F469964
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 620 | 308 | 1240 | 257 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2829745981|2829746298 |
| Length | 297 |
| Sequence | SIPAPHRRGFLTAAAGLIGVSALGGCDRFAVTPTGRQTLKLGEDANLYVQRLLLTPASLAKEFPDSEISPWFKPNGTIDPQDRDYKSLAAKNFEGWKLRIDGLVENPQAFTLADLRALPVRTQTTRHDCVEGWSAIGKWTGVPLAEILKRAGLKPNARYVVFHCADTMEFAESDDTETANPDMTARAEGEENQASDSKAAGAEAPDADAPKGTPIRYYESIDLTDAYHPQTILAYDLNGKALPVSNGAPLRLRVERQLGYKQAKYVMRIEVRDTLKGVGDGEGGYWEDRGYEWYAGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 38 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 42 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 43 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 44 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 45 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 88 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 100 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 101 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 102 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 103 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 104 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 105 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 106 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 107 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 108 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 109 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 110 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 111 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 112 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 113 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 115 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 116 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 117 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 118 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 119 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 120 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 121 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 122 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 123 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 124 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 125 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 126 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 127 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 128 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 129 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 130 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 131 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 132 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 133 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 134 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 135 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 136 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 137 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 138 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 231 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 232 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 233 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 234 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 235 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 238 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 239 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 240 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 252 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 253 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 258 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 259 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 260 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 262 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 264 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 265 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 266 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 267 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 274 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 275 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 276 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 277 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 280 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 281 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 282 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 283 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 284 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 285 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 286 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 287 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 288 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 289 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 290 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 291 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 292 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 293 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 294 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 295 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 296 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 297 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 298 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 299 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 300 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 301 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 302 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 303 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 304 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 305 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 306 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 307 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 308 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.32 |
| Metatranscriptomes | 0 |
| Isolates | 4.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.61 |
| Nodule | 1.45 |
| Rhizoplane | 3.55 |
| Rhizosphere | 89.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_1683 | 2124908027 | Bacteria | 7205 |
| 2 | JGI25406J46586_10013109 | 3300003203 | Bacteria | 3575 |
| 3 | Ga0065714_10003326 | 3300005288 | Bacteria | 14195 |
| 4 | Ga0065714_10007124 | 3300005288 | Bacteria | 2991 |
| 5 | Ga0065714_10008554 | 3300005288 | Bacteria | 4016 |
| 6 | Ga0065714_10017731 | 3300005288 | Bacteria | 1502 |
| 7 | Ga0065712_10003822 | 3300005290 | Bacteria | 4057 |
| 8 | Ga0065715_10131774 | 3300005293 | Bacteria | 1995 |
| 9 | Ga0065707_10085957 | 3300005295 | Bacteria | 5768 |
| 10 | Ga0070658_10452507 | 3300005327 | Bacteria | 1106 |
| 11 | Ga0070690_100053755 | 3300005330 | Bacteria | 2577 |
| 12 | Ga0070690_100078903 | 3300005330 | Bacteria | 2152 |
| 13 | Ga0070670_100244776 | 3300005331 | Bacteria | 1561 |
| 14 | Ga0070666_10004502 | 3300005335 | Bacteria | 8492 |
| 15 | Ga0070680_100148030 | 3300005336 | Bacteria | 1971 |
| 16 | Ga0070680_100460207 | 3300005336 | Bacteria | 1087 |
| 17 | Ga0068868_100005917 | 3300005338 | Bacteria | 8630 |
| 18 | Ga0070660_100199296 | 3300005339 | Bacteria | 1624 |
| 19 | Ga0070689_100000450 | 3300005340 | Bacteria | 24317 |
| 20 | Ga0070668_100241366 | 3300005347 | Bacteria | 1497 |
| 21 | Ga0070675_100005533 | 3300005354 | Bacteria | 9669 |
| 22 | Ga0070674_100092639 | 3300005356 | Bacteria | 2185 |
| 23 | Ga0070673_100006766 | 3300005364 | Bacteria | 7481 |
| 24 | Ga0070667_100004652 | 3300005367 | Bacteria | 11521 |
| 25 | Ga0070667_100066329 | 3300005367 | Bacteria | 3067 |
| 26 | Ga0070709_10006639 | 3300005434 | Bacteria | 6315 |
| 27 | Ga0070714_100084424 | 3300005435 | Bacteria | 2771 |
| 28 | Ga0070713_100060241 | 3300005436 | Bacteria | 3173 |
| 29 | Ga0070662_100044454 | 3300005457 | Bacteria | 3181 |
| 30 | Ga0070706_100496301 | 3300005467 | Bacteria | 1136 |
| 31 | Ga0070699_100021566 | 3300005518 | Bacteria | 5555 |
| 32 | Ga0070699_100220518 | 3300005518 | Bacteria | 1690 |
| 33 | Ga0070697_100438995 | 3300005536 | Bacteria | 1136 |
| 34 | Ga0070672_100003112 | 3300005543 | Bacteria | 10706 |
| 35 | Ga0070693_100047535 | 3300005547 | Bacteria | 2442 |
| 36 | Ga0068859_100655220 | 3300005617 | Bacteria | 1142 |
| 37 | Ga0068858_100013306 | 3300005842 | Bacteria | 7759 |
| 38 | Ga0081455_10051393 | 3300005937 | Bacteria | 3536 |
| 39 | Ga0081539_10000178 | 3300005985 | Bacteria | 149201 |
| 40 | Ga0075364_10017503 | 3300006051 | Bacteria | 4478 |
| 41 | Ga0075364_10056866 | 3300006051 | Bacteria | 2562 |
| 42 | Ga0075362_10034827 | 3300006177 | Bacteria | 2196 |
| 43 | Ga0068871_100044103 | 3300006358 | Bacteria | 3584 |
| 44 | Ga0075428_100655621 | 3300006844 | Bacteria | 1119 |
| 45 | Ga0075433_10383526 | 3300006852 | Bacteria | 1241 |
| 46 | Ga0075434_100089594 | 3300006871 | Bacteria | 3077 |
| 47 | Ga0075436_100000191 | 3300006914 | Bacteria | 37759 |
| 48 | Ga0075436_100012337 | 3300006914 | Bacteria | 5856 |
| 49 | Ga0075436_100012626 | 3300006914 | Bacteria | 5787 |
| 50 | Ga0075436_100077286 | 3300006914 | Bacteria | 2306 |
| 51 | Ga0079104_1000441 | 3300006946 | Bacteria | 47199 |
| 52 | Ga0099826_10185119 | 3300006948 | Bacteria | 1154 |
| 53 | Ga0075435_100011103 | 3300007076 | Bacteria | 6606 |
| 54 | Ga0075435_100240174 | 3300007076 | Bacteria | 1541 |
| 55 | Ga0099794_10002127 | 3300007265 | Bacteria | 7200 |
| 56 | Ga0099794_10157337 | 3300007265 | Bacteria | 1155 |
| 57 | Ga0099795_10105637 | 3300007788 | Bacteria | 1110 |
| 58 | Ga0105251_10000551 | 3300009011 | Bacteria | 35219 |
| 59 | Ga0105251_10002380 | 3300009011 | Bacteria | 14876 |
| 60 | Ga0105244_10029351 | 3300009036 | Bacteria | 2941 |
| 61 | Ga0105250_10091296 | 3300009092 | Bacteria | 1239 |
| 62 | Ga0111539_10001236 | 3300009094 | Bacteria | 34016 |
| 63 | Ga0111539_10001845 | 3300009094 | Bacteria | 28186 |
| 64 | Ga0114129_10097609 | 3300009147 | Bacteria | 4067 |
| 65 | Ga0114129_10448467 | 3300009147 | Bacteria | 1692 |
| 66 | Ga0105248_10099781 | 3300009177 | Bacteria | 3272 |
| 67 | Ga0105238_10417517 | 3300009551 | Bacteria | 1336 |
| 68 | Ga0105246_10054656 | 3300011119 | Bacteria | 2753 |
| 69 | Ga0105246_10319892 | 3300011119 | Bacteria | 1260 |
| 70 | Ga0157371_10000379 | 3300013102 | Bacteria | 55919 |
| 71 | Ga0157371_10208249 | 3300013102 | Bacteria | 1403 |
| 72 | Ga0157378_10000218 | 3300013297 | Bacteria | 55703 |
| 73 | Ga0163162_10175494 | 3300013306 | Bacteria | 2268 |
| 74 | Ga0157375_10000481 | 3300013308 | Bacteria | 36338 |
| 75 | Ga0157375_11086145 | 3300013308 | Bacteria | 936 |
| 76 | Ga0157380_10647647 | 3300014326 | Bacteria | 1053 |
| 77 | Ga0182008_10032685 | 3300014497 | Bacteria | 2612 |
| 78 | Ga0157376_10021802 | 3300014969 | Bacteria | 4979 |
| 79 | Ga0182006_1026969 | 3300015261 | Bacteria | 2348 |
| 80 | Ga0182007_10015569 | 3300015262 | Bacteria | 2831 |
| 81 | Ga0182005_1000698 | 3300015265 | Bacteria | 15569 |
| 82 | Ga0163161_10000293 | 3300017792 | Bacteria | 43753 |
| 83 | Ga0163161_10002662 | 3300017792 | Bacteria | 12689 |
| 84 | Ga0163161_10015094 | 3300017792 | Bacteria | 5386 |
| 85 | Ga0163161_10232070 | 3300017792 | Bacteria | 1432 |
| 86 | Ga0209676_1003111 | 3300025292 | Bacteria | 10661 |
| 87 | Ga0209050_1000458 | 3300025298 | Bacteria | 73243 |
| 88 | Ga0207696_1005499 | 3300025711 | Bacteria | 5252 |
| 89 | Ga0207655_1054065 | 3300025728 | Bacteria | 1600 |
| 90 | Ga0207713_1000521 | 3300025735 | Bacteria | 38694 |
| 91 | Ga0207713_1007742 | 3300025735 | Bacteria | 6276 |
| 92 | Ga0207713_1021400 | 3300025735 | Bacteria | 3101 |
| 93 | Ga0207713_1030195 | 3300025735 | Bacteria | 2416 |
| 94 | Ga0207682_10023771 | 3300025893 | Bacteria | 2423 |
| 95 | Ga0207680_10040324 | 3300025903 | Bacteria | 2716 |
| 96 | Ga0207645_10003799 | 3300025907 | Bacteria | 11336 |
| 97 | Ga0207705_10199821 | 3300025909 | Bacteria | 1515 |
| 98 | Ga0207684_10575282 | 3300025910 | Bacteria | 963 |
| 99 | Ga0207660_10129466 | 3300025917 | Bacteria | 1920 |
| 100 | Ga0207657_10092379 | 3300025919 | Bacteria | 2522 |
| 101 | Ga0207646_10258273 | 3300025922 | Bacteria | 1575 |
| 102 | Ga0207659_10013114 | 3300025926 | Bacteria | 5299 |
| 103 | Ga0207706_10058721 | 3300025933 | Bacteria | 3388 |
| 104 | Ga0207669_10265400 | 3300025937 | Bacteria | 1286 |
| 105 | Ga0207665_10075160 | 3300025939 | Bacteria | 2314 |
| 106 | Ga0207665_10328210 | 3300025939 | Bacteria | 1150 |
| 107 | Ga0207691_10000725 | 3300025940 | Bacteria | 32565 |
| 108 | Ga0207679_10180323 | 3300025945 | Bacteria | 1747 |
| 109 | Ga0207651_10000222 | 3300025960 | Bacteria | 24389 |
| 110 | Ga0207668_10490304 | 3300025972 | Bacteria | 1055 |
| 111 | Ga0207677_10131301 | 3300026023 | Bacteria | 1902 |
| 112 | Ga0207683_10001120 | 3300026121 | Bacteria | 24378 |
| 113 | Ga0209281_1000199 | 3300027111 | Bacteria | 135753 |
| 114 | Ga0209973_1011877 | 3300027252 | Bacteria | 1051 |
| 115 | Ga0209969_1026055 | 3300027360 | Bacteria | 883 |
| 116 | Ga0209967_1000770 | 3300027364 | Bacteria | 4102 |
| 117 | Ga0209984_1004976 | 3300027424 | Bacteria | 1583 |
| 118 | Ga0210000_1000942 | 3300027462 | Bacteria | 4067 |
| 119 | Ga0209968_1014239 | 3300027526 | Bacteria | 1251 |
| 120 | Ga0209983_1002649 | 3300027665 | Bacteria | 3883 |
| 121 | Ga0209971_1006495 | 3300027682 | Bacteria | 2766 |
| 122 | Ga0209974_10002525 | 3300027876 | Bacteria | 6637 |
| 123 | Ga0207428_10007642 | 3300027907 | Bacteria | 9843 |
| 124 | Ga0207428_10015713 | 3300027907 | Bacteria | 6539 |
| 125 | Ga0207428_10086386 | 3300027907 | Bacteria | 2442 |
| 126 | Ga0207428_10127145 | 3300027907 | Bacteria | 1952 |
| 127 | Ga0207428_10195904 | 3300027907 | Bacteria | 1522 |
| 128 | Ga0268266_10084824 | 3300028379 | Bacteria | 2767 |
| 129 | Ga0307515_10132061 | 3300028794 | Bacteria | 2742 |
| 130 | Ga0307408_100138770 | 3300031548 | Bacteria | 1906 |
| 131 | Ga0307406_10074048 | 3300031901 | Bacteria | 2241 |
| 132 | Ga0316583_10006413 | 3300032133 | Bacteria | 4224 |
| 133 | Ga0373934_0000565 | 3300035086 | Bacteria | 13043 |
| 134 | Ga0373934_0073737 | 3300035086 | Bacteria | 1367 |
| 135 | Ga0373923_0035778 | 3300035111 | Bacteria | 2024 |
| 136 | Ga0373953_0035057 | 3300035117 | Bacteria | 1970 |
| 137 | Ga0373956_0000155 | 3300035119 | Bacteria | 25133 |
| 138 | Ga0373957_0004772 | 3300035120 | Bacteria | 4152 |
| 139 | Ga0373957_0050542 | 3300035120 | Bacteria | 1589 |
| 140 | Ga0373960_0006797 | 3300035121 | Bacteria | 2693 |
| 141 | Ga0373960_0019353 | 3300035121 | Bacteria | 1788 |
| 142 | Ga0373955_0008818 | 3300035172 | Bacteria | 4700 |
| 143 | Ga0373955_0017170 | 3300035172 | Bacteria | 3576 |
| 144 | Ga0373924_0002992 | 3300035410 | Bacteria | 5749 |
| 145 | Ga0373924_0019114 | 3300035410 | Bacteria | 2651 |
| 146 | Ga0373931_0028044 | 3300035691 | Bacteria | 2879 |
| 147 | Ga0373931_0113746 | 3300035691 | Bacteria | 1539 |
| 148 | Ga0373933_0002424 | 3300035724 | Bacteria | 10523 |
| 149 | Ga0373933_0005656 | 3300035724 | Bacteria | 6806 |
| 150 | Ga0373937_0012998 | 3300036401 | Bacteria | 7331 |
| 151 | Ga0373937_0048170 | 3300036401 | Bacteria | 3900 |
| 152 | Ga0373937_0104981 | 3300036401 | Bacteria | 2625 |
| 153 | Ga0373937_0215012 | 3300036401 | Bacteria | 1809 |
| 154 | Ga0373937_0291673 | 3300036401 | Bacteria | 1541 |
| 155 | Ga0439438_000700 | 3300041405 | Bacteria | 14983 |
| 156 | Ga0439438_009008 | 3300041405 | Bacteria | 3258 |
| 157 | Ga0439447_000261 | 3300041407 | Bacteria | 18544 |
| 158 | Ga0439466_0000837 | 3300041411 | Bacteria | 11712 |
| 159 | Ga0439466_0000966 | 3300041411 | Bacteria | 11046 |
| 160 | Ga0439466_0008123 | 3300041411 | Bacteria | 3956 |
| 161 | Ga0451841_0767028 | 3300041498 | Bacteria | 976 |
| 162 | Ga0439432_011691 | 3300042006 | Bacteria | 3020 |
| 163 | Ga0439432_050483 | 3300042006 | Bacteria | 1298 |
| 164 | Ga0439452_000035 | 3300042010 | Bacteria | 160387 |
| 165 | Ga0439452_000332 | 3300042010 | Bacteria | 29434 |
| 166 | Ga0439452_000618 | 3300042010 | Bacteria | 17964 |
| 167 | Ga0439452_004502 | 3300042010 | Bacteria | 4660 |
| 168 | Ga0439456_000702 | 3300042013 | Bacteria | 6875 |
| 169 | Ga0450911_000727 | 3300042115 | Bacteria | 9558 |
| 170 | Ga0450911_007927 | 3300042115 | Bacteria | 1525 |
| 171 | Ga0450920_013195 | 3300042122 | Bacteria | 1555 |
| 172 | Ga0450922_004406 | 3300042124 | Bacteria | 1292 |
| 173 | Ga0450902_000710 | 3300042137 | Bacteria | 4243 |
| 174 | Ga0450902_005830 | 3300042137 | Bacteria | 1876 |
| 175 | Ga0450903_000017 | 3300042138 | Bacteria | 32445 |
| 176 | Ga0450903_002873 | 3300042138 | Bacteria | 3013 |
| 177 | Ga0450903_007156 | 3300042138 | Bacteria | 1843 |
| 178 | Ga0450903_008812 | 3300042138 | Bacteria | 1648 |
| 179 | Ga0450903_011746 | 3300042138 | Bacteria | 1407 |
| 180 | Ga0450905_006491 | 3300042142 | Bacteria | 1583 |
| 181 | Ga0450907_000001 | 3300042146 | Bacteria | 236562 |
| 182 | Ga0450907_011683 | 3300042146 | Bacteria | 1458 |
| 183 | Ga0450910_002735 | 3300042147 | Bacteria | 2322 |
| 184 | Ga0439446_0021229 | 3300042156 | Bacteria | 1834 |
| 185 | Ga0450908_007407 | 3300042184 | Bacteria | 2069 |
| 186 | Ga0450909_000419 | 3300042185 | Bacteria | 5464 |
| 187 | Ga0439434_0000001 | 3300042435 | Bacteria | 86314 |
| 188 | Ga0439460_0005837 | 3300042461 | Bacteria | 3035 |
| 189 | Ga0439460_0057416 | 3300042461 | Bacteria | 1181 |
| 190 | Ga0450901_003480 | 3300042533 | Bacteria | 1640 |
| 191 | Ga0439440_0003315 | 3300042993 | Bacteria | 3096 |
| 192 | Ga0453684_0586013 | 3300044712 | Bacteria | 1224 |
| 193 | Ga0451576_0219374 | 3300045051 | Bacteria | 1986 |
| 194 | Ga0495617_000175 | 3300046452 | Bacteria | 40541 |
| 195 | Ga0495617_002727 | 3300046452 | Bacteria | 6827 |
| 196 | Ga0495617_003664 | 3300046452 | Bacteria | 5725 |
| 197 | Ga0495617_005932 | 3300046452 | Bacteria | 4310 |
| 198 | Ga0495617_012954 | 3300046452 | Bacteria | 2842 |
| 199 | Ga0495617_014958 | 3300046452 | Bacteria | 2633 |
| 200 | Ga0495617_167061 | 3300046452 | Bacteria | 696 |
| 201 | Ga0495627_004957 | 3300046453 | Bacteria | 5465 |
| 202 | Ga0495592_0001120 | 3300046454 | Bacteria | 18622 |
| 203 | Ga0495603_0000689 | 3300046455 | Bacteria | 19147 |
| 204 | Ga0495590_0000040 | 3300046457 | Bacteria | 122610 |
| 205 | Ga0495590_0001025 | 3300046457 | Bacteria | 12299 |
| 206 | Ga0495590_0006082 | 3300046457 | Bacteria | 4737 |
| 207 | Ga0495590_0006255 | 3300046457 | Bacteria | 4660 |
| 208 | Ga0495590_0009157 | 3300046457 | Bacteria | 3757 |
| 209 | Ga0495591_000049 | 3300046458 | Bacteria | 138951 |
| 210 | Ga0495591_001688 | 3300046458 | Bacteria | 13201 |
| 211 | Ga0495591_002062 | 3300046458 | Bacteria | 11625 |
| 212 | Ga0495591_004642 | 3300046458 | Bacteria | 6615 |
| 213 | Ga0495591_011864 | 3300046458 | Bacteria | 3275 |
| 214 | Ga0495591_012342 | 3300046458 | Bacteria | 3185 |
| 215 | Ga0495591_022392 | 3300046458 | Bacteria | 2042 |
| 216 | Ga0495591_029269 | 3300046458 | Bacteria | 1675 |
| 217 | Ga0495629_0021846 | 3300046459 | Bacteria | 4566 |
| 218 | Ga0495638_0000116 | 3300046460 | Bacteria | 128087 |
| 219 | Ga0495638_0000568 | 3300046460 | Bacteria | 41722 |
| 220 | Ga0495638_0000626 | 3300046460 | Bacteria | 39128 |
| 221 | Ga0495638_0000684 | 3300046460 | Bacteria | 36872 |
| 222 | Ga0495638_0001444 | 3300046460 | Bacteria | 21496 |
| 223 | Ga0495638_0001526 | 3300046460 | Bacteria | 20852 |
| 224 | Ga0495638_0003800 | 3300046460 | Bacteria | 11728 |
| 225 | Ga0495638_0013821 | 3300046460 | Bacteria | 5480 |
| 226 | Ga0495638_0017973 | 3300046460 | Bacteria | 4705 |
| 227 | Ga0495638_0031352 | 3300046460 | Bacteria | 3417 |
| 228 | Ga0495638_0049527 | 3300046460 | Bacteria | 2626 |
| 229 | Ga0495638_0051116 | 3300046460 | Bacteria | 2578 |
| 230 | Ga0495638_0051302 | 3300046460 | Bacteria | 2572 |
| 231 | Ga0495638_0133747 | 3300046460 | Bacteria | 1454 |
| 232 | Ga0495651_0004288 | 3300046462 | Bacteria | 10933 |
| 233 | Ga0495653_0019288 | 3300046463 | Bacteria | 5530 |
| 234 | Ga0495650_0002085 | 3300046471 | Bacteria | 17242 |
| 235 | Ga0495650_0012910 | 3300046471 | Bacteria | 4459 |
| 236 | Ga0495650_0029121 | 3300046471 | Bacteria | 2522 |
| 237 | Ga0495650_0089035 | 3300046471 | Bacteria | 1177 |
| 238 | Ga0495582_0010136 | 3300046473 | Bacteria | 5190 |
| 239 | Ga0495605_0000215 | 3300046474 | Bacteria | 71472 |
| 240 | Ga0495605_0000572 | 3300046474 | Bacteria | 29906 |
| 241 | Ga0495605_0024567 | 3300046474 | Bacteria | 3152 |
| 242 | Ga0495605_0033021 | 3300046474 | Bacteria | 2630 |
| 243 | Ga0495605_0042306 | 3300046474 | Bacteria | 2265 |
| 244 | Ga0495639_0003018 | 3300046475 | Bacteria | 7331 |
| 245 | Ga0495639_0032371 | 3300046475 | Bacteria | 2332 |
| 246 | Ga0495584_0000054 | 3300046491 | Bacteria | 85945 |
| 247 | Ga0495584_0001003 | 3300046491 | Bacteria | 17687 |
| 248 | Ga0495584_0010795 | 3300046491 | Bacteria | 4689 |
| 249 | Ga0495584_0010844 | 3300046491 | Bacteria | 4676 |
| 250 | Ga0495584_0011119 | 3300046491 | Bacteria | 4613 |
| 251 | Ga0495584_0015087 | 3300046491 | Bacteria | 3937 |
| 252 | Ga0495584_0026533 | 3300046491 | Bacteria | 2935 |
| 253 | Ga0495585_0000016 | 3300046492 | Bacteria | 175433 |
| 254 | Ga0495585_0000227 | 3300046492 | Bacteria | 57949 |
| 255 | Ga0495585_0000441 | 3300046492 | Bacteria | 39743 |
| 256 | Ga0495585_0005990 | 3300046492 | Bacteria | 7608 |
| 257 | Ga0495585_0012924 | 3300046492 | Bacteria | 4905 |
| 258 | Ga0495585_0027294 | 3300046492 | Bacteria | 3258 |
| 259 | Ga0495585_0178955 | 3300046492 | Bacteria | 1091 |
| 260 | Ga0495594_0007963 | 3300046499 | Bacteria | 5448 |
| 261 | Ga0495594_0035128 | 3300046499 | Bacteria | 2729 |
| 262 | Ga0495596_0000454 | 3300046500 | Bacteria | 26053 |
| 263 | Ga0495607_0003174 | 3300046501 | Bacteria | 12735 |
| 264 | Ga0495607_0004998 | 3300046501 | Bacteria | 9620 |
| 265 | Ga0495607_0029839 | 3300046501 | Bacteria | 3354 |
| 266 | Ga0495607_0029905 | 3300046501 | Bacteria | 3351 |
| 267 | Ga0495607_0035679 | 3300046501 | Bacteria | 3006 |
| 268 | Ga0495607_0052048 | 3300046501 | Bacteria | 2373 |
| 269 | Ga0495607_0119643 | 3300046501 | Bacteria | 1384 |
| 270 | Ga0495583_0000708 | 3300046506 | Bacteria | 42814 |
| 271 | Ga0495583_0001334 | 3300046506 | Bacteria | 25606 |
| 272 | Ga0495583_0001922 | 3300046506 | Bacteria | 19212 |
| 273 | Ga0495583_0003944 | 3300046506 | Bacteria | 10970 |
| 274 | Ga0495583_0018098 | 3300046506 | Bacteria | 3719 |
| 275 | Ga0495606_0005566 | 3300046507 | Bacteria | 12009 |
| 276 | Ga0495606_0011906 | 3300046507 | Bacteria | 7036 |
| 277 | Ga0495606_0025479 | 3300046507 | Bacteria | 4234 |
| 278 | Ga0495606_0106352 | 3300046507 | Bacteria | 1699 |
| 279 | Ga0495610_0000631 | 3300046512 | Bacteria | 34583 |
| 280 | Ga0495610_0007082 | 3300046512 | Bacteria | 7566 |
| 281 | Ga0495610_0007858 | 3300046512 | Bacteria | 7015 |
| 282 | Ga0495610_0008870 | 3300046512 | Bacteria | 6442 |
| 283 | Ga0495610_0016042 | 3300046512 | Bacteria | 4330 |
| 284 | Ga0495610_0016473 | 3300046512 | Bacteria | 4252 |
| 285 | Ga0495610_0026890 | 3300046512 | Bacteria | 3066 |
| 286 | Ga0495616_0005072 | 3300046513 | Bacteria | 8189 |
| 287 | Ga0495616_0007353 | 3300046513 | Bacteria | 6589 |
| 288 | Ga0495616_0036653 | 3300046513 | Bacteria | 2529 |
| 289 | Ga0495616_0087734 | 3300046513 | Bacteria | 1477 |
| 290 | Ga0495616_0119348 | 3300046513 | Bacteria | 1219 |
| 291 | Ga0495620_0003703 | 3300046515 | Bacteria | 8727 |
| 292 | Ga0495620_0003805 | 3300046515 | Bacteria | 8608 |
| 293 | Ga0495620_0010547 | 3300046515 | Bacteria | 4869 |
| 294 | Ga0495620_0044898 | 3300046515 | Bacteria | 1917 |
| 295 | Ga0495620_0076235 | 3300046515 | Bacteria | 1363 |
| 296 | Ga0495628_0000904 | 3300046516 | Bacteria | 27219 |
| 297 | Ga0495628_0097041 | 3300046516 | Bacteria | 2277 |
| 298 | Ga0495630_0011457 | 3300046517 | Bacteria | 6420 |
| 299 | Ga0495630_0046637 | 3300046517 | Bacteria | 3239 |
| 300 | Ga0495630_0154175 | 3300046517 | Bacteria | 1748 |
| 301 | Ga0495631_0001303 | 3300046518 | Bacteria | 15278 |
| 302 | Ga0495631_0024545 | 3300046518 | Bacteria | 2783 |
| 303 | Ga0495631_0053923 | 3300046518 | Bacteria | 1754 |
| 304 | Ga0495631_0099821 | 3300046518 | Bacteria | 1249 |
| 305 | Ga0495632_0000166 | 3300046519 | Bacteria | 68543 |
| 306 | Ga0495632_0000992 | 3300046519 | Bacteria | 24789 |
| 307 | Ga0495632_0002945 | 3300046519 | Bacteria | 12495 |
| 308 | Ga0495632_0004432 | 3300046519 | Bacteria | 9544 |
| 309 | Ga0495632_0006992 | 3300046519 | Bacteria | 7161 |
| 310 | Ga0495632_0013964 | 3300046519 | Bacteria | 4561 |
| 311 | Ga0495632_0016929 | 3300046519 | Bacteria | 4040 |
| 312 | Ga0495632_0027449 | 3300046519 | Bacteria | 2982 |
| 313 | Ga0495637_0000608 | 3300046520 | Bacteria | 25508 |
| 314 | Ga0495637_0000852 | 3300046520 | Bacteria | 19987 |
| 315 | Ga0495637_0000879 | 3300046520 | Bacteria | 19466 |
| 316 | Ga0495637_0002271 | 3300046520 | Bacteria | 10655 |
| 317 | Ga0495637_0002854 | 3300046520 | Bacteria | 9374 |
| 318 | Ga0495637_0004013 | 3300046520 | Bacteria | 7680 |
| 319 | Ga0495637_0006642 | 3300046520 | Bacteria | 5790 |
| 320 | Ga0495637_0012723 | 3300046520 | Bacteria | 4015 |
| 321 | Ga0495637_0032071 | 3300046520 | Bacteria | 2317 |
| 322 | Ga0495637_0033439 | 3300046520 | Bacteria | 2258 |
| 323 | Ga0495637_0040331 | 3300046520 | Bacteria | 2010 |
| 324 | Ga0495637_0060596 | 3300046520 | Bacteria | 1553 |
| 325 | Ga0495643_0022744 | 3300046522 | Bacteria | 3570 |
| 326 | Ga0495643_0026534 | 3300046522 | Bacteria | 3268 |
| 327 | Ga0495643_0027535 | 3300046522 | Bacteria | 3193 |
| 328 | Ga0495643_0055927 | 3300046522 | Bacteria | 2107 |
| 329 | Ga0495643_0059589 | 3300046522 | Bacteria | 2029 |
| 330 | Ga0495643_0065708 | 3300046522 | Bacteria | 1915 |
| 331 | Ga0495643_0089977 | 3300046522 | Bacteria | 1585 |
| 332 | Ga0495644_0000323 | 3300046523 | Bacteria | 21880 |
| 333 | Ga0495644_0000338 | 3300046523 | Bacteria | 21325 |
| 334 | Ga0495644_0006154 | 3300046523 | Bacteria | 4665 |
| 335 | Ga0495644_0021656 | 3300046523 | Bacteria | 2451 |
| 336 | Ga0495644_0035971 | 3300046523 | Bacteria | 1868 |
| 337 | Ga0495648_0000429 | 3300046524 | Bacteria | 46065 |
| 338 | Ga0495648_0000812 | 3300046524 | Bacteria | 33084 |
| 339 | Ga0495648_0001001 | 3300046524 | Bacteria | 28927 |
| 340 | Ga0495648_0009633 | 3300046524 | Bacteria | 7453 |
| 341 | Ga0495648_0026715 | 3300046524 | Bacteria | 3881 |
| 342 | Ga0495648_0060724 | 3300046524 | Bacteria | 2247 |
| 343 | Ga0495648_0125306 | 3300046524 | Bacteria | 1374 |
| 344 | Ga0495666_0010679 | 3300046526 | Bacteria | 4579 |
| 345 | Ga0495666_0027288 | 3300046526 | Bacteria | 2811 |
| 346 | Ga0495642_0000016 | 3300046528 | Bacteria | 114282 |
| 347 | Ga0495642_0000023 | 3300046528 | Bacteria | 94611 |
| 348 | Ga0495652_0005891 | 3300046529 | Bacteria | 11463 |
| 349 | Ga0495654_0001623 | 3300046530 | Bacteria | 15240 |
| 350 | Ga0495654_0001726 | 3300046530 | Bacteria | 14686 |
| 351 | Ga0495654_0001827 | 3300046530 | Bacteria | 14163 |
| 352 | Ga0495654_0001856 | 3300046530 | Bacteria | 14064 |
| 353 | Ga0495654_0002118 | 3300046530 | Bacteria | 12962 |
| 354 | Ga0495654_0002516 | 3300046530 | Bacteria | 11776 |
| 355 | Ga0495654_0002819 | 3300046530 | Bacteria | 10931 |
| 356 | Ga0495654_0009258 | 3300046530 | Bacteria | 5401 |
| 357 | Ga0495654_0018429 | 3300046530 | Bacteria | 3658 |
| 358 | Ga0495654_0031684 | 3300046530 | Bacteria | 2683 |
| 359 | Ga0495654_0159542 | 3300046530 | Bacteria | 991 |
| 360 | Ga0495587_0000989 | 3300046536 | Bacteria | 18668 |
| 361 | Ga0495587_0041805 | 3300046536 | Bacteria | 2734 |
| 362 | Ga0495609_0079041 | 3300046538 | Bacteria | 1439 |
| 363 | Ga0495609_0101386 | 3300046538 | Bacteria | 1247 |
| 364 | Ga0495597_0003494 | 3300046542 | Bacteria | 9115 |
| 365 | Ga0495597_0014775 | 3300046542 | Bacteria | 3713 |
| 366 | Ga0495597_0017058 | 3300046542 | Bacteria | 3422 |
| 367 | Ga0495597_0020516 | 3300046542 | Bacteria | 3077 |
| 368 | Ga0495597_0022736 | 3300046542 | Bacteria | 2905 |
| 369 | Ga0495597_0026792 | 3300046542 | Bacteria | 2647 |
| 370 | Ga0495597_0036388 | 3300046542 | Bacteria | 2216 |
| 371 | Ga0495597_0053033 | 3300046542 | Bacteria | 1784 |
| 372 | Ga0495645_0000272 | 3300046543 | Bacteria | 37937 |
| 373 | Ga0495645_0042198 | 3300046543 | Bacteria | 3326 |
| 374 | Ga0495645_0200304 | 3300046543 | Bacteria | 1355 |
| 375 | Ga0495622_0000335 | 3300046557 | Bacteria | 33842 |
| 376 | Ga0495622_0044069 | 3300046557 | Bacteria | 2074 |
| 377 | Ga0495633_0066673 | 3300046558 | Bacteria | 1681 |
| 378 | Ga0495667_0064961 | 3300046559 | Bacteria | 2387 |
| 379 | Ga0495656_0073407 | 3300046615 | Bacteria | 1525 |
| 380 | Ga0495656_0078310 | 3300046615 | Bacteria | 1485 |
| 381 | Ga0495656_0113875 | 3300046615 | Bacteria | 1269 |
| 382 | Ga0495668_0002065 | 3300046616 | Bacteria | 17398 |
| 383 | Ga0495668_0022748 | 3300046616 | Bacteria | 3581 |
| 384 | Ga0495634_0000572 | 3300046642 | Bacteria | 35710 |
| 385 | Ga0495611_0021658 | 3300046648 | Bacteria | 2777 |
| 386 | Ga0495625_0005341 | 3300046660 | Bacteria | 11763 |
| 387 | Ga0495625_0009587 | 3300046660 | Bacteria | 8085 |
| 388 | Ga0495625_0011666 | 3300046660 | Bacteria | 7148 |
| 389 | Ga0495625_0045370 | 3300046660 | Bacteria | 3177 |
| 390 | Ga0495625_0179276 | 3300046660 | Bacteria | 1410 |
| 391 | Ga0495625_0245748 | 3300046660 | Bacteria | 1163 |
| 392 | Ga0495635_0000115 | 3300046663 | Bacteria | 47781 |
| 393 | Ga0495635_0048482 | 3300046663 | Bacteria | 2928 |
| 394 | Ga0495659_0013740 | 3300046664 | Bacteria | 2640 |
| 395 | Ga0495661_0000686 | 3300046665 | Bacteria | 33766 |
| 396 | Ga0495661_0004926 | 3300046665 | Bacteria | 9553 |
| 397 | Ga0495661_0008810 | 3300046665 | Bacteria | 6960 |
| 398 | Ga0495661_0020156 | 3300046665 | Bacteria | 4359 |
| 399 | Ga0495588_0008021 | 3300046674 | Bacteria | 4827 |
| 400 | Ga0495657_0026028 | 3300046675 | Bacteria | 4148 |
| 401 | Ga0495657_0296348 | 3300046675 | Bacteria | 965 |
| 402 | Ga0495599_0001029 | 3300046678 | Bacteria | 15642 |
| 403 | Ga0495599_0247828 | 3300046678 | Bacteria | 1085 |
| 404 | Ga0495623_0000178 | 3300046679 | Bacteria | 39932 |
| 405 | Ga0495623_0122830 | 3300046679 | Bacteria | 1561 |
| 406 | Ga0495646_0008931 | 3300046680 | Bacteria | 6363 |
| 407 | Ga0495669_0031713 | 3300046684 | Bacteria | 2321 |
| 408 | Ga0495669_0107278 | 3300046684 | Bacteria | 1301 |
| 409 | Ga0495613_0014787 | 3300046689 | Bacteria | 5793 |
| 410 | Ga0495613_0072838 | 3300046689 | Bacteria | 2504 |
| 411 | Ga0495670_0000434 | 3300046691 | Bacteria | 19947 |
| 412 | Ga0495670_0008239 | 3300046691 | Bacteria | 5125 |
| 413 | Ga0495670_0012801 | 3300046691 | Bacteria | 4124 |
| 414 | Ga0495670_0059680 | 3300046691 | Bacteria | 1915 |
| 415 | Ga0495671_0000525 | 3300046692 | Bacteria | 29114 |
| 416 | Ga0495671_0015204 | 3300046692 | Bacteria | 4130 |
| 417 | Ga0495671_0023703 | 3300046692 | Bacteria | 3204 |
| 418 | Ga0495671_0036388 | 3300046692 | Bacteria | 2493 |
| 419 | Ga0495671_0037313 | 3300046692 | Bacteria | 2458 |
| 420 | Ga0495671_0083391 | 3300046692 | Bacteria | 1566 |
| 421 | Ga0495671_0253987 | 3300046692 | Bacteria | 848 |
| 422 | Ga0495649_0000763 | 3300046694 | Bacteria | 25899 |
| 423 | Ga0495649_0004154 | 3300046694 | Bacteria | 9510 |
| 424 | Ga0495649_0005691 | 3300046694 | Bacteria | 7865 |
| 425 | Ga0495649_0009385 | 3300046694 | Bacteria | 5821 |
| 426 | Ga0495649_0024657 | 3300046694 | Bacteria | 3353 |
| 427 | Ga0495649_0026407 | 3300046694 | Bacteria | 3228 |
| 428 | Ga0495649_0034645 | 3300046694 | Bacteria | 2777 |
| 429 | Ga0495589_0003127 | 3300046794 | Bacteria | 9054 |
| 430 | Ga0495589_0003965 | 3300046794 | Bacteria | 7944 |
| 431 | Ga0495589_0068118 | 3300046794 | Bacteria | 1741 |
| 432 | Ga0495660_0001030 | 3300046810 | Bacteria | 20218 |
| 433 | Ga0495660_0005589 | 3300046810 | Bacteria | 7523 |
| 434 | Ga0495660_0006827 | 3300046810 | Bacteria | 6730 |
| 435 | Ga0495660_0024645 | 3300046810 | Bacteria | 3426 |
| 436 | Ga0495660_0045562 | 3300046810 | Bacteria | 2407 |
| 437 | Ga0495660_0179098 | 3300046810 | Bacteria | 1026 |
| 438 | Ga0495581_0112418 | 3300047315 | Bacteria | 1583 |
| 439 | Ga0495604_0029107 | 3300047317 | Bacteria | 4395 |
| 440 | Ga0495604_0060721 | 3300047317 | Bacteria | 2893 |
| 441 | Ga0495604_0111365 | 3300047317 | Bacteria | 1995 |
| 442 | Ga0495672_0001022 | 3300047320 | Bacteria | 28756 |
| 443 | Ga0495672_0001954 | 3300047320 | Bacteria | 19485 |
| 444 | Ga0495672_0002006 | 3300047320 | Bacteria | 19232 |
| 445 | Ga0495672_0005214 | 3300047320 | Bacteria | 10355 |
| 446 | Ga0495672_0006243 | 3300047320 | Bacteria | 9294 |
| 447 | Ga0495672_0013902 | 3300047320 | Bacteria | 5534 |
| 448 | Ga0495672_0034687 | 3300047320 | Bacteria | 3114 |
| 449 | Ga0495672_0037343 | 3300047320 | Bacteria | 2973 |
| 450 | Ga0495672_0042569 | 3300047320 | Bacteria | 2737 |
| 451 | Ga0495672_0093475 | 3300047320 | Bacteria | 1646 |
| 452 | Ga0495672_0115239 | 3300047320 | Bacteria | 1436 |
| 453 | Ga0495680_0000459 | 3300047322 | Bacteria | 45776 |
| 454 | Ga0495680_0017091 | 3300047322 | Bacteria | 6206 |
| 455 | Ga0495683_0000116 | 3300047323 | Bacteria | 80411 |
| 456 | Ga0495683_0010374 | 3300047323 | Bacteria | 4924 |
| 457 | Ga0495683_0011556 | 3300047323 | Bacteria | 4644 |
| 458 | Ga0495683_0026108 | 3300047323 | Bacteria | 2989 |
| 459 | Ga0495683_0044127 | 3300047323 | Bacteria | 2242 |
| 460 | Ga0495683_0071844 | 3300047323 | Bacteria | 1697 |
| 461 | Ga0495687_000490 | 3300047443 | Bacteria | 47632 |
| 462 | Ga0495687_002535 | 3300047443 | Bacteria | 14477 |
| 463 | Ga0495677_0005333 | 3300047445 | Bacteria | 4876 |
| 464 | Ga0495679_004309 | 3300047446 | Bacteria | 6598 |
| 465 | Ga0495679_006614 | 3300047446 | Bacteria | 4958 |
| 466 | Ga0495685_020713 | 3300047447 | Bacteria | 2261 |
| 467 | Ga0495673_0000715 | 3300047469 | Bacteria | 32151 |
| 468 | Ga0495673_0000815 | 3300047469 | Bacteria | 29262 |
| 469 | Ga0495673_0001057 | 3300047469 | Bacteria | 24173 |
| 470 | Ga0495673_0001315 | 3300047469 | Bacteria | 20236 |
| 471 | Ga0495673_0002132 | 3300047469 | Bacteria | 14364 |
| 472 | Ga0495673_0003720 | 3300047469 | Bacteria | 9912 |
| 473 | Ga0495673_0008286 | 3300047469 | Bacteria | 5861 |
| 474 | Ga0495673_0028738 | 3300047469 | Bacteria | 2630 |
| 475 | Ga0495673_0038778 | 3300047469 | Bacteria | 2165 |
| 476 | Ga0495673_0066793 | 3300047469 | Bacteria | 1523 |
| 477 | Ga0495681_0000075 | 3300047470 | Bacteria | 89696 |
| 478 | Ga0495681_0000232 | 3300047470 | Bacteria | 46130 |
| 479 | Ga0495681_0000486 | 3300047470 | Bacteria | 30522 |
| 480 | Ga0495681_0004085 | 3300047470 | Bacteria | 10041 |
| 481 | Ga0495681_0004699 | 3300047470 | Bacteria | 9262 |
| 482 | Ga0495681_0006958 | 3300047470 | Bacteria | 7327 |
| 483 | Ga0495681_0009975 | 3300047470 | Bacteria | 5787 |
| 484 | Ga0495681_0043373 | 3300047470 | Bacteria | 2169 |
| 485 | Ga0495684_0070342 | 3300047471 | Bacteria | 2660 |
| 486 | Ga0495686_0000990 | 3300047472 | Bacteria | 34619 |
| 487 | Ga0495686_0033300 | 3300047472 | Bacteria | 3328 |
| 488 | Ga0495686_0214328 | 3300047472 | Bacteria | 1098 |
| 489 | Ga0495686_0230478 | 3300047472 | Bacteria | 1049 |
| 490 | Ga0495593_0014975 | 3300047673 | Bacteria | 4402 |
| 491 | Ga0495593_0084718 | 3300047673 | Bacteria | 1636 |
| 492 | Ga0495593_0147249 | 3300047673 | Bacteria | 1191 |
| 493 | Ga0495626_0000057 | 3300048091 | Bacteria | 148288 |
| 494 | Ga0495626_0000065 | 3300048091 | Bacteria | 141689 |
| 495 | Ga0495626_0000361 | 3300048091 | Bacteria | 47557 |
| 496 | Ga0495626_0021676 | 3300048091 | Bacteria | 3183 |
| 497 | Ga0495626_0022592 | 3300048091 | Bacteria | 3104 |
| 498 | Ga0496100_0276044 | 3300048903 | Bacteria | 1251 |
| 499 | Ga0496101_0315024 | 3300048904 | Bacteria | 1227 |
| 500 | Ga0496102_0000073 | 3300048905 | Bacteria | 149887 |
| 501 | Ga0496102_0024626 | 3300048905 | Bacteria | 5352 |
| 502 | Ga0496103_0000363 | 3300048906 | Bacteria | 40883 |
| 503 | Ga0496104_0000574 | 3300048907 | Bacteria | 31370 |
| 504 | Ga0496104_0004271 | 3300048907 | Bacteria | 12418 |
| 505 | Ga0496105_0025244 | 3300048908 | Bacteria | 4835 |
| 506 | Ga0496105_0051185 | 3300048908 | Bacteria | 3412 |
| 507 | Ga0496106_0004084 | 3300048909 | Bacteria | 10889 |
| 508 | Ga0496106_0393215 | 3300048909 | Bacteria | 1114 |
| 509 | Ga0496108_0072316 | 3300048911 | Bacteria | 2911 |
| 510 | Ga0496108_0110688 | 3300048911 | Bacteria | 2348 |
| 511 | Ga0496109_0044658 | 3300048912 | Bacteria | 4020 |
| 512 | Ga0496110_0131608 | 3300048913 | Bacteria | 2259 |
| 513 | Ga0496110_0221351 | 3300048913 | Bacteria | 1721 |
| 514 | Ga0496112_0146838 | 3300048915 | Bacteria | 2327 |
| 515 | Ga0496112_0500928 | 3300048915 | Bacteria | 1150 |
| 516 | Ga0496113_0059806 | 3300048916 | Bacteria | 2871 |
| 517 | Ga0496113_0223189 | 3300048916 | Bacteria | 1502 |
| 518 | Ga0496114_0090359 | 3300048917 | Bacteria | 2599 |
| 519 | Ga0496115_0076770 | 3300048918 | Bacteria | 2716 |
| 520 | Ga0496116_0160569 | 3300048919 | Bacteria | 1233 |
| 521 | Ga0496117_0001418 | 3300048920 | Bacteria | 34748 |
| 522 | Ga0496117_0093021 | 3300048920 | Bacteria | 1935 |
| 523 | Ga0496118_0005094 | 3300048921 | Bacteria | 15115 |
| 524 | Ga0496118_0102033 | 3300048921 | Bacteria | 1935 |
| 525 | Ga0496124_0001820 | 3300048927 | Bacteria | 29489 |
| 526 | Ga0496124_0058717 | 3300048927 | Bacteria | 3234 |
| 527 | Ga0496125_0005291 | 3300048928 | Bacteria | 14440 |
| 528 | Ga0495678_001342 | 3300049459 | Bacteria | 19691 |
| 529 | Ga0495678_008751 | 3300049459 | Bacteria | 5073 |
| 530 | Ga0495678_008974 | 3300049459 | Bacteria | 4995 |
| 531 | Ga0495678_018474 | 3300049459 | Bacteria | 3134 |
| 532 | Ga0495678_019438 | 3300049459 | Bacteria | 3029 |
| 533 | Ga0495678_025298 | 3300049459 | Bacteria | 2551 |
| 534 | Ga0495678_029172 | 3300049459 | Bacteria | 2319 |
| 535 | Ga0495678_061241 | 3300049459 | Bacteria | 1413 |
| 536 | Ga0495682_0005309 | 3300049460 | Bacteria | 5371 |
| 537 | Ga0495682_0032217 | 3300049460 | Bacteria | 1936 |
| 538 | Ga0495682_0065814 | 3300049460 | Bacteria | 1306 |
| 539 | Ga0495682_0070062 | 3300049460 | Bacteria | 1262 |
| 540 | Ga0495682_0076654 | 3300049460 | Bacteria | 1202 |
| 541 | Ga0501290_000012 | 3300049513 | Bacteria | 28888 |
| 542 | Ga0501292_000043 | 3300049515 | Bacteria | 28998 |
| 543 | Ga0501294_000563 | 3300049517 | Bacteria | 4265 |
| 544 | Ga0501300_000322 | 3300049523 | Bacteria | 7249 |
| 545 | Ga0501038_0288083 | 3300049574 | Bacteria | 1291 |
| 546 | Ga0501039_0055108 | 3300049575 | Bacteria | 3079 |
| 547 | Ga0501041_0042511 | 3300049577 | Bacteria | 2762 |
| 548 | Ga0501043_0099918 | 3300049579 | Bacteria | 2281 |
| 549 | Ga0501046_0046827 | 3300049580 | Bacteria | 3431 |
| 550 | Ga0501071_0348901 | 3300049587 | Bacteria | 1126 |
| 551 | Ga0501072_0119851 | 3300049588 | Bacteria | 2096 |
| 552 | Ga0501075_0021036 | 3300049591 | Bacteria | 4753 |
| 553 | Ga0501075_0140174 | 3300049591 | Bacteria | 1842 |
| 554 | Ga0501076_0010479 | 3300049592 | Bacteria | 6881 |
| 555 | Ga0501076_0113232 | 3300049592 | Bacteria | 2194 |
| 556 | Ga0501077_0119769 | 3300049593 | Bacteria | 1668 |
| 557 | Ga0501206_002530 | 3300049653 | Bacteria | 2305 |
| 558 | Ga0501222_016270 | 3300049662 | Bacteria | 983 |
| 559 | Ga0501223_001009 | 3300049663 | Bacteria | 6650 |
| 560 | Ga0501224_000380 | 3300049664 | Bacteria | 5258 |
| 561 | Ga0501227_007734 | 3300049665 | Bacteria | 2305 |
| 562 | Ga0501235_000932 | 3300049669 | Bacteria | 6041 |
| 563 | Ga0501259_003243 | 3300049688 | Bacteria | 2602 |
| 564 | Ga0501261_000028 | 3300049690 | Bacteria | 32508 |
| 565 | Ga0501221_008232 | 3300049704 | Bacteria | 1808 |
| 566 | Ga0501225_0000335 | 3300049705 | Bacteria | 14740 |
| 567 | Ga0501245_001972 | 3300049708 | Bacteria | 2713 |
| 568 | Ga0501083_0303802 | 3300049744 | Bacteria | 1038 |
| 569 | Ga0501279_000030 | 3300049775 | Bacteria | 37693 |
| 570 | Ga0501280_000040 | 3300049776 | Bacteria | 38251 |
| 571 | Ga0501281_02273 | 3300049777 | Bacteria | 1410 |
| 572 | Ga0501283_012527 | 3300049779 | Bacteria | 1275 |
| 573 | Ga0501045_0102623 | 3300049824 | Bacteria | 2117 |
| 574 | nmdc:mga03683_23160_c1 | 3300050489 | Bacteria | 2416 |
| 575 | nmdc:mga08y16_18347_c1 | 3300050511 | Bacteria | 7374 |
| 576 | nmdc:mga0rr50_480387_c1 | 3300050513 | Bacteria | 1055 |
| 577 | nmdc:mga0rr50_65342_c1 | 3300050513 | Bacteria | 2755 |
| 578 | nmdc:mga0rr50_88628_c1 | 3300050513 | Bacteria | 2404 |
| 579 | nmdc:mga08x19_144_c1 | 3300050514 | Bacteria | 61986 |
| 580 | nmdc:mga08x19_15499_c1 | 3300050514 | Bacteria | 4638 |
| 581 | nmdc:mga08x19_185908_c1 | 3300050514 | Bacteria | 1420 |
| 582 | nmdc:mga08x19_19327_c1 | 3300050514 | Bacteria | 4179 |
| 583 | nmdc:mga0a205_200314_c1 | 3300050515 | Bacteria | 1887 |
| 584 | Ga0500592_000077 | 3300053116 | Bacteria | 24748 |
| 585 | Ga0500593_000329 | 3300053117 | Bacteria | 19123 |
| 586 | Ga0500622_0048923 | 3300053156 | Bacteria | 2180 |
| 587 | Ga0500627_0006006 | 3300053158 | Bacteria | 4090 |
| 588 | Ga0501084_0096320 | 3300054114 | Bacteria | 2485 |
| 589 | Ga0501084_0124215 | 3300054114 | Bacteria | 2171 |
| 590 | Ga0501082_0088555 | 3300060353 | Bacteria | 2671 |
| 591 | Ga0530510_0132007 | 3300061734 | Bacteria | 1837 |
| 592 | 2829746298 | 2829745981 | Bacteria | 5406054 |
| 593 | 2511301209 | 2511231012 | Bacteria | 6738011 |
| 594 | 2511313003 | 2511231014 | Bacteria | 6462302 |
| 595 | 2511323449 | 2511231015 | Bacteria | 6598026 |
| 596 | 2511340461 | 2511231018 | Bacteria | 6436256 |
| 597 | 2511346661 | 2511231019 | Bacteria | 6520662 |
| 598 | 2511353570 | 2511231021 | Bacteria | 7302637 |
| 599 | 2587727861 | 2585428057 | Bacteria | 6737412 |
| 600 | 2643846036 | 2643221565 | Bacteria | 6216018 |
| 601 | 2643953878 | 2643221589 | Bacteria | 6250934 |
| 602 | 2644021812 | 2643221602 | Bacteria | 6249926 |
| 603 | 2644186965 | 2643221633 | Bacteria | 6733554 |
| 604 | 2739199980 | 2738543004 | Bacteria | 6381073 |
| 605 | 2739260139 | 2738543015 | Bacteria | 6750701 |
| 606 | 2774118895 | 2773857670 | Bacteria | 6407454 |
| 607 | 2784312534 | 2784132072 | Bacteria | 6596533 |
| 608 | 2808960108 | 2808606382 | Bacteria | 6841132 |
| 609 | 2842700331 | 2842698319 | Bacteria | 5190321 |
| 610 | 2861693839 | 2861691609 | Bacteria | 5628931 |
| 611 | 2904554546 | 2904550169 | Bacteria | 6221258 |
| 612 | 2908449725 | 2908446538 | Bacteria | 6829095 |
| 613 | 2939640188 | 2939636861 | Bacteria | 6297853 |
| 614 | 2946790686 | 2946787523 | Bacteria | 4366789 |
| 615 | 3007514982 | 3007511990 | Bacteria | 6481491 |
| 616 | 3007620285 | 3007619802 | Bacteria | 6411688 |
| 617 | 641336706 | 641228493 | Bacteria | 3999591 |
| 618 | 643391225 | 643348555 | Bacteria | 3914947 |
| 619 | 8056129634 | 8056125926 | Bacteria | 6228218 |
| 620 | 8056183997 | 8056177738 | Bacteria | 6748268 |
| 621 | MRS2a_Contig_1683 | |||
| 622 | JGI25406J46586_10013109 | |||
| 623 | Ga0065714_10003326 | |||
| 624 | Ga0065714_10007124 | |||
| 625 | Ga0065714_10008554 | |||
| 626 | Ga0065714_10017731 | |||
| 627 | Ga0065712_10003822 | |||
| 628 | Ga0065715_10131774 | |||
| 629 | Ga0065707_10085957 | |||
| 630 | Ga0070658_10452507 | |||
| 631 | Ga0070690_100053755 | |||
| 632 | Ga0070690_100078903 | |||
| 633 | Ga0070670_100244776 | |||
| 634 | Ga0070666_10004502 | |||
| 635 | Ga0070680_100148030 | |||
| 636 | Ga0070680_100460207 | |||
| 637 | Ga0068868_100005917 | |||
| 638 | Ga0070660_100199296 | |||
| 639 | Ga0070689_100000450 | |||
| 640 | Ga0070668_100241366 | |||
| 641 | Ga0070675_100005533 | |||
| 642 | Ga0070674_100092639 | |||
| 643 | Ga0070673_100006766 | |||
| 644 | Ga0070667_100004652 | |||
| 645 | Ga0070667_100066329 | |||
| 646 | Ga0070709_10006639 | |||
| 647 | Ga0070714_100084424 | |||
| 648 | Ga0070713_100060241 | |||
| 649 | Ga0070662_100044454 | |||
| 650 | Ga0070706_100496301 | |||
| 651 | Ga0070699_100021566 | |||
| 652 | Ga0070699_100220518 | |||
| 653 | Ga0070697_100438995 | |||
| 654 | Ga0070672_100003112 | |||
| 655 | Ga0070693_100047535 | |||
| 656 | Ga0068859_100655220 | |||
| 657 | Ga0068858_100013306 | |||
| 658 | Ga0081455_10051393 | |||
| 659 | Ga0081539_10000178 | |||
| 660 | Ga0075364_10017503 | |||
| 661 | Ga0075364_10056866 | |||
| 662 | Ga0075362_10034827 | |||
| 663 | Ga0068871_100044103 | |||
| 664 | Ga0075428_100655621 | |||
| 665 | Ga0075433_10383526 | |||
| 666 | Ga0075434_100089594 | |||
| 667 | Ga0075436_100000191 | |||
| 668 | Ga0075436_100012337 | |||
| 669 | Ga0075436_100012626 | |||
| 670 | Ga0075436_100077286 | |||
| 671 | Ga0079104_1000441 | |||
| 672 | Ga0099826_10185119 | |||
| 673 | Ga0075435_100011103 | |||
| 674 | Ga0075435_100240174 | |||
| 675 | Ga0099794_10002127 | |||
| 676 | Ga0099794_10157337 | |||
| 677 | Ga0099795_10105637 | |||
| 678 | Ga0105251_10000551 | |||
| 679 | Ga0105251_10002380 | |||
| 680 | Ga0105244_10029351 | |||
| 681 | Ga0105250_10091296 | |||
| 682 | Ga0111539_10001236 | |||
| 683 | Ga0111539_10001845 | |||
| 684 | Ga0114129_10097609 | |||
| 685 | Ga0114129_10448467 | |||
| 686 | Ga0105248_10099781 | |||
| 687 | Ga0105238_10417517 | |||
| 688 | Ga0105246_10054656 | |||
| 689 | Ga0105246_10319892 | |||
| 690 | Ga0157371_10000379 | |||
| 691 | Ga0157371_10208249 | |||
| 692 | Ga0157378_10000218 | |||
| 693 | Ga0163162_10175494 | |||
| 694 | Ga0157375_10000481 | |||
| 695 | Ga0157375_11086145 | |||
| 696 | Ga0157380_10647647 | |||
| 697 | Ga0182008_10032685 | |||
| 698 | Ga0157376_10021802 | |||
| 699 | Ga0182006_1026969 | |||
| 700 | Ga0182007_10015569 | |||
| 701 | Ga0182005_1000698 | |||
| 702 | Ga0163161_10000293 | |||
| 703 | Ga0163161_10002662 | |||
| 704 | Ga0163161_10015094 | |||
| 705 | Ga0163161_10232070 | |||
| 706 | Ga0209676_1003111 | |||
| 707 | Ga0209050_1000458 | |||
| 708 | Ga0207696_1005499 | |||
| 709 | Ga0207655_1054065 | |||
| 710 | Ga0207713_1000521 | |||
| 711 | Ga0207713_1007742 | |||
| 712 | Ga0207713_1021400 | |||
| 713 | Ga0207713_1030195 | |||
| 714 | Ga0207682_10023771 | |||
| 715 | Ga0207680_10040324 | |||
| 716 | Ga0207645_10003799 | |||
| 717 | Ga0207705_10199821 | |||
| 718 | Ga0207684_10575282 | |||
| 719 | Ga0207660_10129466 | |||
| 720 | Ga0207657_10092379 | |||
| 721 | Ga0207646_10258273 | |||
| 722 | Ga0207659_10013114 | |||
| 723 | Ga0207706_10058721 | |||
| 724 | Ga0207669_10265400 | |||
| 725 | Ga0207665_10075160 | |||
| 726 | Ga0207665_10328210 | |||
| 727 | Ga0207691_10000725 | |||
| 728 | Ga0207679_10180323 | |||
| 729 | Ga0207651_10000222 | |||
| 730 | Ga0207668_10490304 | |||
| 731 | Ga0207677_10131301 | |||
| 732 | Ga0207683_10001120 | |||
| 733 | Ga0209281_1000199 | |||
| 734 | Ga0209973_1011877 | |||
| 735 | Ga0209969_1026055 | |||
| 736 | Ga0209967_1000770 | |||
| 737 | Ga0209984_1004976 | |||
| 738 | Ga0210000_1000942 | |||
| 739 | Ga0209968_1014239 | |||
| 740 | Ga0209983_1002649 | |||
| 741 | Ga0209971_1006495 | |||
| 742 | Ga0209974_10002525 | |||
| 743 | Ga0207428_10007642 | |||
| 744 | Ga0207428_10015713 | |||
| 745 | Ga0207428_10086386 | |||
| 746 | Ga0207428_10127145 | |||
| 747 | Ga0207428_10195904 | |||
| 748 | Ga0268266_10084824 | |||
| 749 | Ga0307515_10132061 | |||
| 750 | Ga0307408_100138770 | |||
| 751 | Ga0307406_10074048 | |||
| 752 | Ga0316583_10006413 | |||
| 753 | Ga0373934_0000565 | |||
| 754 | Ga0373934_0073737 | |||
| 755 | Ga0373923_0035778 | |||
| 756 | Ga0373953_0035057 | |||
| 757 | Ga0373956_0000155 | |||
| 758 | Ga0373957_0004772 | |||
| 759 | Ga0373957_0050542 | |||
| 760 | Ga0373960_0006797 | |||
| 761 | Ga0373960_0019353 | |||
| 762 | Ga0373955_0008818 | |||
| 763 | Ga0373955_0017170 | |||
| 764 | Ga0373924_0002992 | |||
| 765 | Ga0373924_0019114 | |||
| 766 | Ga0373931_0028044 | |||
| 767 | Ga0373931_0113746 | |||
| 768 | Ga0373933_0002424 | |||
| 769 | Ga0373933_0005656 | |||
| 770 | Ga0373937_0012998 | |||
| 771 | Ga0373937_0048170 | |||
| 772 | Ga0373937_0104981 | |||
| 773 | Ga0373937_0215012 | |||
| 774 | Ga0373937_0291673 | |||
| 775 | Ga0439438_000700 | |||
| 776 | Ga0439438_009008 | |||
| 777 | Ga0439447_000261 | |||
| 778 | Ga0439466_0000837 | |||
| 779 | Ga0439466_0000966 | |||
| 780 | Ga0439466_0008123 | |||
| 781 | Ga0451841_0767028 | |||
| 782 | Ga0439432_011691 | |||
| 783 | Ga0439432_050483 | |||
| 784 | Ga0439452_000035 | |||
| 785 | Ga0439452_000332 | |||
| 786 | Ga0439452_000618 | |||
| 787 | Ga0439452_004502 | |||
| 788 | Ga0439456_000702 | |||
| 789 | Ga0450911_000727 | |||
| 790 | Ga0450911_007927 | |||
| 791 | Ga0450920_013195 | |||
| 792 | Ga0450922_004406 | |||
| 793 | Ga0450902_000710 | |||
| 794 | Ga0450902_005830 | |||
| 795 | Ga0450903_000017 | |||
| 796 | Ga0450903_002873 | |||
| 797 | Ga0450903_007156 | |||
| 798 | Ga0450903_008812 | |||
| 799 | Ga0450903_011746 | |||
| 800 | Ga0450905_006491 | |||
| 801 | Ga0450907_000001 | |||
| 802 | Ga0450907_011683 | |||
| 803 | Ga0450910_002735 | |||
| 804 | Ga0439446_0021229 | |||
| 805 | Ga0450908_007407 | |||
| 806 | Ga0450909_000419 | |||
| 807 | Ga0439434_0000001 | |||
| 808 | Ga0439460_0005837 | |||
| 809 | Ga0439460_0057416 | |||
| 810 | Ga0450901_003480 | |||
| 811 | Ga0439440_0003315 | |||
| 812 | Ga0453684_0586013 | |||
| 813 | Ga0451576_0219374 | |||
| 814 | Ga0495617_000175 | |||
| 815 | Ga0495617_002727 | |||
| 816 | Ga0495617_003664 | |||
| 817 | Ga0495617_005932 | |||
| 818 | Ga0495617_012954 | |||
| 819 | Ga0495617_014958 | |||
| 820 | Ga0495617_167061 | |||
| 821 | Ga0495627_004957 | |||
| 822 | Ga0495592_0001120 | |||
| 823 | Ga0495603_0000689 | |||
| 824 | Ga0495590_0000040 | |||
| 825 | Ga0495590_0001025 | |||
| 826 | Ga0495590_0006082 | |||
| 827 | Ga0495590_0006255 | |||
| 828 | Ga0495590_0009157 | |||
| 829 | Ga0495591_000049 | |||
| 830 | Ga0495591_001688 | |||
| 831 | Ga0495591_002062 | |||
| 832 | Ga0495591_004642 | |||
| 833 | Ga0495591_011864 | |||
| 834 | Ga0495591_012342 | |||
| 835 | Ga0495591_022392 | |||
| 836 | Ga0495591_029269 | |||
| 837 | Ga0495629_0021846 | |||
| 838 | Ga0495638_0000116 | |||
| 839 | Ga0495638_0000568 | |||
| 840 | Ga0495638_0000626 | |||
| 841 | Ga0495638_0000684 | |||
| 842 | Ga0495638_0001444 | |||
| 843 | Ga0495638_0001526 | |||
| 844 | Ga0495638_0003800 | |||
| 845 | Ga0495638_0013821 | |||
| 846 | Ga0495638_0017973 | |||
| 847 | Ga0495638_0031352 | |||
| 848 | Ga0495638_0049527 | |||
| 849 | Ga0495638_0051116 | |||
| 850 | Ga0495638_0051302 | |||
| 851 | Ga0495638_0133747 | |||
| 852 | Ga0495651_0004288 | |||
| 853 | Ga0495653_0019288 | |||
| 854 | Ga0495650_0002085 | |||
| 855 | Ga0495650_0012910 | |||
| 856 | Ga0495650_0029121 | |||
| 857 | Ga0495650_0089035 | |||
| 858 | Ga0495582_0010136 | |||
| 859 | Ga0495605_0000215 | |||
| 860 | Ga0495605_0000572 | |||
| 861 | Ga0495605_0024567 | |||
| 862 | Ga0495605_0033021 | |||
| 863 | Ga0495605_0042306 | |||
| 864 | Ga0495639_0003018 | |||
| 865 | Ga0495639_0032371 | |||
| 866 | Ga0495584_0000054 | |||
| 867 | Ga0495584_0001003 | |||
| 868 | Ga0495584_0010795 | |||
| 869 | Ga0495584_0010844 | |||
| 870 | Ga0495584_0011119 | |||
| 871 | Ga0495584_0015087 | |||
| 872 | Ga0495584_0026533 | |||
| 873 | Ga0495585_0000016 | |||
| 874 | Ga0495585_0000227 | |||
| 875 | Ga0495585_0000441 | |||
| 876 | Ga0495585_0005990 | |||
| 877 | Ga0495585_0012924 | |||
| 878 | Ga0495585_0027294 | |||
| 879 | Ga0495585_0178955 | |||
| 880 | Ga0495594_0007963 | |||
| 881 | Ga0495594_0035128 | |||
| 882 | Ga0495596_0000454 | |||
| 883 | Ga0495607_0003174 | |||
| 884 | Ga0495607_0004998 | |||
| 885 | Ga0495607_0029839 | |||
| 886 | Ga0495607_0029905 | |||
| 887 | Ga0495607_0035679 | |||
| 888 | Ga0495607_0052048 | |||
| 889 | Ga0495607_0119643 | |||
| 890 | Ga0495583_0000708 | |||
| 891 | Ga0495583_0001334 | |||
| 892 | Ga0495583_0001922 | |||
| 893 | Ga0495583_0003944 | |||
| 894 | Ga0495583_0018098 | |||
| 895 | Ga0495606_0005566 | |||
| 896 | Ga0495606_0011906 | |||
| 897 | Ga0495606_0025479 | |||
| 898 | Ga0495606_0106352 | |||
| 899 | Ga0495610_0000631 | |||
| 900 | Ga0495610_0007082 | |||
| 901 | Ga0495610_0007858 | |||
| 902 | Ga0495610_0008870 | |||
| 903 | Ga0495610_0016042 | |||
| 904 | Ga0495610_0016473 | |||
| 905 | Ga0495610_0026890 | |||
| 906 | Ga0495616_0005072 | |||
| 907 | Ga0495616_0007353 | |||
| 908 | Ga0495616_0036653 | |||
| 909 | Ga0495616_0087734 | |||
| 910 | Ga0495616_0119348 | |||
| 911 | Ga0495620_0003703 | |||
| 912 | Ga0495620_0003805 | |||
| 913 | Ga0495620_0010547 | |||
| 914 | Ga0495620_0044898 | |||
| 915 | Ga0495620_0076235 | |||
| 916 | Ga0495628_0000904 | |||
| 917 | Ga0495628_0097041 | |||
| 918 | Ga0495630_0011457 | |||
| 919 | Ga0495630_0046637 | |||
| 920 | Ga0495630_0154175 | |||
| 921 | Ga0495631_0001303 | |||
| 922 | Ga0495631_0024545 | |||
| 923 | Ga0495631_0053923 | |||
| 924 | Ga0495631_0099821 | |||
| 925 | Ga0495632_0000166 | |||
| 926 | Ga0495632_0000992 | |||
| 927 | Ga0495632_0002945 | |||
| 928 | Ga0495632_0004432 | |||
| 929 | Ga0495632_0006992 | |||
| 930 | Ga0495632_0013964 | |||
| 931 | Ga0495632_0016929 | |||
| 932 | Ga0495632_0027449 | |||
| 933 | Ga0495637_0000608 | |||
| 934 | Ga0495637_0000852 | |||
| 935 | Ga0495637_0000879 | |||
| 936 | Ga0495637_0002271 | |||
| 937 | Ga0495637_0002854 | |||
| 938 | Ga0495637_0004013 | |||
| 939 | Ga0495637_0006642 | |||
| 940 | Ga0495637_0012723 | |||
| 941 | Ga0495637_0032071 | |||
| 942 | Ga0495637_0033439 | |||
| 943 | Ga0495637_0040331 | |||
| 944 | Ga0495637_0060596 | |||
| 945 | Ga0495643_0022744 | |||
| 946 | Ga0495643_0026534 | |||
| 947 | Ga0495643_0027535 | |||
| 948 | Ga0495643_0055927 | |||
| 949 | Ga0495643_0059589 | |||
| 950 | Ga0495643_0065708 | |||
| 951 | Ga0495643_0089977 | |||
| 952 | Ga0495644_0000323 | |||
| 953 | Ga0495644_0000338 | |||
| 954 | Ga0495644_0006154 | |||
| 955 | Ga0495644_0021656 | |||
| 956 | Ga0495644_0035971 | |||
| 957 | Ga0495648_0000429 | |||
| 958 | Ga0495648_0000812 | |||
| 959 | Ga0495648_0001001 | |||
| 960 | Ga0495648_0009633 | |||
| 961 | Ga0495648_0026715 | |||
| 962 | Ga0495648_0060724 | |||
| 963 | Ga0495648_0125306 | |||
| 964 | Ga0495666_0010679 | |||
| 965 | Ga0495666_0027288 | |||
| 966 | Ga0495642_0000016 | |||
| 967 | Ga0495642_0000023 | |||
| 968 | Ga0495652_0005891 | |||
| 969 | Ga0495654_0001623 | |||
| 970 | Ga0495654_0001726 | |||
| 971 | Ga0495654_0001827 | |||
| 972 | Ga0495654_0001856 | |||
| 973 | Ga0495654_0002118 | |||
| 974 | Ga0495654_0002516 | |||
| 975 | Ga0495654_0002819 | |||
| 976 | Ga0495654_0009258 | |||
| 977 | Ga0495654_0018429 | |||
| 978 | Ga0495654_0031684 | |||
| 979 | Ga0495654_0159542 | |||
| 980 | Ga0495587_0000989 | |||
| 981 | Ga0495587_0041805 | |||
| 982 | Ga0495609_0079041 | |||
| 983 | Ga0495609_0101386 | |||
| 984 | Ga0495597_0003494 | |||
| 985 | Ga0495597_0014775 | |||
| 986 | Ga0495597_0017058 | |||
| 987 | Ga0495597_0020516 | |||
| 988 | Ga0495597_0022736 | |||
| 989 | Ga0495597_0026792 | |||
| 990 | Ga0495597_0036388 | |||
| 991 | Ga0495597_0053033 | |||
| 992 | Ga0495645_0000272 | |||
| 993 | Ga0495645_0042198 | |||
| 994 | Ga0495645_0200304 | |||
| 995 | Ga0495622_0000335 | |||
| 996 | Ga0495622_0044069 | |||
| 997 | Ga0495633_0066673 | |||
| 998 | Ga0495667_0064961 | |||
| 999 | Ga0495656_0073407 | |||
| 1000 | Ga0495656_0078310 | |||
| 1001 | Ga0495656_0113875 | |||
| 1002 | Ga0495668_0002065 | |||
| 1003 | Ga0495668_0022748 | |||
| 1004 | Ga0495634_0000572 | |||
| 1005 | Ga0495611_0021658 | |||
| 1006 | Ga0495625_0005341 | |||
| 1007 | Ga0495625_0009587 | |||
| 1008 | Ga0495625_0011666 | |||
| 1009 | Ga0495625_0045370 | |||
| 1010 | Ga0495625_0179276 | |||
| 1011 | Ga0495625_0245748 | |||
| 1012 | Ga0495635_0000115 | |||
| 1013 | Ga0495635_0048482 | |||
| 1014 | Ga0495659_0013740 | |||
| 1015 | Ga0495661_0000686 | |||
| 1016 | Ga0495661_0004926 | |||
| 1017 | Ga0495661_0008810 | |||
| 1018 | Ga0495661_0020156 | |||
| 1019 | Ga0495588_0008021 | |||
| 1020 | Ga0495657_0026028 | |||
| 1021 | Ga0495657_0296348 | |||
| 1022 | Ga0495599_0001029 | |||
| 1023 | Ga0495599_0247828 | |||
| 1024 | Ga0495623_0000178 | |||
| 1025 | Ga0495623_0122830 | |||
| 1026 | Ga0495646_0008931 | |||
| 1027 | Ga0495669_0031713 | |||
| 1028 | Ga0495669_0107278 | |||
| 1029 | Ga0495613_0014787 | |||
| 1030 | Ga0495613_0072838 | |||
| 1031 | Ga0495670_0000434 | |||
| 1032 | Ga0495670_0008239 | |||
| 1033 | Ga0495670_0012801 | |||
| 1034 | Ga0495670_0059680 | |||
| 1035 | Ga0495671_0000525 | |||
| 1036 | Ga0495671_0015204 | |||
| 1037 | Ga0495671_0023703 | |||
| 1038 | Ga0495671_0036388 | |||
| 1039 | Ga0495671_0037313 | |||
| 1040 | Ga0495671_0083391 | |||
| 1041 | Ga0495671_0253987 | |||
| 1042 | Ga0495649_0000763 | |||
| 1043 | Ga0495649_0004154 | |||
| 1044 | Ga0495649_0005691 | |||
| 1045 | Ga0495649_0009385 | |||
| 1046 | Ga0495649_0024657 | |||
| 1047 | Ga0495649_0026407 | |||
| 1048 | Ga0495649_0034645 | |||
| 1049 | Ga0495589_0003127 | |||
| 1050 | Ga0495589_0003965 | |||
| 1051 | Ga0495589_0068118 | |||
| 1052 | Ga0495660_0001030 | |||
| 1053 | Ga0495660_0005589 | |||
| 1054 | Ga0495660_0006827 | |||
| 1055 | Ga0495660_0024645 | |||
| 1056 | Ga0495660_0045562 | |||
| 1057 | Ga0495660_0179098 | |||
| 1058 | Ga0495581_0112418 | |||
| 1059 | Ga0495604_0029107 | |||
| 1060 | Ga0495604_0060721 | |||
| 1061 | Ga0495604_0111365 | |||
| 1062 | Ga0495672_0001022 | |||
| 1063 | Ga0495672_0001954 | |||
| 1064 | Ga0495672_0002006 | |||
| 1065 | Ga0495672_0005214 | |||
| 1066 | Ga0495672_0006243 | |||
| 1067 | Ga0495672_0013902 | |||
| 1068 | Ga0495672_0034687 | |||
| 1069 | Ga0495672_0037343 | |||
| 1070 | Ga0495672_0042569 | |||
| 1071 | Ga0495672_0093475 | |||
| 1072 | Ga0495672_0115239 | |||
| 1073 | Ga0495680_0000459 | |||
| 1074 | Ga0495680_0017091 | |||
| 1075 | Ga0495683_0000116 | |||
| 1076 | Ga0495683_0010374 | |||
| 1077 | Ga0495683_0011556 | |||
| 1078 | Ga0495683_0026108 | |||
| 1079 | Ga0495683_0044127 | |||
| 1080 | Ga0495683_0071844 | |||
| 1081 | Ga0495687_000490 | |||
| 1082 | Ga0495687_002535 | |||
| 1083 | Ga0495677_0005333 | |||
| 1084 | Ga0495679_004309 | |||
| 1085 | Ga0495679_006614 | |||
| 1086 | Ga0495685_020713 | |||
| 1087 | Ga0495673_0000715 | |||
| 1088 | Ga0495673_0000815 | |||
| 1089 | Ga0495673_0001057 | |||
| 1090 | Ga0495673_0001315 | |||
| 1091 | Ga0495673_0002132 | |||
| 1092 | Ga0495673_0003720 | |||
| 1093 | Ga0495673_0008286 | |||
| 1094 | Ga0495673_0028738 | |||
| 1095 | Ga0495673_0038778 | |||
| 1096 | Ga0495673_0066793 | |||
| 1097 | Ga0495681_0000075 | |||
| 1098 | Ga0495681_0000232 | |||
| 1099 | Ga0495681_0000486 | |||
| 1100 | Ga0495681_0004085 | |||
| 1101 | Ga0495681_0004699 | |||
| 1102 | Ga0495681_0006958 | |||
| 1103 | Ga0495681_0009975 | |||
| 1104 | Ga0495681_0043373 | |||
| 1105 | Ga0495684_0070342 | |||
| 1106 | Ga0495686_0000990 | |||
| 1107 | Ga0495686_0033300 | |||
| 1108 | Ga0495686_0214328 | |||
| 1109 | Ga0495686_0230478 | |||
| 1110 | Ga0495593_0014975 | |||
| 1111 | Ga0495593_0084718 | |||
| 1112 | Ga0495593_0147249 | |||
| 1113 | Ga0495626_0000057 | |||
| 1114 | Ga0495626_0000065 | |||
| 1115 | Ga0495626_0000361 | |||
| 1116 | Ga0495626_0021676 | |||
| 1117 | Ga0495626_0022592 | |||
| 1118 | Ga0496100_0276044 | |||
| 1119 | Ga0496101_0315024 | |||
| 1120 | Ga0496102_0000073 | |||
| 1121 | Ga0496102_0024626 | |||
| 1122 | Ga0496103_0000363 | |||
| 1123 | Ga0496104_0000574 | |||
| 1124 | Ga0496104_0004271 | |||
| 1125 | Ga0496105_0025244 | |||
| 1126 | Ga0496105_0051185 | |||
| 1127 | Ga0496106_0004084 | |||
| 1128 | Ga0496106_0393215 | |||
| 1129 | Ga0496108_0072316 | |||
| 1130 | Ga0496108_0110688 | |||
| 1131 | Ga0496109_0044658 | |||
| 1132 | Ga0496110_0131608 | |||
| 1133 | Ga0496110_0221351 | |||
| 1134 | Ga0496112_0146838 | |||
| 1135 | Ga0496112_0500928 | |||
| 1136 | Ga0496113_0059806 | |||
| 1137 | Ga0496113_0223189 | |||
| 1138 | Ga0496114_0090359 | |||
| 1139 | Ga0496115_0076770 | |||
| 1140 | Ga0496116_0160569 | |||
| 1141 | Ga0496117_0001418 | |||
| 1142 | Ga0496117_0093021 | |||
| 1143 | Ga0496118_0005094 | |||
| 1144 | Ga0496118_0102033 | |||
| 1145 | Ga0496124_0001820 | |||
| 1146 | Ga0496124_0058717 | |||
| 1147 | Ga0496125_0005291 | |||
| 1148 | Ga0495678_001342 | |||
| 1149 | Ga0495678_008751 | |||
| 1150 | Ga0495678_008974 | |||
| 1151 | Ga0495678_018474 | |||
| 1152 | Ga0495678_019438 | |||
| 1153 | Ga0495678_025298 | |||
| 1154 | Ga0495678_029172 | |||
| 1155 | Ga0495678_061241 | |||
| 1156 | Ga0495682_0005309 | |||
| 1157 | Ga0495682_0032217 | |||
| 1158 | Ga0495682_0065814 | |||
| 1159 | Ga0495682_0070062 | |||
| 1160 | Ga0495682_0076654 | |||
| 1161 | Ga0501290_000012 | |||
| 1162 | Ga0501292_000043 | |||
| 1163 | Ga0501294_000563 | |||
| 1164 | Ga0501300_000322 | |||
| 1165 | Ga0501038_0288083 | |||
| 1166 | Ga0501039_0055108 | |||
| 1167 | Ga0501041_0042511 | |||
| 1168 | Ga0501043_0099918 | |||
| 1169 | Ga0501046_0046827 | |||
| 1170 | Ga0501071_0348901 | |||
| 1171 | Ga0501072_0119851 | |||
| 1172 | Ga0501075_0021036 | |||
| 1173 | Ga0501075_0140174 | |||
| 1174 | Ga0501076_0010479 | |||
| 1175 | Ga0501076_0113232 | |||
| 1176 | Ga0501077_0119769 | |||
| 1177 | Ga0501206_002530 | |||
| 1178 | Ga0501222_016270 | |||
| 1179 | Ga0501223_001009 | |||
| 1180 | Ga0501224_000380 | |||
| 1181 | Ga0501227_007734 | |||
| 1182 | Ga0501235_000932 | |||
| 1183 | Ga0501259_003243 | |||
| 1184 | Ga0501261_000028 | |||
| 1185 | Ga0501221_008232 | |||
| 1186 | Ga0501225_0000335 | |||
| 1187 | Ga0501245_001972 | |||
| 1188 | Ga0501083_0303802 | |||
| 1189 | Ga0501279_000030 | |||
| 1190 | Ga0501280_000040 | |||
| 1191 | Ga0501281_02273 | |||
| 1192 | Ga0501283_012527 | |||
| 1193 | Ga0501045_0102623 | |||
| 1194 | nmdc:mga03683_23160_c1 | |||
| 1195 | nmdc:mga08y16_18347_c1 | |||
| 1196 | nmdc:mga0rr50_480387_c1 | |||
| 1197 | nmdc:mga0rr50_65342_c1 | |||
| 1198 | nmdc:mga0rr50_88628_c1 | |||
| 1199 | nmdc:mga08x19_144_c1 | |||
| 1200 | nmdc:mga08x19_15499_c1 | |||
| 1201 | nmdc:mga08x19_185908_c1 | |||
| 1202 | nmdc:mga08x19_19327_c1 | |||
| 1203 | nmdc:mga0a205_200314_c1 | |||
| 1204 | Ga0500592_000077 | |||
| 1205 | Ga0500593_000329 | |||
| 1206 | Ga0500622_0048923 | |||
| 1207 | Ga0500627_0006006 | |||
| 1208 | Ga0501084_0096320 | |||
| 1209 | Ga0501084_0124215 | |||
| 1210 | Ga0501082_0088555 | |||
| 1211 | Ga0530510_0132007 | |||
| 1212 | 2829746298 | |||
| 1213 | 2511301209 | |||
| 1214 | 2511313003 | |||
| 1215 | 2511323449 | |||
| 1216 | 2511340461 | |||
| 1217 | 2511346661 | |||
| 1218 | 2511353570 | |||
| 1219 | 2587727861 | |||
| 1220 | 2643846036 | |||
| 1221 | 2643953878 | |||
| 1222 | 2644021812 | |||
| 1223 | 2644186965 | |||
| 1224 | 2739199980 | |||
| 1225 | 2739260139 | |||
| 1226 | 2774118895 | |||
| 1227 | 2784312534 | |||
| 1228 | 2808960108 | |||
| 1229 | 2842700331 | |||
| 1230 | 2861693839 | |||
| 1231 | 2904554546 | |||
| 1232 | 2908449725 | |||
| 1233 | 2939640188 | |||
| 1234 | 2946790686 | |||
| 1235 | 3007514982 | |||
| 1236 | 3007620285 | |||
| 1237 | 641336706 | |||
| 1238 | 643391225 | |||
| 1239 | 8056129634 | |||
| 1240 | 8056183997 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xdy-assembly7.cif.gz_G | structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor | 0.9295 | 115 | 245 |
| 1sox-assembly1.cif.gz_A | sulfite oxidase from chicken liver | 0.9083 | 107 | 245 |
| 2a99-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9058 | 107 | 243 |
| 2a9b-assembly1.cif.gz_A | crystal structure of r138q mutant of recombinant sulfite oxidase at resting state | 0.9016 | 107 | 245 |
| 3r19-assembly1.cif.gz_A-2 | chicken sulfite oxidase triple mutant with altered activity and substrate affinity | 0.9004 | 107 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xtsA01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8981 | 107 | 243 | 3.90.420.10 |
| af_P96400_291_442_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8647 | 96 | 243 | 3.90.420.10 |
| 2ca4A01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8445 | 86 | 254 | 3.90.420.10 |
| af_P96400_291_442_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8384 | 96 | 243 | 3.90.420.10 |
| af_A0A0R4IKF7_192_441_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8207 | 86 | 243 | 3.90.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537TEQ0-F1-model_v4 | Molybdopterin-binding protein | 0.9552 | 80 | 257 |
|
| AF-A0A380AE90-F1-model_v4 | Sulfoxide reductase catalytic subunit yedY (EC 1.8.-.-) | 0.9433 | 82 | 257 |
GO:0016491
|
| AF-A0A2V8U2V9-F1-model_v4 | Oxidoreductase molybdopterin-binding domain-containing protein | 0.9418 | 108 | 246 |
|
| AF-A0A1F5DHC0-F1-model_v4 | Oxidoreductase molybdopterin-binding domain-containing protein | 0.9416 | 106 | 248 |
|
| AF-A0A1Q5QVM3-F1-model_v4 | Molybdopterin-binding protein | 0.9391 | 115 | 257 |
|