F469991

General Info

Members Datasets Scaffolds Average Seq Length
621 260 1242 189

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10004760|Ga0111539_1000476012
Length 226
Sequence MQKAHDAGPVSCFAFCILHVAFLARLRQRQTGAARVVRRPAVFLDRDGTIIEERGFIDRLDMIAMFPWTGDALRLLKRAGYVVVVATNQSAVARGMIEEAFLHEVHRAIDAKLAGSGGSIDAYYYCPHLPNAVIDQYRQVCRCRKPSPGLIEQACRELELDLHRSVMIGDRWRDIASGAAAGTRTVLVRSGHGAHEEAAPEAGVAADVIVNNLMEAVGWMLRTSSR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
181 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
186 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
187 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
188 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
189 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 2.09
Rhizosphere 97.58
Stem 0
Stem Tuber 0
Unclassified 18.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10004760 3300009094 Bacteria 17717
2 Ga0065704_10011730 3300005289 Bacteria 2212
3 Ga0065712_10086172 3300005290 Bacteria 2651
4 Ga0065715_10001120 3300005293 Bacteria 7319
5 Ga0065715_10008396 3300005293 Bacteria 3900
6 Ga0065715_10020008 3300005293 Bacteria 2498
7 Ga0065707_10029583 3300005295 Unclassified 1573
8 Ga0070658_10004105 3300005327 Bacteria 11933
9 Ga0070676_10026178 3300005328 Bacteria 3301
10 Ga0070676_10293495 3300005328 Bacteria 1099
11 Ga0070676_10297499 3300005328 Bacteria 1093
12 Ga0070676_10522433 3300005328 Unclassified 846
13 Ga0070683_100056236 3300005329 Bacteria 3653
14 Ga0070690_100078601 3300005330 Bacteria 2156
15 Ga0070690_100724074 3300005330 Unclassified 766
16 Ga0070670_100030005 3300005331 Bacteria 4683
17 Ga0070670_100036504 3300005331 Bacteria 4229
18 Ga0070670_100041922 3300005331 Bacteria 3934
19 Ga0070670_100044318 3300005331 Bacteria 3825
20 Ga0070670_100069181 3300005331 Bacteria 3031
21 Ga0070670_100260967 3300005331 Bacteria 1510
22 Ga0070670_101299177 3300005331 Unclassified 666
23 Ga0070677_10057905 3300005333 Unclassified 1590
24 Ga0068869_100009597 3300005334 Bacteria 6286
25 Ga0068869_100052552 3300005334 Unclassified 2959
26 Ga0068869_100101178 3300005334 Bacteria 2180
27 Ga0068869_100165018 3300005334 Bacteria 1727
28 Ga0070666_10041878 3300005335 Unclassified 3061
29 Ga0070666_10048192 3300005335 Bacteria 2862
30 Ga0070666_10075011 3300005335 Bacteria 2306
31 Ga0070680_100064706 3300005336 Bacteria 2997
32 Ga0070680_100359668 3300005336 Bacteria 1238
33 Ga0068868_100526869 3300005338 Bacteria 1038
34 Ga0070689_100021078 3300005340 Bacteria 4845
35 Ga0070689_100027948 3300005340 Bacteria 4258
36 Ga0070689_100042509 3300005340 Bacteria 3490
37 Ga0070689_100126041 3300005340 Bacteria 2049
38 Ga0070689_100766115 3300005340 Unclassified 847
39 Ga0070691_10205879 3300005341 Unclassified 1036
40 Ga0070687_100007916 3300005343 Bacteria 4471
41 Ga0070687_100055193 3300005343 Bacteria 2074
42 Ga0070661_100011066 3300005344 Bacteria 6283
43 Ga0070661_100507234 3300005344 Bacteria 966
44 Ga0070661_100587212 3300005344 Unclassified 899
45 Ga0070692_10048232 3300005345 Unclassified 2206
46 Ga0070668_100054433 3300005347 Bacteria 3086
47 Ga0070668_100251965 3300005347 Bacteria 1466
48 Ga0070668_100258393 3300005347 Unclassified 1448
49 Ga0070669_100008531 3300005353 Bacteria 7316
50 Ga0070669_100044698 3300005353 Bacteria 3227
51 Ga0070669_100180281 3300005353 Bacteria 1652
52 Ga0070669_100370338 3300005353 Bacteria 1167
53 Ga0070669_100417525 3300005353 Unclassified 1101
54 Ga0070675_100006227 3300005354 Bacteria 9152
55 Ga0070675_100012013 3300005354 Bacteria 6788
56 Ga0070675_100093728 3300005354 Bacteria 2519
57 Ga0070675_100139638 3300005354 Bacteria 2070
58 Ga0070675_100155469 3300005354 Bacteria 1963
59 Ga0070675_100178433 3300005354 Bacteria 1835
60 Ga0070675_100540531 3300005354 Bacteria 1053
61 Ga0070671_100034650 3300005355 Bacteria 4179
62 Ga0070671_100063218 3300005355 Bacteria 3082
63 Ga0070671_100077325 3300005355 Bacteria 2781
64 Ga0070671_100806370 3300005355 Bacteria 818
65 Ga0070674_100069893 3300005356 Bacteria 2478
66 Ga0070674_100084627 3300005356 Bacteria 2274
67 Ga0070674_100264527 3300005356 Bacteria 1357
68 Ga0070673_100000688 3300005364 Bacteria 18683
69 Ga0070673_100120755 3300005364 Bacteria 2186
70 Ga0070673_100219592 3300005364 Bacteria 1644
71 Ga0070673_100223171 3300005364 Bacteria 1632
72 Ga0070673_100355616 3300005364 Bacteria 1301
73 Ga0070688_100050215 3300005365 Bacteria 2598
74 Ga0070688_100079582 3300005365 Unclassified 2118
75 Ga0070688_100124766 3300005365 Bacteria 1729
76 Ga0070688_100298284 3300005365 Bacteria 1164
77 Ga0070688_100386578 3300005365 Unclassified 1033
78 Ga0070659_100010308 3300005366 Bacteria 6872
79 Ga0070659_100201385 3300005366 Bacteria 1639
80 Ga0070659_100500279 3300005366 Bacteria 1036
81 Ga0070659_100831685 3300005366 Bacteria 804
82 Ga0070667_100055429 3300005367 Bacteria 3348
83 Ga0070667_100173576 3300005367 Bacteria 1904
84 Ga0070667_100991985 3300005367 Unclassified 783
85 Ga0070667_101168734 3300005367 Archaea 720
86 Ga0070713_100038288 3300005436 Bacteria 3884
87 Ga0070701_10185137 3300005438 Bacteria 1222
88 Ga0070701_10207991 3300005438 Bacteria 1160
89 Ga0070701_10400933 3300005438 Unclassified 869
90 Ga0070705_100000663 3300005440 Bacteria 19708
91 Ga0070705_100028536 3300005440 Bacteria 3058
92 Ga0070700_100095772 3300005441 Bacteria 1946
93 Ga0070700_100115009 3300005441 Bacteria 1794
94 Ga0070700_100166982 3300005441 Unclassified 1521
95 Ga0070700_100461142 3300005441 Unclassified 969
96 Ga0070694_100003294 3300005444 Bacteria 9656
97 Ga0070694_100027872 3300005444 Bacteria 3672
98 Ga0070694_100119152 3300005444 Unclassified 1892
99 Ga0070694_100167153 3300005444 Unclassified 1618
100 Ga0070708_100330169 3300005445 Bacteria 1437
101 Ga0070708_100334088 3300005445 Bacteria 1428
102 Ga0070663_100022145 3300005455 Bacteria 4243
103 Ga0070663_100161407 3300005455 Bacteria 1725
104 Ga0070663_100200773 3300005455 Bacteria 1556
105 Ga0070663_100527412 3300005455 Bacteria 984
106 Ga0070678_100011365 3300005456 Bacteria 5489
107 Ga0070678_100104995 3300005456 Bacteria 2198
108 Ga0070678_100120539 3300005456 Bacteria 2068
109 Ga0070678_100337088 3300005456 Bacteria 1293
110 Ga0070662_100006502 3300005457 Bacteria 7539
111 Ga0070662_100230835 3300005457 Bacteria 1480
112 Ga0070662_100536433 3300005457 Bacteria 979
113 Ga0070681_10244319 3300005458 Unclassified 1708
114 Ga0070681_10788828 3300005458 Unclassified 867
115 Ga0068867_100001539 3300005459 Bacteria 16006
116 Ga0068867_100019325 3300005459 Bacteria 4856
117 Ga0068867_100948480 3300005459 Unclassified 777
118 Ga0070685_10546304 3300005466 Bacteria 826
119 Ga0070706_100041913 3300005467 Bacteria 4228
120 Ga0070707_100049308 3300005468 Bacteria 4036
121 Ga0070707_100629991 3300005468 Bacteria 1035
122 Ga0070707_101263107 3300005468 Bacteria 705
123 Ga0070698_100005649 3300005471 Bacteria 13693
124 Ga0070698_100010484 3300005471 Bacteria 9885
125 Ga0070699_100001875 3300005518 Bacteria 19020
126 Ga0070699_100015842 3300005518 Bacteria 6472
127 Ga0070699_100049322 3300005518 Bacteria 3644
128 Ga0070699_100158121 3300005518 Bacteria 2005
129 Ga0070679_100155234 3300005530 Bacteria 2264
130 Ga0070679_100548022 3300005530 Unclassified 1100
131 Ga0070684_100000301 3300005535 Bacteria 34312
132 Ga0070684_101529943 3300005535 Bacteria 629
133 Ga0070697_100286966 3300005536 Bacteria 1413
134 Ga0068853_100372041 3300005539 Bacteria 1333
135 Ga0068853_100503057 3300005539 Bacteria 1144
136 Ga0070672_100011492 3300005543 Bacteria 6176
137 Ga0070672_100068383 3300005543 Bacteria 2817
138 Ga0070672_100087983 3300005543 Bacteria 2500
139 Ga0070672_100105952 3300005543 Bacteria 2286
140 Ga0070672_100111518 3300005543 Bacteria 2230
141 Ga0070672_100268228 3300005543 Unclassified 1441
142 Ga0070672_100328119 3300005543 Bacteria 1302
143 Ga0070686_100125639 3300005544 Unclassified 1767
144 Ga0070686_100129444 3300005544 Bacteria 1743
145 Ga0070695_100000212 3300005545 Bacteria 28184
146 Ga0070695_100082183 3300005545 Unclassified 2133
147 Ga0070695_100216591 3300005545 Bacteria 1377
148 Ga0070696_100000342 3300005546 Bacteria 28263
149 Ga0070696_100017664 3300005546 Bacteria 4817
150 Ga0070696_100024237 3300005546 Bacteria 4123
151 Ga0070696_100090176 3300005546 Bacteria 2181
152 Ga0070696_100351040 3300005546 Unclassified 1142
153 Ga0070696_100719907 3300005546 Bacteria 815
154 Ga0070693_100023253 3300005547 Bacteria 3310
155 Ga0070704_100002704 3300005549 Bacteria 10021
156 Ga0070704_100007519 3300005549 Bacteria 6487
157 Ga0070704_100008968 3300005549 Bacteria 6027
158 Ga0070704_100086572 3300005549 Bacteria 2323
159 Ga0070704_100531501 3300005549 Bacteria 1025
160 Ga0070704_101001444 3300005549 Bacteria 756
161 Ga0070664_100002048 3300005564 Bacteria 16145
162 Ga0070664_100068932 3300005564 Bacteria 3025
163 Ga0070664_100236761 3300005564 Bacteria 1638
164 Ga0070664_100247314 3300005564 Bacteria 1602
165 Ga0068857_100009596 3300005577 Bacteria 8408
166 Ga0068857_100012658 3300005577 Bacteria 7350
167 Ga0068857_100039005 3300005577 Bacteria 4206
168 Ga0068857_100090601 3300005577 Bacteria 2737
169 Ga0068857_100206290 3300005577 Bacteria 1793
170 Ga0068854_100101768 3300005578 Bacteria 2155
171 Ga0068856_100055868 3300005614 Bacteria 3896
172 Ga0070702_100129588 3300005615 Bacteria 1591
173 Ga0068852_100078907 3300005616 Bacteria 2914
174 Ga0068852_100151500 3300005616 Unclassified 2157
175 Ga0068852_100395255 3300005616 Unclassified 1359
176 Ga0068859_100002208 3300005617 Bacteria 19742
177 Ga0068859_100019857 3300005617 Bacteria 6745
178 Ga0068859_100272196 3300005617 Bacteria 1786
179 Ga0068864_100072226 3300005618 Bacteria 3007
180 Ga0068864_100072375 3300005618 Bacteria 3004
181 Ga0068864_100213332 3300005618 Bacteria 1778
182 Ga0068864_100219892 3300005618 Bacteria 1752
183 Ga0068864_100325707 3300005618 Bacteria 1444
184 Ga0068861_100002093 3300005719 Bacteria 12939
185 Ga0068861_100135762 3300005719 Bacteria 2002
186 Ga0068861_100541267 3300005719 Bacteria 1059
187 Ga0068861_100574652 3300005719 Bacteria 1031
188 Ga0068861_100580540 3300005719 Bacteria 1026
189 Ga0068870_10019223 3300005840 Bacteria 3311
190 Ga0068870_10091342 3300005840 Bacteria 1703
191 Ga0068863_100103021 3300005841 Bacteria 2714
192 Ga0068863_100364354 3300005841 Bacteria 1409
193 Ga0068858_100162587 3300005842 Bacteria 2102
194 Ga0068860_100003414 3300005843 Bacteria 16326
195 Ga0068860_100044658 3300005843 Bacteria 4223
196 Ga0068860_100115102 3300005843 Unclassified 2571
197 Ga0068862_100000827 3300005844 Bacteria 30636
198 Ga0081455_10081424 3300005937 Bacteria 2651
199 Ga0075364_10036370 3300006051 Bacteria 3183
200 Ga0075432_10020224 3300006058 Bacteria 2276
201 Ga0075432_10084960 3300006058 Bacteria 1152
202 Ga0068871_100275490 3300006358 Unclassified 1470
203 Ga0068871_100353356 3300006358 Bacteria 1300
204 Ga0075428_100001698 3300006844 Bacteria 23498
205 Ga0075428_100003344 3300006844 Bacteria 17557
206 Ga0075428_100009452 3300006844 Bacteria 10823
207 Ga0075428_100139937 3300006844 Bacteria 2631
208 Ga0075428_100203416 3300006844 Bacteria 2140
209 Ga0075428_100937550 3300006844 Unclassified 918
210 Ga0075430_100007576 3300006846 Bacteria 9172
211 Ga0075430_100798356 3300006846 Bacteria 778
212 Ga0075431_100034639 3300006847 Bacteria 5202
213 Ga0075431_100044914 3300006847 Bacteria 4556
214 Ga0075431_100103657 3300006847 Bacteria 2936
215 Ga0075431_100149086 3300006847 Bacteria 2409
216 Ga0075431_100150757 3300006847 Bacteria 2394
217 Ga0075431_100558708 3300006847 Bacteria 1131
218 Ga0075433_10037546 3300006852 Bacteria 4180
219 Ga0075433_10050276 3300006852 Unclassified 3628
220 Ga0075433_10194590 3300006852 Bacteria 1804
221 Ga0075433_10254352 3300006852 Unclassified 1558
222 Ga0075433_10261082 3300006852 Bacteria 1535
223 Ga0075433_10806459 3300006852 Bacteria 820
224 Ga0075434_100002926 3300006871 Bacteria 15175
225 Ga0075434_100018114 3300006871 Bacteria 6796
226 Ga0075434_100019878 3300006871 Bacteria 6503
227 Ga0075434_100078225 3300006871 Bacteria 3303
228 Ga0075434_100180920 3300006871 Bacteria 2128
229 Ga0075434_100206639 3300006871 Bacteria 1984
230 Ga0075434_100219015 3300006871 Bacteria 1923
231 Ga0075434_100296438 3300006871 Unclassified 1637
232 Ga0075434_100360597 3300006871 Bacteria 1475
233 Ga0075434_100568870 3300006871 Bacteria 1153
234 Ga0075434_100907179 3300006871 Bacteria 896
235 Ga0075429_100126233 3300006880 Bacteria 2237
236 Ga0075429_100209360 3300006880 Bacteria 1708
237 Ga0068865_100059008 3300006881 Bacteria 2682
238 Ga0068865_100203341 3300006881 Bacteria 1539
239 Ga0075436_100706763 3300006914 Bacteria 747
240 Ga0075436_100813984 3300006914 Archaea 696
241 Ga0097620_100002208 3300006931 Bacteria 19742
242 Ga0097620_100019857 3300006931 Bacteria 6745
243 Ga0097620_100272214 3300006931 Bacteria 1786
244 Ga0075435_100000569 3300007076 Bacteria 22675
245 Ga0075435_100006387 3300007076 Bacteria 8332
246 Ga0075435_100015656 3300007076 Bacteria 5706
247 Ga0075435_100043659 3300007076 Bacteria 3589
248 Ga0075435_100051652 3300007076 Bacteria 3312
249 Ga0075435_100194434 3300007076 Unclassified 1718
250 Ga0111539_10000112 3300009094 Bacteria 89047
251 Ga0111539_10071637 3300009094 Unclassified 4089
252 Ga0111539_10099093 3300009094 Bacteria 3423
253 Ga0111539_10145577 3300009094 Bacteria 2774
254 Ga0111539_10246517 3300009094 Bacteria 2080
255 Ga0111539_10793961 3300009094 Bacteria 1102
256 Ga0111539_10983055 3300009094 Unclassified 981
257 Ga0111539_11943730 3300009094 Unclassified 682
258 Ga0105245_10140761 3300009098 Bacteria 2272
259 Ga0105245_11409631 3300009098 Bacteria 747
260 Ga0114129_10000827 3300009147 Bacteria 39985
261 Ga0114129_10011640 3300009147 Bacteria 12523
262 Ga0114129_10014871 3300009147 Bacteria 11087
263 Ga0114129_10049443 3300009147 Bacteria 5907
264 Ga0114129_10077488 3300009147 Bacteria 4623
265 Ga0114129_10513694 3300009147 Bacteria 1563
266 Ga0105243_10063535 3300009148 Bacteria 2959
267 Ga0105243_10099909 3300009148 Bacteria 2406
268 Ga0105241_10018160 3300009174 Bacteria 5171
269 Ga0105242_10051901 3300009176 Bacteria 3344
270 Ga0105242_10178454 3300009176 Bacteria 1872
271 Ga0105248_10234447 3300009177 Bacteria 2066
272 Ga0105248_10464475 3300009177 Bacteria 1427
273 Ga0105249_10021912 3300009553 Bacteria 5723
274 Ga0105249_10023851 3300009553 Bacteria 5495
275 Ga0105249_10215520 3300009553 Bacteria 1887
276 Ga0105249_10230067 3300009553 Bacteria 1828
277 Ga0105239_10212655 3300010375 Bacteria 2168
278 Ga0157370_10494554 3300013104 Bacteria 1123
279 Ga0157374_10185193 3300013296 Bacteria 2035
280 Ga0157378_10103868 3300013297 Unclassified 2597
281 Ga0163162_10134000 3300013306 Bacteria 2588
282 Ga0157372_11543458 3300013307 Bacteria 765
283 Ga0157375_10003263 3300013308 Bacteria 14080
284 Ga0157375_10095345 3300013308 Bacteria 3046
285 Ga0157375_10170558 3300013308 Unclassified 2323
286 Ga0157375_10226890 3300013308 Bacteria 2026
287 Ga0157375_10434227 3300013308 Bacteria 1479
288 Ga0163163_10078490 3300014325 Bacteria 3298
289 Ga0163163_10315017 3300014325 Unclassified 1618
290 Ga0157380_10008182 3300014326 Bacteria 7454
291 Ga0157380_10712073 3300014326 Unclassified 1010
292 Ga0157377_10091827 3300014745 Bacteria 1794
293 Ga0157377_10263612 3300014745 Bacteria 1122
294 Ga0157379_10612874 3300014968 Bacteria 1017
295 Ga0157376_10290876 3300014969 Unclassified 1542
296 Ga0157376_10362377 3300014969 Bacteria 1391
297 Ga0163161_10402495 3300017792 Unclassified 1098
298 Ga0207697_10176143 3300025315 Unclassified 937
299 Ga0207653_10036964 3300025885 Bacteria 1592
300 Ga0207682_10015781 3300025893 Bacteria 2944
301 Ga0207642_10043171 3300025899 Bacteria 1986
302 Ga0207688_10005054 3300025901 Bacteria 7177
303 Ga0207688_10038732 3300025901 Bacteria 2647
304 Ga0207688_10100313 3300025901 Bacteria 1671
305 Ga0207680_10058594 3300025903 Bacteria 2335
306 Ga0207680_10077519 3300025903 Bacteria 2079
307 Ga0207680_10288076 3300025903 Bacteria 1142
308 Ga0207645_10057445 3300025907 Bacteria 2484
309 Ga0207645_10222221 3300025907 Unclassified 1245
310 Ga0207643_10005120 3300025908 Bacteria 7014
311 Ga0207643_10014418 3300025908 Bacteria 4292
312 Ga0207643_10083091 3300025908 Bacteria 1858
313 Ga0207643_10399476 3300025908 Unclassified 869
314 Ga0207705_10054199 3300025909 Bacteria 2890
315 Ga0207654_10088977 3300025911 Bacteria 1877
316 Ga0207707_10055001 3300025912 Bacteria 3463
317 Ga0207707_10490173 3300025912 Bacteria 1049
318 Ga0207695_10170343 3300025913 Bacteria 2103
319 Ga0207660_10041690 3300025917 Bacteria 3218
320 Ga0207660_10119903 3300025917 Bacteria 1991
321 Ga0207660_10350641 3300025917 Unclassified 1183
322 Ga0207660_10869839 3300025917 Bacteria 736
323 Ga0207662_10002158 3300025918 Bacteria 9803
324 Ga0207662_10007709 3300025918 Bacteria 5864
325 Ga0207662_10091866 3300025918 Bacteria 1868
326 Ga0207662_10164080 3300025918 Bacteria 1421
327 Ga0207649_10019888 3300025920 Bacteria 3844
328 Ga0207649_10111038 3300025920 Bacteria 1832
329 Ga0207649_10440292 3300025920 Bacteria 982
330 Ga0207649_10457376 3300025920 Bacteria 964
331 Ga0207649_10744873 3300025920 Unclassified 762
332 Ga0207652_10236524 3300025921 Bacteria 1646
333 Ga0207652_10588383 3300025921 Unclassified 999
334 Ga0207646_10484471 3300025922 Bacteria 1115
335 Ga0207681_10021426 3300025923 Bacteria 4109
336 Ga0207681_10033883 3300025923 Bacteria 3353
337 Ga0207681_10108260 3300025923 Bacteria 2017
338 Ga0207681_10125501 3300025923 Bacteria 1889
339 Ga0207681_10211687 3300025923 Bacteria 1494
340 Ga0207650_10012538 3300025925 Bacteria 5851
341 Ga0207650_10030181 3300025925 Bacteria 3903
342 Ga0207650_10041168 3300025925 Bacteria 3384
343 Ga0207650_10048543 3300025925 Bacteria 3131
344 Ga0207650_10113967 3300025925 Bacteria 2097
345 Ga0207650_10433417 3300025925 Bacteria 1092
346 Ga0207650_10472305 3300025925 Bacteria 1046
347 Ga0207659_10000905 3300025926 Bacteria 17661
348 Ga0207659_10040720 3300025926 Unclassified 3251
349 Ga0207659_10115926 3300025926 Bacteria 2044
350 Ga0207659_10201993 3300025926 Bacteria 1588
351 Ga0207659_10327548 3300025926 Bacteria 1265
352 Ga0207659_10466055 3300025926 Bacteria 1066
353 Ga0207659_11064031 3300025926 Bacteria 696
354 Ga0207687_10164831 3300025927 Bacteria 1704
355 Ga0207687_10940146 3300025927 Bacteria 740
356 Ga0207700_10015971 3300025928 Bacteria 4974
357 Ga0207644_10018142 3300025931 Unclassified 4758
358 Ga0207644_10046856 3300025931 Bacteria 3082
359 Ga0207690_10007478 3300025932 Bacteria 6484
360 Ga0207690_10187175 3300025932 Bacteria 1563
361 Ga0207690_10418041 3300025932 Bacteria 1072
362 Ga0207706_10019899 3300025933 Bacteria 6034
363 Ga0207706_10263252 3300025933 Bacteria 1505
364 Ga0207706_10374448 3300025933 Bacteria 1236
365 Ga0207706_10628898 3300025933 Unclassified 921
366 Ga0207686_10099351 3300025934 Bacteria 1940
367 Ga0207709_10140976 3300025935 Bacteria 1657
368 Ga0207670_10006465 3300025936 Bacteria 6502
369 Ga0207670_10006980 3300025936 Bacteria 6286
370 Ga0207670_10084683 3300025936 Bacteria 2226
371 Ga0207670_10263062 3300025936 Unclassified 1338
372 Ga0207670_10479724 3300025936 Bacteria 1007
373 Ga0207669_10088141 3300025937 Bacteria 2012
374 Ga0207669_10231843 3300025937 Unclassified 1363
375 Ga0207691_10006450 3300025940 Bacteria 11331
376 Ga0207691_10006903 3300025940 Bacteria 10951
377 Ga0207691_10026207 3300025940 Bacteria 5470
378 Ga0207691_10043130 3300025940 Bacteria 4158
379 Ga0207691_10214752 3300025940 Unclassified 1670
380 Ga0207691_10258839 3300025940 Bacteria 1500
381 Ga0207691_10418348 3300025940 Unclassified 1142
382 Ga0207691_10562529 3300025940 Bacteria 966
383 Ga0207711_10355524 3300025941 Bacteria 1357
384 Ga0207711_10425320 3300025941 Bacteria 1235
385 Ga0207689_10066591 3300025942 Unclassified 2961
386 Ga0207689_10129294 3300025942 Bacteria 2078
387 Ga0207689_10157746 3300025942 Bacteria 1870
388 Ga0207689_10237871 3300025942 Bacteria 1505
389 Ga0207661_10003320 3300025944 Bacteria 11164
390 Ga0207661_10059774 3300025944 Bacteria 3073
391 Ga0207679_10004857 3300025945 Bacteria 8382
392 Ga0207679_10191852 3300025945 Bacteria 1699
393 Ga0207679_10209288 3300025945 Bacteria 1634
394 Ga0207679_10228861 3300025945 Bacteria 1568
395 Ga0207667_10120974 3300025949 Bacteria 2698
396 Ga0207651_10000958 3300025960 Bacteria 12747
397 Ga0207651_10028626 3300025960 Bacteria 3518
398 Ga0207651_10062890 3300025960 Bacteria 2589
399 Ga0207651_10452189 3300025960 Bacteria 1102
400 Ga0207651_10886098 3300025960 Unclassified 794
401 Ga0207712_10549743 3300025961 Bacteria 993
402 Ga0207668_10049217 3300025972 Bacteria 2896
403 Ga0207668_10144970 3300025972 Unclassified 1831
404 Ga0207668_10915680 3300025972 Bacteria 781
405 Ga0207640_10029535 3300025981 Bacteria 3366
406 Ga0207640_11079770 3300025981 Bacteria 709
407 Ga0207658_10128078 3300025986 Bacteria 2035
408 Ga0207658_10184598 3300025986 Unclassified 1729
409 Ga0207658_10202898 3300025986 Unclassified 1657
410 Ga0207677_10108330 3300026023 Bacteria 2063
411 Ga0207677_10275094 3300026023 Bacteria 1379
412 Ga0207677_10884529 3300026023 Bacteria 804
413 Ga0207639_10405084 3300026041 Bacteria 1230
414 Ga0207678_10014169 3300026067 Bacteria 7010
415 Ga0207708_10016904 3300026075 Bacteria 5493
416 Ga0207708_10120217 3300026075 Bacteria 2046
417 Ga0207708_10120458 3300026075 Bacteria 2044
418 Ga0207708_10515084 3300026075 Unclassified 1004
419 Ga0207702_10106222 3300026078 Bacteria 2488
420 Ga0207641_10120991 3300026088 Bacteria 2336
421 Ga0207641_10611983 3300026088 Bacteria 1067
422 Ga0207648_10010176 3300026089 Bacteria 8944
423 Ga0207648_10030461 3300026089 Bacteria 4779
424 Ga0207648_10142191 3300026089 Bacteria 2115
425 Ga0207676_10086073 3300026095 Unclassified 2566
426 Ga0207674_10015147 3300026116 Bacteria 8485
427 Ga0207674_10057123 3300026116 Bacteria 3957
428 Ga0207674_10059622 3300026116 Bacteria 3861
429 Ga0207675_100005902 3300026118 Bacteria 11688
430 Ga0207675_100238619 3300026118 Bacteria 1756
431 Ga0207675_100281491 3300026118 Bacteria 1616
432 Ga0207675_100312817 3300026118 Bacteria 1532
433 Ga0207675_100676414 3300026118 Unclassified 1040
434 Ga0207683_10051493 3300026121 Bacteria 3607
435 Ga0207683_10064077 3300026121 Bacteria 3239
436 Ga0207683_10073377 3300026121 Bacteria 3027
437 Ga0207683_10236373 3300026121 Unclassified 1666
438 Ga0207698_10091746 3300026142 Unclassified 2488
439 Ga0209971_1033597 3300027682 Bacteria 1233
440 Ga0207428_10001411 3300027907 Bacteria 25306
441 Ga0207428_10026431 3300027907 Bacteria 4845
442 Ga0268265_10000420 3300028380 Bacteria 45660
443 Ga0268265_10072494 3300028380 Bacteria 2687
444 Ga0268265_10081661 3300028380 Bacteria 2553
445 Ga0268265_10321991 3300028380 Bacteria 1401
446 Ga0268264_10005134 3300028381 Bacteria 11094
447 Ga0268264_10129910 3300028381 Bacteria 2231
448 Ga0268264_10200762 3300028381 Bacteria 1824
449 Ga0307408_100134955 3300031548 Bacteria 1930
450 Ga0307413_10061126 3300031824 Bacteria 2323
451 Ga0307413_10905851 3300031824 Unclassified 749
452 Ga0307413_11196144 3300031824 Bacteria 661
453 Ga0307407_10121799 3300031903 Bacteria 1655
454 Ga0307409_100070191 3300031995 Bacteria 2780
455 Ga0307409_100175691 3300031995 Unclassified 1890
456 Ga0307409_100944024 3300031995 Bacteria 878
457 Ga0307416_100287352 3300032002 Bacteria 1626
458 Ga0307416_100783970 3300032002 Unclassified 1048
459 Ga0307416_100787074 3300032002 Unclassified 1046
460 Ga0307416_100927385 3300032002 Bacteria 972
461 Ga0307415_100221497 3300032126 Unclassified 1517
462 Ga0373929_0072445 3300035085 Bacteria 826
463 Ga0373949_0131039 3300035090 Bacteria 711
464 Ga0373951_0138821 3300035091 Bacteria 674
465 Ga0373952_0135497 3300035092 Bacteria 680
466 Ga0373932_0105786 3300035112 Unclassified 921
467 Ga0373939_0033080 3300035114 Unclassified 1507
468 Ga0373957_0108086 3300035120 Bacteria 1118
469 Ga0373960_0025582 3300035121 Bacteria 1606
470 Ga0373946_0011622 3300035171 Bacteria 3289
471 Ga0373955_0240551 3300035172 Unclassified 1084
472 Ga0373962_0184466 3300035242 Bacteria 699
473 Ga0373937_0084641 3300036401 Bacteria 2934
474 Ga0373925_0388507 3300037068 Unclassified 1137
475 Ga0451807_1355736 3300041486 Bacteria 830
476 Ga0439431_0005387 3300041997 Bacteria 2825
477 Ga0439441_018676 3300042001 Unclassified 1256
478 Ga0439445_0038993 3300042004 Bacteria 1258
479 Ga0439455_0079221 3300042012 Bacteria 891
480 Ga0439462_0041911 3300042015 Bacteria 1223
481 Ga0450914_020173 3300042118 Unclassified 737
482 Ga0450923_007995 3300042125 Unclassified 1807
483 Ga0450897_023855 3300042128 Unclassified 668
484 Ga0450898_033365 3300042134 Unclassified 952
485 Ga0450900_035754 3300042136 Bacteria 732
486 Ga0439446_0031774 3300042156 Bacteria 1529
487 Ga0439446_0051438 3300042156 Bacteria 1231
488 Ga0439446_0098911 3300042156 Bacteria 920
489 Ga0439446_0165322 3300042156 Unclassified 733
490 Ga0439434_0143065 3300042435 Bacteria 789
491 Ga0439435_0044547 3300042436 Unclassified 1251
492 Ga0439460_0056622 3300042461 Bacteria 1188
493 Ga0450918_065802 3300042531 Unclassified 675
494 Ga0451577_0004260 3300042876 Bacteria 15216
495 Ga0451577_0013210 3300042876 Bacteria 7737
496 Ga0451577_0133325 3300042876 Unclassified 2230
497 Ga0439440_0078838 3300042993 Unclassified 868
498 Ga0453684_0716191 3300044712 Unclassified 1086
499 Ga0451576_0041577 3300045051 Bacteria 4859
500 Ga0451576_0066107 3300045051 Unclassified 3764
501 Ga0451576_0197816 3300045051 Unclassified 2100
502 Ga0451576_0278051 3300045051 Bacteria 1750
503 Ga0495662_0061255 3300046476 Bacteria 1818
504 Ga0495584_0279460 3300046491 Unclassified 848
505 Ga0495585_0106374 3300046492 Bacteria 1496
506 Ga0495594_0033655 3300046499 Bacteria 2787
507 Ga0495637_0224331 3300046520 Bacteria 683
508 Ga0495643_0006181 3300046522 Bacteria 7947
509 Ga0495644_0052347 3300046523 Unclassified 1533
510 Ga0495663_0018831 3300046525 Bacteria 1969
511 Ga0495663_0124788 3300046525 Unclassified 864
512 Ga0495598_0003305 3300046537 Bacteria 3412
513 Ga0495609_0033897 3300046538 Bacteria 2316
514 Ga0495621_0005565 3300046539 Bacteria 3629
515 Ga0495621_0021046 3300046539 Bacteria 2147
516 Ga0495621_0219858 3300046539 Bacteria 769
517 Ga0495633_0019436 3300046558 Bacteria 3436
518 Ga0495656_0021811 3300046615 Bacteria 2499
519 Ga0495656_0080371 3300046615 Unclassified 1470
520 Ga0495659_0001218 3300046664 Bacteria 8906
521 Ga0495659_0038446 3300046664 Unclassified 1699
522 Ga0495659_0066287 3300046664 Unclassified 1345
523 Ga0495659_0134914 3300046664 Bacteria 981
524 Ga0495599_0009516 3300046678 Bacteria 5943
525 Ga0495658_0115151 3300046683 Bacteria 1620
526 Ga0495669_0015271 3300046684 Bacteria 3288
527 Ga0495669_0127553 3300046684 Unclassified 1196
528 Ga0495670_0204224 3300046691 Bacteria 1047
529 Ga0495604_0327833 3300047317 Bacteria 1022
530 Ga0495636_0066304 3300047318 Bacteria 1535
531 Ga0495676_0078516 3300047321 Bacteria 2513
532 Ga0495677_0170563 3300047445 Unclassified 842
533 Ga0496104_0009907 3300048907 Bacteria 8508
534 Ga0496106_0323852 3300048909 Bacteria 1237
535 Ga0496108_0004789 3300048911 Bacteria 10915
536 Ga0496109_0013120 3300048912 Bacteria 7169
537 Ga0496109_0656601 3300048912 Bacteria 986
538 Ga0496110_0043734 3300048913 Bacteria 3911
539 Ga0496110_0231975 3300048913 Bacteria 1679
540 Ga0496111_0016075 3300048914 Bacteria 5152
541 Ga0496111_0549487 3300048914 Bacteria 848
542 Ga0496112_0003645 3300048915 Bacteria 12829
543 Ga0496112_0264469 3300048915 Bacteria 1669
544 Ga0496113_0129464 3300048916 Bacteria 1979
545 Ga0501036_0159088 3300049572 Bacteria 1905
546 Ga0501036_0212321 3300049572 Bacteria 1626
547 Ga0501037_0039741 3300049573 Bacteria 3463
548 Ga0501038_0116757 3300049574 Bacteria 2205
549 Ga0501040_0021717 3300049576 Unclassified 4291
550 Ga0501040_0915278 3300049576 Bacteria 635
551 Ga0501041_0036184 3300049577 Unclassified 2992
552 Ga0501042_0007351 3300049578 Bacteria 7211
553 Ga0501042_0385783 3300049578 Bacteria 1014
554 Ga0501046_0044057 3300049580 Bacteria 3550
555 Ga0501048_0047735 3300049582 Bacteria 3055
556 Ga0501067_0066044 3300049583 Bacteria 2003
557 Ga0501069_0133750 3300049585 Bacteria 1421
558 Ga0501069_0481283 3300049585 Archaea 739
559 Ga0501071_0677296 3300049587 Archaea 794
560 Ga0501072_0034054 3300049588 Bacteria 3991
561 Ga0501072_0045119 3300049588 Bacteria 3465
562 Ga0501075_0068900 3300049591 Bacteria 2673
563 Ga0501076_0139316 3300049592 Bacteria 1970
564 Ga0501076_0515346 3300049592 Unclassified 986
565 Ga0501077_0014511 3300049593 Bacteria 4951
566 Ga0501077_0299189 3300049593 Unclassified 1025
567 Ga0501079_0026759 3300049741 Bacteria 4422
568 Ga0501079_0037905 3300049741 Bacteria 3717
569 Ga0501079_0114625 3300049741 Unclassified 2095
570 Ga0501080_0058973 3300049742 Bacteria 3572
571 Ga0501080_0172067 3300049742 Bacteria 1997
572 Ga0501081_0101534 3300049743 Bacteria 2034
573 Ga0501081_0395789 3300049743 Unclassified 1022
574 Ga0501083_0073440 3300049744 Bacteria 2274
575 Ga0501045_0069766 3300049824 Bacteria 2584
576 nmdc:mga00v17_10507_c1 3300050491 Bacteria 5056
577 nmdc:mga05p37_1334207_c1 3300050507 Archaea 728
578 nmdc:mga05p37_19777_c1 3300050507 Bacteria 8147
579 nmdc:mga05p37_37631_c1 3300050507 Bacteria 5933
580 nmdc:mga05p37_63194_c1 3300050507 Bacteria 4556
581 nmdc:mga05p37_765850_c1 3300050507 Bacteria 1062
582 nmdc:mga09592_67719_c1 3300050508 Bacteria 3028
583 nmdc:mga0qj67_120078_c1 3300050509 Bacteria 2126
584 nmdc:mga0qj67_510370_c1 3300050509 Unclassified 966
585 nmdc:mga0qj67_737123_c1 3300050509 Bacteria 782
586 nmdc:mga06r32_228720_c1 3300050510 Bacteria 1848
587 nmdc:mga06r32_303917_c1 3300050510 Bacteria 1581
588 nmdc:mga08y16_122115_c1 3300050511 Bacteria 2711
589 nmdc:mga08y16_1234298_c1 3300050511 Unclassified 717
590 nmdc:mga08y16_1337562_c1 3300050511 Bacteria 682
591 nmdc:mga08y16_21114_c1 3300050511 Bacteria 6874
592 nmdc:mga08y16_33978_c1 3300050511 Bacteria 5357
593 nmdc:mga08y16_52828_c1 3300050511 Unclassified 4250
594 nmdc:mga08y16_5651_c1 3300050511 Bacteria 13102
595 nmdc:mga0n895_103946_c1 3300050512 Bacteria 2852
596 nmdc:mga0n895_1045887_c1 3300050512 Archaea 796
597 nmdc:mga0n895_133562_c1 3300050512 Bacteria 2508
598 nmdc:mga0n895_17848_c1 3300050512 Bacteria 6552
599 nmdc:mga0n895_256790_c1 3300050512 Bacteria 1774
600 nmdc:mga0n895_301094_c1 3300050512 Bacteria 1625
601 nmdc:mga0n895_404259_c1 3300050512 Bacteria 1381
602 nmdc:mga0n895_602498_c1 3300050512 Bacteria 1101
603 nmdc:mga0n895_64718_c1 3300050512 Bacteria 3617
604 nmdc:mga0rr50_11158_c1 3300050513 Bacteria 5733
605 nmdc:mga0rr50_161242_c1 3300050513 Bacteria 1820
606 nmdc:mga0rr50_165476_c1 3300050513 Unclassified 1798
607 nmdc:mga0rr50_180329_c1 3300050513 Bacteria 1726
608 nmdc:mga0rr50_22447_c1 3300050513 Bacteria 4332
609 nmdc:mga0rr50_35375_c1 3300050513 Bacteria 3587
610 nmdc:mga0rr50_82805_c1 3300050513 Bacteria 2479
611 nmdc:mga08x19_520565_c1 3300050514 Unclassified 840
612 nmdc:mga0a205_111609_c1 3300050515 Bacteria 2633
613 nmdc:mga0a205_1128318_c1 3300050515 Bacteria 631
614 nmdc:mga0a205_162665_c1 3300050515 Bacteria 2128
615 nmdc:mga0a205_2564_c1 3300050515 Bacteria 16018
616 nmdc:mga0a205_27120_c1 3300050515 Bacteria 5469
617 nmdc:mga0a205_28075_c1 3300050515 Bacteria 5377
618 nmdc:mga0a205_292030_c1 3300050515 Unclassified 1504
619 nmdc:mga0a205_3887_c1 3300050515 Bacteria 13374
620 Ga0501084_0394059 3300054114 Unclassified 1170
621 Ga0530510_0044836 3300061734 Bacteria 3196
622 Ga0111539_10004760
623 Ga0065704_10011730
624 Ga0065712_10086172
625 Ga0065715_10001120
626 Ga0065715_10008396
627 Ga0065715_10020008
628 Ga0065707_10029583
629 Ga0070658_10004105
630 Ga0070676_10026178
631 Ga0070676_10293495
632 Ga0070676_10297499
633 Ga0070676_10522433
634 Ga0070683_100056236
635 Ga0070690_100078601
636 Ga0070690_100724074
637 Ga0070670_100030005
638 Ga0070670_100036504
639 Ga0070670_100041922
640 Ga0070670_100044318
641 Ga0070670_100069181
642 Ga0070670_100260967
643 Ga0070670_101299177
644 Ga0070677_10057905
645 Ga0068869_100009597
646 Ga0068869_100052552
647 Ga0068869_100101178
648 Ga0068869_100165018
649 Ga0070666_10041878
650 Ga0070666_10048192
651 Ga0070666_10075011
652 Ga0070680_100064706
653 Ga0070680_100359668
654 Ga0068868_100526869
655 Ga0070689_100021078
656 Ga0070689_100027948
657 Ga0070689_100042509
658 Ga0070689_100126041
659 Ga0070689_100766115
660 Ga0070691_10205879
661 Ga0070687_100007916
662 Ga0070687_100055193
663 Ga0070661_100011066
664 Ga0070661_100507234
665 Ga0070661_100587212
666 Ga0070692_10048232
667 Ga0070668_100054433
668 Ga0070668_100251965
669 Ga0070668_100258393
670 Ga0070669_100008531
671 Ga0070669_100044698
672 Ga0070669_100180281
673 Ga0070669_100370338
674 Ga0070669_100417525
675 Ga0070675_100006227
676 Ga0070675_100012013
677 Ga0070675_100093728
678 Ga0070675_100139638
679 Ga0070675_100155469
680 Ga0070675_100178433
681 Ga0070675_100540531
682 Ga0070671_100034650
683 Ga0070671_100063218
684 Ga0070671_100077325
685 Ga0070671_100806370
686 Ga0070674_100069893
687 Ga0070674_100084627
688 Ga0070674_100264527
689 Ga0070673_100000688
690 Ga0070673_100120755
691 Ga0070673_100219592
692 Ga0070673_100223171
693 Ga0070673_100355616
694 Ga0070688_100050215
695 Ga0070688_100079582
696 Ga0070688_100124766
697 Ga0070688_100298284
698 Ga0070688_100386578
699 Ga0070659_100010308
700 Ga0070659_100201385
701 Ga0070659_100500279
702 Ga0070659_100831685
703 Ga0070667_100055429
704 Ga0070667_100173576
705 Ga0070667_100991985
706 Ga0070667_101168734
707 Ga0070713_100038288
708 Ga0070701_10185137
709 Ga0070701_10207991
710 Ga0070701_10400933
711 Ga0070705_100000663
712 Ga0070705_100028536
713 Ga0070700_100095772
714 Ga0070700_100115009
715 Ga0070700_100166982
716 Ga0070700_100461142
717 Ga0070694_100003294
718 Ga0070694_100027872
719 Ga0070694_100119152
720 Ga0070694_100167153
721 Ga0070708_100330169
722 Ga0070708_100334088
723 Ga0070663_100022145
724 Ga0070663_100161407
725 Ga0070663_100200773
726 Ga0070663_100527412
727 Ga0070678_100011365
728 Ga0070678_100104995
729 Ga0070678_100120539
730 Ga0070678_100337088
731 Ga0070662_100006502
732 Ga0070662_100230835
733 Ga0070662_100536433
734 Ga0070681_10244319
735 Ga0070681_10788828
736 Ga0068867_100001539
737 Ga0068867_100019325
738 Ga0068867_100948480
739 Ga0070685_10546304
740 Ga0070706_100041913
741 Ga0070707_100049308
742 Ga0070707_100629991
743 Ga0070707_101263107
744 Ga0070698_100005649
745 Ga0070698_100010484
746 Ga0070699_100001875
747 Ga0070699_100015842
748 Ga0070699_100049322
749 Ga0070699_100158121
750 Ga0070679_100155234
751 Ga0070679_100548022
752 Ga0070684_100000301
753 Ga0070684_101529943
754 Ga0070697_100286966
755 Ga0068853_100372041
756 Ga0068853_100503057
757 Ga0070672_100011492
758 Ga0070672_100068383
759 Ga0070672_100087983
760 Ga0070672_100105952
761 Ga0070672_100111518
762 Ga0070672_100268228
763 Ga0070672_100328119
764 Ga0070686_100125639
765 Ga0070686_100129444
766 Ga0070695_100000212
767 Ga0070695_100082183
768 Ga0070695_100216591
769 Ga0070696_100000342
770 Ga0070696_100017664
771 Ga0070696_100024237
772 Ga0070696_100090176
773 Ga0070696_100351040
774 Ga0070696_100719907
775 Ga0070693_100023253
776 Ga0070704_100002704
777 Ga0070704_100007519
778 Ga0070704_100008968
779 Ga0070704_100086572
780 Ga0070704_100531501
781 Ga0070704_101001444
782 Ga0070664_100002048
783 Ga0070664_100068932
784 Ga0070664_100236761
785 Ga0070664_100247314
786 Ga0068857_100009596
787 Ga0068857_100012658
788 Ga0068857_100039005
789 Ga0068857_100090601
790 Ga0068857_100206290
791 Ga0068854_100101768
792 Ga0068856_100055868
793 Ga0070702_100129588
794 Ga0068852_100078907
795 Ga0068852_100151500
796 Ga0068852_100395255
797 Ga0068859_100002208
798 Ga0068859_100019857
799 Ga0068859_100272196
800 Ga0068864_100072226
801 Ga0068864_100072375
802 Ga0068864_100213332
803 Ga0068864_100219892
804 Ga0068864_100325707
805 Ga0068861_100002093
806 Ga0068861_100135762
807 Ga0068861_100541267
808 Ga0068861_100574652
809 Ga0068861_100580540
810 Ga0068870_10019223
811 Ga0068870_10091342
812 Ga0068863_100103021
813 Ga0068863_100364354
814 Ga0068858_100162587
815 Ga0068860_100003414
816 Ga0068860_100044658
817 Ga0068860_100115102
818 Ga0068862_100000827
819 Ga0081455_10081424
820 Ga0075364_10036370
821 Ga0075432_10020224
822 Ga0075432_10084960
823 Ga0068871_100275490
824 Ga0068871_100353356
825 Ga0075428_100001698
826 Ga0075428_100003344
827 Ga0075428_100009452
828 Ga0075428_100139937
829 Ga0075428_100203416
830 Ga0075428_100937550
831 Ga0075430_100007576
832 Ga0075430_100798356
833 Ga0075431_100034639
834 Ga0075431_100044914
835 Ga0075431_100103657
836 Ga0075431_100149086
837 Ga0075431_100150757
838 Ga0075431_100558708
839 Ga0075433_10037546
840 Ga0075433_10050276
841 Ga0075433_10194590
842 Ga0075433_10254352
843 Ga0075433_10261082
844 Ga0075433_10806459
845 Ga0075434_100002926
846 Ga0075434_100018114
847 Ga0075434_100019878
848 Ga0075434_100078225
849 Ga0075434_100180920
850 Ga0075434_100206639
851 Ga0075434_100219015
852 Ga0075434_100296438
853 Ga0075434_100360597
854 Ga0075434_100568870
855 Ga0075434_100907179
856 Ga0075429_100126233
857 Ga0075429_100209360
858 Ga0068865_100059008
859 Ga0068865_100203341
860 Ga0075436_100706763
861 Ga0075436_100813984
862 Ga0097620_100002208
863 Ga0097620_100019857
864 Ga0097620_100272214
865 Ga0075435_100000569
866 Ga0075435_100006387
867 Ga0075435_100015656
868 Ga0075435_100043659
869 Ga0075435_100051652
870 Ga0075435_100194434
871 Ga0111539_10000112
872 Ga0111539_10071637
873 Ga0111539_10099093
874 Ga0111539_10145577
875 Ga0111539_10246517
876 Ga0111539_10793961
877 Ga0111539_10983055
878 Ga0111539_11943730
879 Ga0105245_10140761
880 Ga0105245_11409631
881 Ga0114129_10000827
882 Ga0114129_10011640
883 Ga0114129_10014871
884 Ga0114129_10049443
885 Ga0114129_10077488
886 Ga0114129_10513694
887 Ga0105243_10063535
888 Ga0105243_10099909
889 Ga0105241_10018160
890 Ga0105242_10051901
891 Ga0105242_10178454
892 Ga0105248_10234447
893 Ga0105248_10464475
894 Ga0105249_10021912
895 Ga0105249_10023851
896 Ga0105249_10215520
897 Ga0105249_10230067
898 Ga0105239_10212655
899 Ga0157370_10494554
900 Ga0157374_10185193
901 Ga0157378_10103868
902 Ga0163162_10134000
903 Ga0157372_11543458
904 Ga0157375_10003263
905 Ga0157375_10095345
906 Ga0157375_10170558
907 Ga0157375_10226890
908 Ga0157375_10434227
909 Ga0163163_10078490
910 Ga0163163_10315017
911 Ga0157380_10008182
912 Ga0157380_10712073
913 Ga0157377_10091827
914 Ga0157377_10263612
915 Ga0157379_10612874
916 Ga0157376_10290876
917 Ga0157376_10362377
918 Ga0163161_10402495
919 Ga0207697_10176143
920 Ga0207653_10036964
921 Ga0207682_10015781
922 Ga0207642_10043171
923 Ga0207688_10005054
924 Ga0207688_10038732
925 Ga0207688_10100313
926 Ga0207680_10058594
927 Ga0207680_10077519
928 Ga0207680_10288076
929 Ga0207645_10057445
930 Ga0207645_10222221
931 Ga0207643_10005120
932 Ga0207643_10014418
933 Ga0207643_10083091
934 Ga0207643_10399476
935 Ga0207705_10054199
936 Ga0207654_10088977
937 Ga0207707_10055001
938 Ga0207707_10490173
939 Ga0207695_10170343
940 Ga0207660_10041690
941 Ga0207660_10119903
942 Ga0207660_10350641
943 Ga0207660_10869839
944 Ga0207662_10002158
945 Ga0207662_10007709
946 Ga0207662_10091866
947 Ga0207662_10164080
948 Ga0207649_10019888
949 Ga0207649_10111038
950 Ga0207649_10440292
951 Ga0207649_10457376
952 Ga0207649_10744873
953 Ga0207652_10236524
954 Ga0207652_10588383
955 Ga0207646_10484471
956 Ga0207681_10021426
957 Ga0207681_10033883
958 Ga0207681_10108260
959 Ga0207681_10125501
960 Ga0207681_10211687
961 Ga0207650_10012538
962 Ga0207650_10030181
963 Ga0207650_10041168
964 Ga0207650_10048543
965 Ga0207650_10113967
966 Ga0207650_10433417
967 Ga0207650_10472305
968 Ga0207659_10000905
969 Ga0207659_10040720
970 Ga0207659_10115926
971 Ga0207659_10201993
972 Ga0207659_10327548
973 Ga0207659_10466055
974 Ga0207659_11064031
975 Ga0207687_10164831
976 Ga0207687_10940146
977 Ga0207700_10015971
978 Ga0207644_10018142
979 Ga0207644_10046856
980 Ga0207690_10007478
981 Ga0207690_10187175
982 Ga0207690_10418041
983 Ga0207706_10019899
984 Ga0207706_10263252
985 Ga0207706_10374448
986 Ga0207706_10628898
987 Ga0207686_10099351
988 Ga0207709_10140976
989 Ga0207670_10006465
990 Ga0207670_10006980
991 Ga0207670_10084683
992 Ga0207670_10263062
993 Ga0207670_10479724
994 Ga0207669_10088141
995 Ga0207669_10231843
996 Ga0207691_10006450
997 Ga0207691_10006903
998 Ga0207691_10026207
999 Ga0207691_10043130
1000 Ga0207691_10214752
1001 Ga0207691_10258839
1002 Ga0207691_10418348
1003 Ga0207691_10562529
1004 Ga0207711_10355524
1005 Ga0207711_10425320
1006 Ga0207689_10066591
1007 Ga0207689_10129294
1008 Ga0207689_10157746
1009 Ga0207689_10237871
1010 Ga0207661_10003320
1011 Ga0207661_10059774
1012 Ga0207679_10004857
1013 Ga0207679_10191852
1014 Ga0207679_10209288
1015 Ga0207679_10228861
1016 Ga0207667_10120974
1017 Ga0207651_10000958
1018 Ga0207651_10028626
1019 Ga0207651_10062890
1020 Ga0207651_10452189
1021 Ga0207651_10886098
1022 Ga0207712_10549743
1023 Ga0207668_10049217
1024 Ga0207668_10144970
1025 Ga0207668_10915680
1026 Ga0207640_10029535
1027 Ga0207640_11079770
1028 Ga0207658_10128078
1029 Ga0207658_10184598
1030 Ga0207658_10202898
1031 Ga0207677_10108330
1032 Ga0207677_10275094
1033 Ga0207677_10884529
1034 Ga0207639_10405084
1035 Ga0207678_10014169
1036 Ga0207708_10016904
1037 Ga0207708_10120217
1038 Ga0207708_10120458
1039 Ga0207708_10515084
1040 Ga0207702_10106222
1041 Ga0207641_10120991
1042 Ga0207641_10611983
1043 Ga0207648_10010176
1044 Ga0207648_10030461
1045 Ga0207648_10142191
1046 Ga0207676_10086073
1047 Ga0207674_10015147
1048 Ga0207674_10057123
1049 Ga0207674_10059622
1050 Ga0207675_100005902
1051 Ga0207675_100238619
1052 Ga0207675_100281491
1053 Ga0207675_100312817
1054 Ga0207675_100676414
1055 Ga0207683_10051493
1056 Ga0207683_10064077
1057 Ga0207683_10073377
1058 Ga0207683_10236373
1059 Ga0207698_10091746
1060 Ga0209971_1033597
1061 Ga0207428_10001411
1062 Ga0207428_10026431
1063 Ga0268265_10000420
1064 Ga0268265_10072494
1065 Ga0268265_10081661
1066 Ga0268265_10321991
1067 Ga0268264_10005134
1068 Ga0268264_10129910
1069 Ga0268264_10200762
1070 Ga0307408_100134955
1071 Ga0307413_10061126
1072 Ga0307413_10905851
1073 Ga0307413_11196144
1074 Ga0307407_10121799
1075 Ga0307409_100070191
1076 Ga0307409_100175691
1077 Ga0307409_100944024
1078 Ga0307416_100287352
1079 Ga0307416_100783970
1080 Ga0307416_100787074
1081 Ga0307416_100927385
1082 Ga0307415_100221497
1083 Ga0373929_0072445
1084 Ga0373949_0131039
1085 Ga0373951_0138821
1086 Ga0373952_0135497
1087 Ga0373932_0105786
1088 Ga0373939_0033080
1089 Ga0373957_0108086
1090 Ga0373960_0025582
1091 Ga0373946_0011622
1092 Ga0373955_0240551
1093 Ga0373962_0184466
1094 Ga0373937_0084641
1095 Ga0373925_0388507
1096 Ga0451807_1355736
1097 Ga0439431_0005387
1098 Ga0439441_018676
1099 Ga0439445_0038993
1100 Ga0439455_0079221
1101 Ga0439462_0041911
1102 Ga0450914_020173
1103 Ga0450923_007995
1104 Ga0450897_023855
1105 Ga0450898_033365
1106 Ga0450900_035754
1107 Ga0439446_0031774
1108 Ga0439446_0051438
1109 Ga0439446_0098911
1110 Ga0439446_0165322
1111 Ga0439434_0143065
1112 Ga0439435_0044547
1113 Ga0439460_0056622
1114 Ga0450918_065802
1115 Ga0451577_0004260
1116 Ga0451577_0013210
1117 Ga0451577_0133325
1118 Ga0439440_0078838
1119 Ga0453684_0716191
1120 Ga0451576_0041577
1121 Ga0451576_0066107
1122 Ga0451576_0197816
1123 Ga0451576_0278051
1124 Ga0495662_0061255
1125 Ga0495584_0279460
1126 Ga0495585_0106374
1127 Ga0495594_0033655
1128 Ga0495637_0224331
1129 Ga0495643_0006181
1130 Ga0495644_0052347
1131 Ga0495663_0018831
1132 Ga0495663_0124788
1133 Ga0495598_0003305
1134 Ga0495609_0033897
1135 Ga0495621_0005565
1136 Ga0495621_0021046
1137 Ga0495621_0219858
1138 Ga0495633_0019436
1139 Ga0495656_0021811
1140 Ga0495656_0080371
1141 Ga0495659_0001218
1142 Ga0495659_0038446
1143 Ga0495659_0066287
1144 Ga0495659_0134914
1145 Ga0495599_0009516
1146 Ga0495658_0115151
1147 Ga0495669_0015271
1148 Ga0495669_0127553
1149 Ga0495670_0204224
1150 Ga0495604_0327833
1151 Ga0495636_0066304
1152 Ga0495676_0078516
1153 Ga0495677_0170563
1154 Ga0496104_0009907
1155 Ga0496106_0323852
1156 Ga0496108_0004789
1157 Ga0496109_0013120
1158 Ga0496109_0656601
1159 Ga0496110_0043734
1160 Ga0496110_0231975
1161 Ga0496111_0016075
1162 Ga0496111_0549487
1163 Ga0496112_0003645
1164 Ga0496112_0264469
1165 Ga0496113_0129464
1166 Ga0501036_0159088
1167 Ga0501036_0212321
1168 Ga0501037_0039741
1169 Ga0501038_0116757
1170 Ga0501040_0021717
1171 Ga0501040_0915278
1172 Ga0501041_0036184
1173 Ga0501042_0007351
1174 Ga0501042_0385783
1175 Ga0501046_0044057
1176 Ga0501048_0047735
1177 Ga0501067_0066044
1178 Ga0501069_0133750
1179 Ga0501069_0481283
1180 Ga0501071_0677296
1181 Ga0501072_0034054
1182 Ga0501072_0045119
1183 Ga0501075_0068900
1184 Ga0501076_0139316
1185 Ga0501076_0515346
1186 Ga0501077_0014511
1187 Ga0501077_0299189
1188 Ga0501079_0026759
1189 Ga0501079_0037905
1190 Ga0501079_0114625
1191 Ga0501080_0058973
1192 Ga0501080_0172067
1193 Ga0501081_0101534
1194 Ga0501081_0395789
1195 Ga0501083_0073440
1196 Ga0501045_0069766
1197 nmdc:mga00v17_10507_c1
1198 nmdc:mga05p37_1334207_c1
1199 nmdc:mga05p37_19777_c1
1200 nmdc:mga05p37_37631_c1
1201 nmdc:mga05p37_63194_c1
1202 nmdc:mga05p37_765850_c1
1203 nmdc:mga09592_67719_c1
1204 nmdc:mga0qj67_120078_c1
1205 nmdc:mga0qj67_510370_c1
1206 nmdc:mga0qj67_737123_c1
1207 nmdc:mga06r32_228720_c1
1208 nmdc:mga06r32_303917_c1
1209 nmdc:mga08y16_122115_c1
1210 nmdc:mga08y16_1234298_c1
1211 nmdc:mga08y16_1337562_c1
1212 nmdc:mga08y16_21114_c1
1213 nmdc:mga08y16_33978_c1
1214 nmdc:mga08y16_52828_c1
1215 nmdc:mga08y16_5651_c1
1216 nmdc:mga0n895_103946_c1
1217 nmdc:mga0n895_1045887_c1
1218 nmdc:mga0n895_133562_c1
1219 nmdc:mga0n895_17848_c1
1220 nmdc:mga0n895_256790_c1
1221 nmdc:mga0n895_301094_c1
1222 nmdc:mga0n895_404259_c1
1223 nmdc:mga0n895_602498_c1
1224 nmdc:mga0n895_64718_c1
1225 nmdc:mga0rr50_11158_c1
1226 nmdc:mga0rr50_161242_c1
1227 nmdc:mga0rr50_165476_c1
1228 nmdc:mga0rr50_180329_c1
1229 nmdc:mga0rr50_22447_c1
1230 nmdc:mga0rr50_35375_c1
1231 nmdc:mga0rr50_82805_c1
1232 nmdc:mga08x19_520565_c1
1233 nmdc:mga0a205_111609_c1
1234 nmdc:mga0a205_1128318_c1
1235 nmdc:mga0a205_162665_c1
1236 nmdc:mga0a205_2564_c1
1237 nmdc:mga0a205_27120_c1
1238 nmdc:mga0a205_28075_c1
1239 nmdc:mga0a205_292030_c1
1240 nmdc:mga0a205_3887_c1
1241 Ga0501084_0394059
1242 Ga0530510_0044836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

135

188

0.94

PF13242

Hydrolase_like

HAD-hyrolase-like

142

216

0.91

PF08645

PNK3P

Polynucleotide kinase 3 phosphatase

41

196

0.8

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

22

182

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.928 3 186
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.9132 3 186
3l8f-assembly1.cif.gz_A crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate 0.8978 1 185
3l8f-assembly1.cif.gz_A crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate 0.8884 1 185
2o2x-assembly1.cif.gz_A crystal structure of a putative had-like phosphatase (mll2559) from mesorhizobium loti at 1.50 a resolution 0.8585 2 189
ID Description Score Start End Superfamily
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9156 4 186 3.40.50.1000
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9007 4 186 3.40.50.1000
3l8gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.859 1 185 3.40.50.1000
2o2xA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8559 2 187 3.40.50.1000
2fpuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8551 1 150 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7V9BJV4-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9813 2 188 GO:0005737
GO:0005975
GO:0016791
AF-A0A3B0VDL7-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9783 3 185 GO:0005737
GO:0005975
GO:0016791
AF-A0A7T6AR85-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.975 2 188 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A3B0VDC1-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9749 2 188 GO:0005737
GO:0005975
GO:0016791
AF-A0A1F4U578-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.9718 1 186 GO:0005737
GO:0005975
GO:0016791
GO:0046872

Map