Ga0495656_0277005_118_414 | 98 |
| 477 | 3300046615 | Ga0495656_0330204 | Ga0495656_0330204_271_576 | 98 |
| 478 | 3300046615 | Ga0495656_0380938 | Ga0495656_0380938_93_389 | 98 |
| 479 | 3300046616 | Ga0495668_0688716 | Ga0495668_0688716_234_530 | 98 |
| 480 | 3300046642 | Ga0495634_0034771 | Ga0495634_0034771_2197_2493 | 98 |
| 481 | 3300046642 | Ga0495634_0227038 | Ga0495634_0227038_619_915 | 98 |
| 482 | 3300046663 | Ga0495635_0009515 | Ga0495635_0009515_228_524 | 98 |
| 483 | 3300046663 | Ga0495635_0060815 | Ga0495635_0060815_2119_2415 | 98 |
| 484 | 3300046664 | Ga0495659_0073570 | Ga0495659_0073570_433_729 | 98 |
| 485 | 3300046674 | Ga0495588_0433213 | Ga0495588_0433213_49_345 | 98 |
| 486 | 3300046675 | Ga0495657_0015852 | Ga0495657_0015852_972_1268 | 98 |
| 487 | 3300046675 | Ga0495657_0190079 | Ga0495657_0190079_55_351 | 98 |
| 488 | 3300046678 | Ga0495599_0014431 | Ga0495599_0014431_4574_4870 | 98 |
| 489 | 3300046680 | Ga0495646_0008419 | Ga0495646_0008419_81_377 | 98 |
| 490 | 3300046681 | Ga0495647_0002631 | Ga0495647_0002631_3673_3969 | 98 |
| 491 | 3300046683 | Ga0495658_0008300 | Ga0495658_0008300_3324_3620 | 98 |
| 492 | 3300046683 | Ga0495658_0827338 | Ga0495658_0827338_209_505 | 98 |
| 493 | 3300046684 | Ga0495669_0271877 | Ga0495669_0271877_22_318 | 98 |
| 494 | 3300046684 | Ga0495669_0528679 | Ga0495669_0528679_109_405 | 98 |
| 495 | 3300046689 | Ga0495613_0016167 | Ga0495613_0016167_2346_2642 | 98 |
| 496 | 3300046689 | Ga0495613_0028316 | Ga0495613_0028316_229_525 | 98 |
| 497 | 3300046690 | Ga0495624_0504267 | Ga0495624_0504267_408_704 | 98 |
| 498 | 3300046691 | Ga0495670_0502634 | Ga0495670_0502634_16_312 | 98 |
| 499 | 3300046692 | Ga0495671_0083060 | Ga0495671_0083060_1172_1468 | 98 |
| 500 | 3300046794 | Ga0495589_0230341 | Ga0495589_0230341_62_358 | 98 |
| 501 | 3300046809 | Ga0495600_0001744 | Ga0495600_0001744_7520_7816 | 98 |
| 502 | 3300047315 | Ga0495581_0002802 | Ga0495581_0002802_3410_3706 | 98 |
| 503 | 3300047317 | Ga0495604_0008035 | Ga0495604_0008035_6253_6549 | 98 |
| 504 | 3300047319 | Ga0495674_0007929 | Ga0495674_0007929_4896_5192 | 98 |
| 505 | 3300047319 | Ga0495674_1017815 | Ga0495674_1017815_313_609 | 98 |
| 506 | 3300047321 | Ga0495676_0010518 | Ga0495676_0010518_4618_4914 | 98 |
| 507 | 3300047321 | Ga0495676_0277308 | Ga0495676_0277308_39_335 | 98 |
| 508 | 3300047321 | Ga0495676_0845164 | Ga0495676_0845164_180_476 | 98 |
| 509 | 3300047322 | Ga0495680_0005335 | Ga0495680_0005335_5440_5736 | 98 |
| 510 | 3300047322 | Ga0495680_0092498 | Ga0495680_0092498_1902_2198 | 98 |
| 511 | 3300047444 | Ga0495675_0063723 | Ga0495675_0063723_538_834 | 98 |
| 512 | 3300047445 | Ga0495677_0098842 | Ga0495677_0098842_485_781 | 98 |
| 513 | 3300047471 | Ga0495684_0003466 | Ga0495684_0003466_1653_1949 | 98 |
| 514 | 3300047471 | Ga0495684_0407421 | Ga0495684_0407421_45_341 | 98 |
| 515 | 3300047673 | Ga0495593_0071190 | Ga0495593_0071190_271_567 | 98 |
| 516 | 3300048088 | Ga0495602_0406797 | Ga0495602_0406797_219_515 | 98 |
| 517 | 3300048091 | Ga0495626_0155107 | Ga0495626_0155107_524_820 | 98 |
| 518 | 3300048903 | Ga0496100_0000160 | Ga0496100_0000160_25630_25926 | 98 |
| 519 | 3300048903 | Ga0496100_0178056 | Ga0496100_0178056_1115_1411 | 98 |
| 520 | 3300048904 | Ga0496101_0020330 | Ga0496101_0020330_1087_1383 | 98 |
| 521 | 3300048904 | Ga0496101_0067384 | Ga0496101_0067384_426_722 | 98 |
| 522 | 3300048904 | Ga0496101_1442878 | Ga0496101_1442878_163_459 | 98 |
| 523 | 3300048905 | Ga0496102_0095627 | Ga0496102_0095627_2033_2329 | 98 |
| 524 | 3300048905 | Ga0496102_1307632 | Ga0496102_1307632_133_429 | 98 |
| 525 | 3300048905 | Ga0496102_1482635 | Ga0496102_1482635_265_582 | 98 |
| 526 | 3300048906 | Ga0496103_0021233 | Ga0496103_0021233_2585_2902 | 98 |
| 527 | 3300048906 | Ga0496103_0039832 | Ga0496103_0039832_2095_2391 | 98 |
| 528 | 3300048906 | Ga0496103_0469490 | Ga0496103_0469490_258_554 | 98 |
| 529 | 3300048907 | Ga0496104_0016547 | Ga0496104_0016547_4923_5219 | 98 |
| 530 | 3300048907 | Ga0496104_0018971 | Ga0496104_0018971_4691_4987 | 98 |
| 531 | 3300048907 | Ga0496104_0026628 | Ga0496104_0026628_933_1229 | 98 |
| 532 | 3300048907 | Ga0496104_0122627 | Ga0496104_0122627_550_846 | 98 |
| 533 | 3300048907 | Ga0496104_0533662 | Ga0496104_0533662_473_769 | 98 |
| 534 | 3300048907 | Ga0496104_0753417 | Ga0496104_0753417_10_306 | 98 |
| 535 | 3300048908 | Ga0496105_0041755 | Ga0496105_0041755_3077_3373 | 98 |
| 536 | 3300048908 | Ga0496105_0089089 | Ga0496105_0089089_1407_1703 | 98 |
| 537 | 3300048908 | Ga0496105_0093197 | Ga0496105_0093197_1255_1551 | 98 |
| 538 | 3300048908 | Ga0496105_0195632 | Ga0496105_0195632_1290_1586 | 98 |
| 539 | 3300048909 | Ga0496106_0031262 | Ga0496106_0031262_136_432 | 98 |
| 540 | 3300048909 | Ga0496106_0254517 | Ga0496106_0254517_985_1281 | 98 |
| 541 | 3300048910 | Ga0496107_0047242 | Ga0496107_0047242_2102_2398 | 98 |
| 542 | 3300048910 | Ga0496107_0265948 | Ga0496107_0265948_115_411 | 98 |
| 543 | 3300048911 | Ga0496108_0000293 | Ga0496108_0000293_11308_11604 | 98 |
| 544 | 3300048911 | Ga0496108_0060335 | Ga0496108_0060335_1368_1664 | 98 |
| 545 | 3300048911 | Ga0496108_0216495 | Ga0496108_0216495_890_1186 | 98 |
| 546 | 3300048911 | Ga0496108_0252766 | Ga0496108_0252766_1217_1513 | 98 |
| 547 | 3300048911 | Ga0496108_0462469 | Ga0496108_0462469_678_974 | 98 |
| 548 | 3300048912 | Ga0496109_0003621 | Ga0496109_0003621_11188_11484 | 98 |
| 549 | 3300048912 | Ga0496109_0206412 | Ga0496109_0206412_597_893 | 98 |
| 550 | 3300048912 | Ga0496109_0398674 | Ga0496109_0398674_32_328 | 98 |
| 551 | 3300048912 | Ga0496109_1527474 | Ga0496109_1527474_50_346 | 98 |
| 552 | 3300048913 | Ga0496110_0112521 | Ga0496110_0112521_1758_2054 | 98 |
| 553 | 3300048913 | Ga0496110_0120489 | Ga0496110_0120489_135_431 | 98 |
| 554 | 3300048913 | Ga0496110_0241358 | Ga0496110_0241358_339_635 | 98 |
| 555 | 3300048913 | Ga0496110_0489118 | Ga0496110_0489118_246_542 | 98 |
| 556 | 3300048913 | Ga0496110_0801299 | Ga0496110_0801299_214_510 | 98 |
| 557 | 3300048914 | Ga0496111_0010620 | Ga0496111_0010620_616_912 | 98 |
| 558 | 3300048914 | Ga0496111_0176726 | Ga0496111_0176726_920_1216 | 98 |
| 559 | 3300048914 | Ga0496111_0727557 | Ga0496111_0727557_61_357 | 98 |
| 560 | 3300048914 | Ga0496111_0898870 | Ga0496111_0898870_159_455 | 98 |
| 561 | 3300048915 | Ga0496112_0026671 | Ga0496112_0026671_4475_4771 | 98 |
| 562 | 3300048915 | Ga0496112_0134669 | Ga0496112_0134669_1835_2131 | 98 |
| 563 | 3300048915 | Ga0496112_0376926 | Ga0496112_0376926_689_988 | 98 |
| 564 | 3300048915 | Ga0496112_0661276 | Ga0496112_0661276_289_615 | 98 |
| 565 | 3300048915 | Ga0496112_1107156 | Ga0496112_1107156_182_478 | 98 |
| 566 | 3300048915 | Ga0496112_1551082 | Ga0496112_1551082_117_413 | 98 |
| 567 | 3300048916 | Ga0496113_0002572 | Ga0496113_0002572_5744_6040 | 98 |
| 568 | 3300048916 | Ga0496113_0114004 | Ga0496113_0114004_942_1238 | 98 |
| 569 | 3300048916 | Ga0496113_0387660 | Ga0496113_0387660_697_993 | 98 |
| 570 | 3300048916 | Ga0496113_0782377 | Ga0496113_0782377_196_492 | 98 |
| 571 | 3300048916 | Ga0496113_0938104 | Ga0496113_0938104_94_390 | 98 |
| 572 | 3300048917 | Ga0496114_0067006 | Ga0496114_0067006_2429_2725 | 98 |
| 573 | 3300048917 | Ga0496114_0140069 | Ga0496114_0140069_1750_2046 | 98 |
| 574 | 3300048917 | Ga0496114_0562114 | Ga0496114_0562114_680_976 | 98 |
| 575 | 3300048918 | Ga0496115_0143216 | Ga0496115_0143216_1056_1352 | 98 |
| 576 | 3300048922 | Ga0496119_0004993 | Ga0496119_0004993_3034_3330 | 98 |
| 577 | 3300048927 | Ga0496124_0026441 | Ga0496124_0026441_295_591 | 98 |
| 578 | 3300048928 | Ga0496125_0059947 | Ga0496125_0059947_1091_1387 | 98 |
| 579 | 3300048929 | Ga0496126_0007744 | Ga0496126_0007744_1442_1738 | 98 |
| 580 | 3300048929 | Ga0496126_0104226 | Ga0496126_0104226_1673_1969 | 98 |
| 581 | 3300049581 | Ga0501047_0008965 | Ga0501047_0008965_3641_3937 | 98 |
| 582 | 3300049581 | Ga0501047_0134649 | Ga0501047_0134649_1909_2205 | 98 |
| 583 | 3300049581 | Ga0501047_0421629 | Ga0501047_0421629_52_348 | 98 |
| 584 | 3300049583 | Ga0501067_0377198 | Ga0501067_0377198_244_543 | 98 |
| 585 | 3300049583 | Ga0501067_0466756 | Ga0501067_0466756_86_382 | 98 |
| 586 | 3300049585 | Ga0501069_0635660 | Ga0501069_0635660_152_451 | 98 |
| 587 | 3300049587 | Ga0501071_0187882 | Ga0501071_0187882_928_1224 | 98 |
| 588 | 3300049588 | Ga0501072_1204969 | Ga0501072_1204969_51_347 | 98 |
| 589 | 3300049592 | Ga0501076_0205205 | Ga0501076_0205205_1016_1312 | 98 |
| 590 | 3300049592 | Ga0501076_0479610 | Ga0501076_0479610_398_700 | 98 |
| 591 | 3300049652 | Ga0501202_230738 | Ga0501202_230738_44_340 | 98 |
| 592 | 3300049744 | Ga0501083_0604889 | Ga0501083_0604889_290_589 | 98 |
| 593 | 3300050489 | nmdc:mga03683_393832_c1 | nmdc:mga03683_393832_c1_355_651 | 98 |
| 594 | 3300050490 | nmdc:mga03n38_18927_c1 | nmdc:mga03n38_18927_c1_1880_2176 | 98 |
| 595 | 3300050491 | nmdc:mga00v17_32357_c1 | nmdc:mga00v17_32357_c1_505_801 | 98 |
| 596 | 3300050491 | nmdc:mga00v17_371262_c1 | nmdc:mga00v17_371262_c1_582_878 | 98 |
| 597 | 3300050492 | nmdc:mga0yw44_168720_c1 | nmdc:mga0yw44_168720_c1_147_443 | 98 |
| 598 | 3300050492 | nmdc:mga0yw44_268201_c1 | nmdc:mga0yw44_268201_c1_232_528 | 98 |
| 599 | 3300050492 | nmdc:mga0yw44_48431_c1 | nmdc:mga0yw44_48431_c1_1766_2062 | 98 |
| 600 | 3300050492 | nmdc:mga0yw44_968412_c1 | nmdc:mga0yw44_968412_c1_193_495 | 98 |
| 601 | 3300050494 | nmdc:mga06z11_31534_c1 | nmdc:mga06z11_31534_c1_1354_1650 | 98 |
| 602 | 3300050494 | nmdc:mga06z11_985534_c1 | nmdc:mga06z11_985534_c1_14_310 | 98 |
| 603 | 3300050495 | nmdc:mga04h51_4557_c1 | nmdc:mga04h51_4557_c1_2208_2504 | 98 |
| 604 | 3300050496 | nmdc:mga07m45_154106_c1 | nmdc:mga07m45_154106_c1_203_499 | 98 |
| 605 | 3300050496 | nmdc:mga07m45_50068_c1 | nmdc:mga07m45_50068_c1_143_439 | 98 |
| 606 | 3300050496 | nmdc:mga07m45_775310_c1 | nmdc:mga07m45_775310_c1_237_533 | 98 |
| 607 | 3300050507 | nmdc:mga05p37_240199_c1 | nmdc:mga05p37_240199_c1_1841_2137 | 98 |
| 608 | 3300050511 | nmdc:mga08y16_384306_c1 | nmdc:mga08y16_384306_c1_1062_1358 | 98 |
| 609 | 3300050512 | nmdc:mga0n895_936446_c1 | nmdc:mga0n895_936446_c1_119_424 | 98 |
| 610 | 3300050515 | nmdc:mga0a205_200668_c1 | nmdc:mga0a205_200668_c1_1162_1458 | 98 |
| 611 | 3300050515 | nmdc:mga0a205_31108_c1 | nmdc:mga0a205_31108_c1_1179_1484 | 98 |
| 612 | 3300050515 | nmdc:mga0a205_498309_c1 | nmdc:mga0a205_498309_c1_301_597 | 98 |
| 613 | 3300053077 | Ga0495601_0129184 | Ga0495601_0129184_340_636 | 98 |
| 614 | 3300053084 | Ga0495595_0008217 | Ga0495595_0008217_3930_4226 | 98 |
| 615 | 3300053085 | Ga0495619_0034868 | Ga0495619_0034868_2778_3074 | 98 |
| 616 | 3300054114 | Ga0501084_0067383 | Ga0501084_0067383_205_501 | 98 |
| 617 | 3300060353 | Ga0501082_1393082 | Ga0501082_1393082_199_495 | 98 |
| 618 | 3300061719 | Ga0466962_0173384 | Ga0466962_0173384_397_747 | 98 |
| 619 | 3300061719 | Ga0466962_0206352 | Ga0466962_0206352_469_765 | 98 |
| 620 | 3300061734 | Ga0530510_1016209 | Ga0530510_1016209_246_542 | 98 |
| 621 | 3300061734 | Ga0530510_1327490 | Ga0530510_1327490_133_429 | 98 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.855 | 3 | 87 |
| 4oi3-assembly1.cif.gz_B | crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) | 0.8362 | 3 | 87 |
| 7qa5-assembly1.cif.gz_A | solution structure of the c terminal domain of mgtc (pa4635) from pseudomonas aeruginosa | 0.7009 | 2 | 86 |
| 7csl-assembly2.cif.gz_D | crystal structure of the archaeal ef1a-ef1b complex | 0.6928 | 1 | 83 |
| 3ab4-assembly1.cif.gz_A | crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine | 0.6791 | 2 | 74 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.8462 | 4 | 87 | 3.30.70.3090 |
| 4oi3B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.8273 | 4 | 87 | 3.30.70.3090 |
| af_Q2G1I7_88_170_3.30.70.3090 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7794 | 1 | 83 | 3.30.70.3090 |
| af_Q2G1I7_88_170_3.30.70.3090 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer | 0.7381 | 1 | 83 | 3.30.70.3090 |
| 4moaA03 | Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Pesticidal crystal protein, central domain | 0.6895 | 36 | 62 | 2.100.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B1ZTA8-F1-model_v4 | DUF4242 domain-containing protein | 0.9576 | 1 | 96 |
|
| AF-A0A7Y2XFY1-F1-model_v4 | DUF4242 domain-containing protein | 0.9575 | 1 | 93 |
|
| AF-A0A1G7HQU9-F1-model_v4 | DUF4242 domain-containing protein | 0.956 | 1 | 94 |
|
| AF-A0A369TIF7-F1-model_v4 | DUF4242 domain-containing protein | 0.9537 | 1 | 94 |
|
| AF-A0A7Y2XFY1-F1-model_v4 | DUF4242 domain-containing protein | 0.9476 | 1 | 93 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar