F469964

General Info

Members Datasets Scaffolds Average Seq Length
620 308 1240 257

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2829745981|2829746298
Length 297
Sequence SIPAPHRRGFLTAAAGLIGVSALGGCDRFAVTPTGRQTLKLGEDANLYVQRLLLTPASLAKEFPDSEISPWFKPNGTIDPQDRDYKSLAAKNFEGWKLRIDGLVENPQAFTLADLRALPVRTQTTRHDCVEGWSAIGKWTGVPLAEILKRAGLKPNARYVVFHCADTMEFAESDDTETANPDMTARAEGEENQASDSKAAGAEAPDADAPKGTPIRYYESIDLTDAYHPQTILAYDLNGKALPVSNGAPLRLRVERQLGYKQAKYVMRIEVRDTLKGVGDGEGGYWEDRGYEWYAGI

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
115 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
116 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
117 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
120 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
121 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
122 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
123 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
124 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
125 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
126 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
127 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
128 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
131 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
135 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
139 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
143 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
236 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
237 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
238 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
239 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
240 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
252 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
253 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
254 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
255 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
256 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
257 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
258 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
259 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
260 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
261 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
264 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
265 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
266 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
274 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
281 2511231012 Pseudomonas sp. GM33 Isolate Nodule
282 2511231014 Pseudomonas sp. GM48 Isolate Nodule
283 2511231015 Pseudomonas sp. GM49 Isolate Nodule
284 2511231018 Pseudomonas sp. GM60 Isolate Nodule
285 2511231019 Pseudomonas sp. GM67 Isolate Nodule
286 2511231021 Pseudomonas sp. GM78 Isolate Nodule
287 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
288 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
289 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
290 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
291 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
292 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
293 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
294 2773857670 Pseudomonas sp. 478 Isolate Unclassified
295 2784132072 Pseudomonas sp. 460 Isolate Unclassified
296 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
297 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
298 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
299 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
300 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
301 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
302 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
303 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
304 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
305 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
306 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
307 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
308 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 1.45
Rhizoplane 3.55
Rhizosphere 89.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1683 2124908027 Bacteria 7205
2 JGI25406J46586_10013109 3300003203 Bacteria 3575
3 Ga0065714_10003326 3300005288 Bacteria 14195
4 Ga0065714_10007124 3300005288 Bacteria 2991
5 Ga0065714_10008554 3300005288 Bacteria 4016
6 Ga0065714_10017731 3300005288 Bacteria 1502
7 Ga0065712_10003822 3300005290 Bacteria 4057
8 Ga0065715_10131774 3300005293 Bacteria 1995
9 Ga0065707_10085957 3300005295 Bacteria 5768
10 Ga0070658_10452507 3300005327 Bacteria 1106
11 Ga0070690_100053755 3300005330 Bacteria 2577
12 Ga0070690_100078903 3300005330 Bacteria 2152
13 Ga0070670_100244776 3300005331 Bacteria 1561
14 Ga0070666_10004502 3300005335 Bacteria 8492
15 Ga0070680_100148030 3300005336 Bacteria 1971
16 Ga0070680_100460207 3300005336 Bacteria 1087
17 Ga0068868_100005917 3300005338 Bacteria 8630
18 Ga0070660_100199296 3300005339 Bacteria 1624
19 Ga0070689_100000450 3300005340 Bacteria 24317
20 Ga0070668_100241366 3300005347 Bacteria 1497
21 Ga0070675_100005533 3300005354 Bacteria 9669
22 Ga0070674_100092639 3300005356 Bacteria 2185
23 Ga0070673_100006766 3300005364 Bacteria 7481
24 Ga0070667_100004652 3300005367 Bacteria 11521
25 Ga0070667_100066329 3300005367 Bacteria 3067
26 Ga0070709_10006639 3300005434 Bacteria 6315
27 Ga0070714_100084424 3300005435 Bacteria 2771
28 Ga0070713_100060241 3300005436 Bacteria 3173
29 Ga0070662_100044454 3300005457 Bacteria 3181
30 Ga0070706_100496301 3300005467 Bacteria 1136
31 Ga0070699_100021566 3300005518 Bacteria 5555
32 Ga0070699_100220518 3300005518 Bacteria 1690
33 Ga0070697_100438995 3300005536 Bacteria 1136
34 Ga0070672_100003112 3300005543 Bacteria 10706
35 Ga0070693_100047535 3300005547 Bacteria 2442
36 Ga0068859_100655220 3300005617 Bacteria 1142
37 Ga0068858_100013306 3300005842 Bacteria 7759
38 Ga0081455_10051393 3300005937 Bacteria 3536
39 Ga0081539_10000178 3300005985 Bacteria 149201
40 Ga0075364_10017503 3300006051 Bacteria 4478
41 Ga0075364_10056866 3300006051 Bacteria 2562
42 Ga0075362_10034827 3300006177 Bacteria 2196
43 Ga0068871_100044103 3300006358 Bacteria 3584
44 Ga0075428_100655621 3300006844 Bacteria 1119
45 Ga0075433_10383526 3300006852 Bacteria 1241
46 Ga0075434_100089594 3300006871 Bacteria 3077
47 Ga0075436_100000191 3300006914 Bacteria 37759
48 Ga0075436_100012337 3300006914 Bacteria 5856
49 Ga0075436_100012626 3300006914 Bacteria 5787
50 Ga0075436_100077286 3300006914 Bacteria 2306
51 Ga0079104_1000441 3300006946 Bacteria 47199
52 Ga0099826_10185119 3300006948 Bacteria 1154
53 Ga0075435_100011103 3300007076 Bacteria 6606
54 Ga0075435_100240174 3300007076 Bacteria 1541
55 Ga0099794_10002127 3300007265 Bacteria 7200
56 Ga0099794_10157337 3300007265 Bacteria 1155
57 Ga0099795_10105637 3300007788 Bacteria 1110
58 Ga0105251_10000551 3300009011 Bacteria 35219
59 Ga0105251_10002380 3300009011 Bacteria 14876
60 Ga0105244_10029351 3300009036 Bacteria 2941
61 Ga0105250_10091296 3300009092 Bacteria 1239
62 Ga0111539_10001236 3300009094 Bacteria 34016
63 Ga0111539_10001845 3300009094 Bacteria 28186
64 Ga0114129_10097609 3300009147 Bacteria 4067
65 Ga0114129_10448467 3300009147 Bacteria 1692
66 Ga0105248_10099781 3300009177 Bacteria 3272
67 Ga0105238_10417517 3300009551 Bacteria 1336
68 Ga0105246_10054656 3300011119 Bacteria 2753
69 Ga0105246_10319892 3300011119 Bacteria 1260
70 Ga0157371_10000379 3300013102 Bacteria 55919
71 Ga0157371_10208249 3300013102 Bacteria 1403
72 Ga0157378_10000218 3300013297 Bacteria 55703
73 Ga0163162_10175494 3300013306 Bacteria 2268
74 Ga0157375_10000481 3300013308 Bacteria 36338
75 Ga0157375_11086145 3300013308 Bacteria 936
76 Ga0157380_10647647 3300014326 Bacteria 1053
77 Ga0182008_10032685 3300014497 Bacteria 2612
78 Ga0157376_10021802 3300014969 Bacteria 4979
79 Ga0182006_1026969 3300015261 Bacteria 2348
80 Ga0182007_10015569 3300015262 Bacteria 2831
81 Ga0182005_1000698 3300015265 Bacteria 15569
82 Ga0163161_10000293 3300017792 Bacteria 43753
83 Ga0163161_10002662 3300017792 Bacteria 12689
84 Ga0163161_10015094 3300017792 Bacteria 5386
85 Ga0163161_10232070 3300017792 Bacteria 1432
86 Ga0209676_1003111 3300025292 Bacteria 10661
87 Ga0209050_1000458 3300025298 Bacteria 73243
88 Ga0207696_1005499 3300025711 Bacteria 5252
89 Ga0207655_1054065 3300025728 Bacteria 1600
90 Ga0207713_1000521 3300025735 Bacteria 38694
91 Ga0207713_1007742 3300025735 Bacteria 6276
92 Ga0207713_1021400 3300025735 Bacteria 3101
93 Ga0207713_1030195 3300025735 Bacteria 2416
94 Ga0207682_10023771 3300025893 Bacteria 2423
95 Ga0207680_10040324 3300025903 Bacteria 2716
96 Ga0207645_10003799 3300025907 Bacteria 11336
97 Ga0207705_10199821 3300025909 Bacteria 1515
98 Ga0207684_10575282 3300025910 Bacteria 963
99 Ga0207660_10129466 3300025917 Bacteria 1920
100 Ga0207657_10092379 3300025919 Bacteria 2522
101 Ga0207646_10258273 3300025922 Bacteria 1575
102 Ga0207659_10013114 3300025926 Bacteria 5299
103 Ga0207706_10058721 3300025933 Bacteria 3388
104 Ga0207669_10265400 3300025937 Bacteria 1286
105 Ga0207665_10075160 3300025939 Bacteria 2314
106 Ga0207665_10328210 3300025939 Bacteria 1150
107 Ga0207691_10000725 3300025940 Bacteria 32565
108 Ga0207679_10180323 3300025945 Bacteria 1747
109 Ga0207651_10000222 3300025960 Bacteria 24389
110 Ga0207668_10490304 3300025972 Bacteria 1055
111 Ga0207677_10131301 3300026023 Bacteria 1902
112 Ga0207683_10001120 3300026121 Bacteria 24378
113 Ga0209281_1000199 3300027111 Bacteria 135753
114 Ga0209973_1011877 3300027252 Bacteria 1051
115 Ga0209969_1026055 3300027360 Bacteria 883
116 Ga0209967_1000770 3300027364 Bacteria 4102
117 Ga0209984_1004976 3300027424 Bacteria 1583
118 Ga0210000_1000942 3300027462 Bacteria 4067
119 Ga0209968_1014239 3300027526 Bacteria 1251
120 Ga0209983_1002649 3300027665 Bacteria 3883
121 Ga0209971_1006495 3300027682 Bacteria 2766
122 Ga0209974_10002525 3300027876 Bacteria 6637
123 Ga0207428_10007642 3300027907 Bacteria 9843
124 Ga0207428_10015713 3300027907 Bacteria 6539
125 Ga0207428_10086386 3300027907 Bacteria 2442
126 Ga0207428_10127145 3300027907 Bacteria 1952
127 Ga0207428_10195904 3300027907 Bacteria 1522
128 Ga0268266_10084824 3300028379 Bacteria 2767
129 Ga0307515_10132061 3300028794 Bacteria 2742
130 Ga0307408_100138770 3300031548 Bacteria 1906
131 Ga0307406_10074048 3300031901 Bacteria 2241
132 Ga0316583_10006413 3300032133 Bacteria 4224
133 Ga0373934_0000565 3300035086 Bacteria 13043
134 Ga0373934_0073737 3300035086 Bacteria 1367
135 Ga0373923_0035778 3300035111 Bacteria 2024
136 Ga0373953_0035057 3300035117 Bacteria 1970
137 Ga0373956_0000155 3300035119 Bacteria 25133
138 Ga0373957_0004772 3300035120 Bacteria 4152
139 Ga0373957_0050542 3300035120 Bacteria 1589
140 Ga0373960_0006797 3300035121 Bacteria 2693
141 Ga0373960_0019353 3300035121 Bacteria 1788
142 Ga0373955_0008818 3300035172 Bacteria 4700
143 Ga0373955_0017170 3300035172 Bacteria 3576
144 Ga0373924_0002992 3300035410 Bacteria 5749
145 Ga0373924_0019114 3300035410 Bacteria 2651
146 Ga0373931_0028044 3300035691 Bacteria 2879
147 Ga0373931_0113746 3300035691 Bacteria 1539
148 Ga0373933_0002424 3300035724 Bacteria 10523
149 Ga0373933_0005656 3300035724 Bacteria 6806
150 Ga0373937_0012998 3300036401 Bacteria 7331
151 Ga0373937_0048170 3300036401 Bacteria 3900
152 Ga0373937_0104981 3300036401 Bacteria 2625
153 Ga0373937_0215012 3300036401 Bacteria 1809
154 Ga0373937_0291673 3300036401 Bacteria 1541
155 Ga0439438_000700 3300041405 Bacteria 14983
156 Ga0439438_009008 3300041405 Bacteria 3258
157 Ga0439447_000261 3300041407 Bacteria 18544
158 Ga0439466_0000837 3300041411 Bacteria 11712
159 Ga0439466_0000966 3300041411 Bacteria 11046
160 Ga0439466_0008123 3300041411 Bacteria 3956
161 Ga0451841_0767028 3300041498 Bacteria 976
162 Ga0439432_011691 3300042006 Bacteria 3020
163 Ga0439432_050483 3300042006 Bacteria 1298
164 Ga0439452_000035 3300042010 Bacteria 160387
165 Ga0439452_000332 3300042010 Bacteria 29434
166 Ga0439452_000618 3300042010 Bacteria 17964
167 Ga0439452_004502 3300042010 Bacteria 4660
168 Ga0439456_000702 3300042013 Bacteria 6875
169 Ga0450911_000727 3300042115 Bacteria 9558
170 Ga0450911_007927 3300042115 Bacteria 1525
171 Ga0450920_013195 3300042122 Bacteria 1555
172 Ga0450922_004406 3300042124 Bacteria 1292
173 Ga0450902_000710 3300042137 Bacteria 4243
174 Ga0450902_005830 3300042137 Bacteria 1876
175 Ga0450903_000017 3300042138 Bacteria 32445
176 Ga0450903_002873 3300042138 Bacteria 3013
177 Ga0450903_007156 3300042138 Bacteria 1843
178 Ga0450903_008812 3300042138 Bacteria 1648
179 Ga0450903_011746 3300042138 Bacteria 1407
180 Ga0450905_006491 3300042142 Bacteria 1583
181 Ga0450907_000001 3300042146 Bacteria 236562
182 Ga0450907_011683 3300042146 Bacteria 1458
183 Ga0450910_002735 3300042147 Bacteria 2322
184 Ga0439446_0021229 3300042156 Bacteria 1834
185 Ga0450908_007407 3300042184 Bacteria 2069
186 Ga0450909_000419 3300042185 Bacteria 5464
187 Ga0439434_0000001 3300042435 Bacteria 86314
188 Ga0439460_0005837 3300042461 Bacteria 3035
189 Ga0439460_0057416 3300042461 Bacteria 1181
190 Ga0450901_003480 3300042533 Bacteria 1640
191 Ga0439440_0003315 3300042993 Bacteria 3096
192 Ga0453684_0586013 3300044712 Bacteria 1224
193 Ga0451576_0219374 3300045051 Bacteria 1986
194 Ga0495617_000175 3300046452 Bacteria 40541
195 Ga0495617_002727 3300046452 Bacteria 6827
196 Ga0495617_003664 3300046452 Bacteria 5725
197 Ga0495617_005932 3300046452 Bacteria 4310
198 Ga0495617_012954 3300046452 Bacteria 2842
199 Ga0495617_014958 3300046452 Bacteria 2633
200 Ga0495617_167061 3300046452 Bacteria 696
201 Ga0495627_004957 3300046453 Bacteria 5465
202 Ga0495592_0001120 3300046454 Bacteria 18622
203 Ga0495603_0000689 3300046455 Bacteria 19147
204 Ga0495590_0000040 3300046457 Bacteria 122610
205 Ga0495590_0001025 3300046457 Bacteria 12299
206 Ga0495590_0006082 3300046457 Bacteria 4737
207 Ga0495590_0006255 3300046457 Bacteria 4660
208 Ga0495590_0009157 3300046457 Bacteria 3757
209 Ga0495591_000049 3300046458 Bacteria 138951
210 Ga0495591_001688 3300046458 Bacteria 13201
211 Ga0495591_002062 3300046458 Bacteria 11625
212 Ga0495591_004642 3300046458 Bacteria 6615
213 Ga0495591_011864 3300046458 Bacteria 3275
214 Ga0495591_012342 3300046458 Bacteria 3185
215 Ga0495591_022392 3300046458 Bacteria 2042
216 Ga0495591_029269 3300046458 Bacteria 1675
217 Ga0495629_0021846 3300046459 Bacteria 4566
218 Ga0495638_0000116 3300046460 Bacteria 128087
219 Ga0495638_0000568 3300046460 Bacteria 41722
220 Ga0495638_0000626 3300046460 Bacteria 39128
221 Ga0495638_0000684 3300046460 Bacteria 36872
222 Ga0495638_0001444 3300046460 Bacteria 21496
223 Ga0495638_0001526 3300046460 Bacteria 20852
224 Ga0495638_0003800 3300046460 Bacteria 11728
225 Ga0495638_0013821 3300046460 Bacteria 5480
226 Ga0495638_0017973 3300046460 Bacteria 4705
227 Ga0495638_0031352 3300046460 Bacteria 3417
228 Ga0495638_0049527 3300046460 Bacteria 2626
229 Ga0495638_0051116 3300046460 Bacteria 2578
230 Ga0495638_0051302 3300046460 Bacteria 2572
231 Ga0495638_0133747 3300046460 Bacteria 1454
232 Ga0495651_0004288 3300046462 Bacteria 10933
233 Ga0495653_0019288 3300046463 Bacteria 5530
234 Ga0495650_0002085 3300046471 Bacteria 17242
235 Ga0495650_0012910 3300046471 Bacteria 4459
236 Ga0495650_0029121 3300046471 Bacteria 2522
237 Ga0495650_0089035 3300046471 Bacteria 1177
238 Ga0495582_0010136 3300046473 Bacteria 5190
239 Ga0495605_0000215 3300046474 Bacteria 71472
240 Ga0495605_0000572 3300046474 Bacteria 29906
241 Ga0495605_0024567 3300046474 Bacteria 3152
242 Ga0495605_0033021 3300046474 Bacteria 2630
243 Ga0495605_0042306 3300046474 Bacteria 2265
244 Ga0495639_0003018 3300046475 Bacteria 7331
245 Ga0495639_0032371 3300046475 Bacteria 2332
246 Ga0495584_0000054 3300046491 Bacteria 85945
247 Ga0495584_0001003 3300046491 Bacteria 17687
248 Ga0495584_0010795 3300046491 Bacteria 4689
249 Ga0495584_0010844 3300046491 Bacteria 4676
250 Ga0495584_0011119 3300046491 Bacteria 4613
251 Ga0495584_0015087 3300046491 Bacteria 3937
252 Ga0495584_0026533 3300046491 Bacteria 2935
253 Ga0495585_0000016 3300046492 Bacteria 175433
254 Ga0495585_0000227 3300046492 Bacteria 57949
255 Ga0495585_0000441 3300046492 Bacteria 39743
256 Ga0495585_0005990 3300046492 Bacteria 7608
257 Ga0495585_0012924 3300046492 Bacteria 4905
258 Ga0495585_0027294 3300046492 Bacteria 3258
259 Ga0495585_0178955 3300046492 Bacteria 1091
260 Ga0495594_0007963 3300046499 Bacteria 5448
261 Ga0495594_0035128 3300046499 Bacteria 2729
262 Ga0495596_0000454 3300046500 Bacteria 26053
263 Ga0495607_0003174 3300046501 Bacteria 12735
264 Ga0495607_0004998 3300046501 Bacteria 9620
265 Ga0495607_0029839 3300046501 Bacteria 3354
266 Ga0495607_0029905 3300046501 Bacteria 3351
267 Ga0495607_0035679 3300046501 Bacteria 3006
268 Ga0495607_0052048 3300046501 Bacteria 2373
269 Ga0495607_0119643 3300046501 Bacteria 1384
270 Ga0495583_0000708 3300046506 Bacteria 42814
271 Ga0495583_0001334 3300046506 Bacteria 25606
272 Ga0495583_0001922 3300046506 Bacteria 19212
273 Ga0495583_0003944 3300046506 Bacteria 10970
274 Ga0495583_0018098 3300046506 Bacteria 3719
275 Ga0495606_0005566 3300046507 Bacteria 12009
276 Ga0495606_0011906 3300046507 Bacteria 7036
277 Ga0495606_0025479 3300046507 Bacteria 4234
278 Ga0495606_0106352 3300046507 Bacteria 1699
279 Ga0495610_0000631 3300046512 Bacteria 34583
280 Ga0495610_0007082 3300046512 Bacteria 7566
281 Ga0495610_0007858 3300046512 Bacteria 7015
282 Ga0495610_0008870 3300046512 Bacteria 6442
283 Ga0495610_0016042 3300046512 Bacteria 4330
284 Ga0495610_0016473 3300046512 Bacteria 4252
285 Ga0495610_0026890 3300046512 Bacteria 3066
286 Ga0495616_0005072 3300046513 Bacteria 8189
287 Ga0495616_0007353 3300046513 Bacteria 6589
288 Ga0495616_0036653 3300046513 Bacteria 2529
289 Ga0495616_0087734 3300046513 Bacteria 1477
290 Ga0495616_0119348 3300046513 Bacteria 1219
291 Ga0495620_0003703 3300046515 Bacteria 8727
292 Ga0495620_0003805 3300046515 Bacteria 8608
293 Ga0495620_0010547 3300046515 Bacteria 4869
294 Ga0495620_0044898 3300046515 Bacteria 1917
295 Ga0495620_0076235 3300046515 Bacteria 1363
296 Ga0495628_0000904 3300046516 Bacteria 27219
297 Ga0495628_0097041 3300046516 Bacteria 2277
298 Ga0495630_0011457 3300046517 Bacteria 6420
299 Ga0495630_0046637 3300046517 Bacteria 3239
300 Ga0495630_0154175 3300046517 Bacteria 1748
301 Ga0495631_0001303 3300046518 Bacteria 15278
302 Ga0495631_0024545 3300046518 Bacteria 2783
303 Ga0495631_0053923 3300046518 Bacteria 1754
304 Ga0495631_0099821 3300046518 Bacteria 1249
305 Ga0495632_0000166 3300046519 Bacteria 68543
306 Ga0495632_0000992 3300046519 Bacteria 24789
307 Ga0495632_0002945 3300046519 Bacteria 12495
308 Ga0495632_0004432 3300046519 Bacteria 9544
309 Ga0495632_0006992 3300046519 Bacteria 7161
310 Ga0495632_0013964 3300046519 Bacteria 4561
311 Ga0495632_0016929 3300046519 Bacteria 4040
312 Ga0495632_0027449 3300046519 Bacteria 2982
313 Ga0495637_0000608 3300046520 Bacteria 25508
314 Ga0495637_0000852 3300046520 Bacteria 19987
315 Ga0495637_0000879 3300046520 Bacteria 19466
316 Ga0495637_0002271 3300046520 Bacteria 10655
317 Ga0495637_0002854 3300046520 Bacteria 9374
318 Ga0495637_0004013 3300046520 Bacteria 7680
319 Ga0495637_0006642 3300046520 Bacteria 5790
320 Ga0495637_0012723 3300046520 Bacteria 4015
321 Ga0495637_0032071 3300046520 Bacteria 2317
322 Ga0495637_0033439 3300046520 Bacteria 2258
323 Ga0495637_0040331 3300046520 Bacteria 2010
324 Ga0495637_0060596 3300046520 Bacteria 1553
325 Ga0495643_0022744 3300046522 Bacteria 3570
326 Ga0495643_0026534 3300046522 Bacteria 3268
327 Ga0495643_0027535 3300046522 Bacteria 3193
328 Ga0495643_0055927 3300046522 Bacteria 2107
329 Ga0495643_0059589 3300046522 Bacteria 2029
330 Ga0495643_0065708 3300046522 Bacteria 1915
331 Ga0495643_0089977 3300046522 Bacteria 1585
332 Ga0495644_0000323 3300046523 Bacteria 21880
333 Ga0495644_0000338 3300046523 Bacteria 21325
334 Ga0495644_0006154 3300046523 Bacteria 4665
335 Ga0495644_0021656 3300046523 Bacteria 2451
336 Ga0495644_0035971 3300046523 Bacteria 1868
337 Ga0495648_0000429 3300046524 Bacteria 46065
338 Ga0495648_0000812 3300046524 Bacteria 33084
339 Ga0495648_0001001 3300046524 Bacteria 28927
340 Ga0495648_0009633 3300046524 Bacteria 7453
341 Ga0495648_0026715 3300046524 Bacteria 3881
342 Ga0495648_0060724 3300046524 Bacteria 2247
343 Ga0495648_0125306 3300046524 Bacteria 1374
344 Ga0495666_0010679 3300046526 Bacteria 4579
345 Ga0495666_0027288 3300046526 Bacteria 2811
346 Ga0495642_0000016 3300046528 Bacteria 114282
347 Ga0495642_0000023 3300046528 Bacteria 94611
348 Ga0495652_0005891 3300046529 Bacteria 11463
349 Ga0495654_0001623 3300046530 Bacteria 15240
350 Ga0495654_0001726 3300046530 Bacteria 14686
351 Ga0495654_0001827 3300046530 Bacteria 14163
352 Ga0495654_0001856 3300046530 Bacteria 14064
353 Ga0495654_0002118 3300046530 Bacteria 12962
354 Ga0495654_0002516 3300046530 Bacteria 11776
355 Ga0495654_0002819 3300046530 Bacteria 10931
356 Ga0495654_0009258 3300046530 Bacteria 5401
357 Ga0495654_0018429 3300046530 Bacteria 3658
358 Ga0495654_0031684 3300046530 Bacteria 2683
359 Ga0495654_0159542 3300046530 Bacteria 991
360 Ga0495587_0000989 3300046536 Bacteria 18668
361 Ga0495587_0041805 3300046536 Bacteria 2734
362 Ga0495609_0079041 3300046538 Bacteria 1439
363 Ga0495609_0101386 3300046538 Bacteria 1247
364 Ga0495597_0003494 3300046542 Bacteria 9115
365 Ga0495597_0014775 3300046542 Bacteria 3713
366 Ga0495597_0017058 3300046542 Bacteria 3422
367 Ga0495597_0020516 3300046542 Bacteria 3077
368 Ga0495597_0022736 3300046542 Bacteria 2905
369 Ga0495597_0026792 3300046542 Bacteria 2647
370 Ga0495597_0036388 3300046542 Bacteria 2216
371 Ga0495597_0053033 3300046542 Bacteria 1784
372 Ga0495645_0000272 3300046543 Bacteria 37937
373 Ga0495645_0042198 3300046543 Bacteria 3326
374 Ga0495645_0200304 3300046543 Bacteria 1355
375 Ga0495622_0000335 3300046557 Bacteria 33842
376 Ga0495622_0044069 3300046557 Bacteria 2074
377 Ga0495633_0066673 3300046558 Bacteria 1681
378 Ga0495667_0064961 3300046559 Bacteria 2387
379 Ga0495656_0073407 3300046615 Bacteria 1525
380 Ga0495656_0078310 3300046615 Bacteria 1485
381 Ga0495656_0113875 3300046615 Bacteria 1269
382 Ga0495668_0002065 3300046616 Bacteria 17398
383 Ga0495668_0022748 3300046616 Bacteria 3581
384 Ga0495634_0000572 3300046642 Bacteria 35710
385 Ga0495611_0021658 3300046648 Bacteria 2777
386 Ga0495625_0005341 3300046660 Bacteria 11763
387 Ga0495625_0009587 3300046660 Bacteria 8085
388 Ga0495625_0011666 3300046660 Bacteria 7148
389 Ga0495625_0045370 3300046660 Bacteria 3177
390 Ga0495625_0179276 3300046660 Bacteria 1410
391 Ga0495625_0245748 3300046660 Bacteria 1163
392 Ga0495635_0000115 3300046663 Bacteria 47781
393 Ga0495635_0048482 3300046663 Bacteria 2928
394 Ga0495659_0013740 3300046664 Bacteria 2640
395 Ga0495661_0000686 3300046665 Bacteria 33766
396 Ga0495661_0004926 3300046665 Bacteria 9553
397 Ga0495661_0008810 3300046665 Bacteria 6960
398 Ga0495661_0020156 3300046665 Bacteria 4359
399 Ga0495588_0008021 3300046674 Bacteria 4827
400 Ga0495657_0026028 3300046675 Bacteria 4148
401 Ga0495657_0296348 3300046675 Bacteria 965
402 Ga0495599_0001029 3300046678 Bacteria 15642
403 Ga0495599_0247828 3300046678 Bacteria 1085
404 Ga0495623_0000178 3300046679 Bacteria 39932
405 Ga0495623_0122830 3300046679 Bacteria 1561
406 Ga0495646_0008931 3300046680 Bacteria 6363
407 Ga0495669_0031713 3300046684 Bacteria 2321
408 Ga0495669_0107278 3300046684 Bacteria 1301
409 Ga0495613_0014787 3300046689 Bacteria 5793
410 Ga0495613_0072838 3300046689 Bacteria 2504
411 Ga0495670_0000434 3300046691 Bacteria 19947
412 Ga0495670_0008239 3300046691 Bacteria 5125
413 Ga0495670_0012801 3300046691 Bacteria 4124
414 Ga0495670_0059680 3300046691 Bacteria 1915
415 Ga0495671_0000525 3300046692 Bacteria 29114
416 Ga0495671_0015204 3300046692 Bacteria 4130
417 Ga0495671_0023703 3300046692 Bacteria 3204
418 Ga0495671_0036388 3300046692 Bacteria 2493
419 Ga0495671_0037313 3300046692 Bacteria 2458
420 Ga0495671_0083391 3300046692 Bacteria 1566
421 Ga0495671_0253987 3300046692 Bacteria 848
422 Ga0495649_0000763 3300046694 Bacteria 25899
423 Ga0495649_0004154 3300046694 Bacteria 9510
424 Ga0495649_0005691 3300046694 Bacteria 7865
425 Ga0495649_0009385 3300046694 Bacteria 5821
426 Ga0495649_0024657 3300046694 Bacteria 3353
427 Ga0495649_0026407 3300046694 Bacteria 3228
428 Ga0495649_0034645 3300046694 Bacteria 2777
429 Ga0495589_0003127 3300046794 Bacteria 9054
430 Ga0495589_0003965 3300046794 Bacteria 7944
431 Ga0495589_0068118 3300046794 Bacteria 1741
432 Ga0495660_0001030 3300046810 Bacteria 20218
433 Ga0495660_0005589 3300046810 Bacteria 7523
434 Ga0495660_0006827 3300046810 Bacteria 6730
435 Ga0495660_0024645 3300046810 Bacteria 3426
436 Ga0495660_0045562 3300046810 Bacteria 2407
437 Ga0495660_0179098 3300046810 Bacteria 1026
438 Ga0495581_0112418 3300047315 Bacteria 1583
439 Ga0495604_0029107 3300047317 Bacteria 4395
440 Ga0495604_0060721 3300047317 Bacteria 2893
441 Ga0495604_0111365 3300047317 Bacteria 1995
442 Ga0495672_0001022 3300047320 Bacteria 28756
443 Ga0495672_0001954 3300047320 Bacteria 19485
444 Ga0495672_0002006 3300047320 Bacteria 19232
445 Ga0495672_0005214 3300047320 Bacteria 10355
446 Ga0495672_0006243 3300047320 Bacteria 9294
447 Ga0495672_0013902 3300047320 Bacteria 5534
448 Ga0495672_0034687 3300047320 Bacteria 3114
449 Ga0495672_0037343 3300047320 Bacteria 2973
450 Ga0495672_0042569 3300047320 Bacteria 2737
451 Ga0495672_0093475 3300047320 Bacteria 1646
452 Ga0495672_0115239 3300047320 Bacteria 1436
453 Ga0495680_0000459 3300047322 Bacteria 45776
454 Ga0495680_0017091 3300047322 Bacteria 6206
455 Ga0495683_0000116 3300047323 Bacteria 80411
456 Ga0495683_0010374 3300047323 Bacteria 4924
457 Ga0495683_0011556 3300047323 Bacteria 4644
458 Ga0495683_0026108 3300047323 Bacteria 2989
459 Ga0495683_0044127 3300047323 Bacteria 2242
460 Ga0495683_0071844 3300047323 Bacteria 1697
461 Ga0495687_000490 3300047443 Bacteria 47632
462 Ga0495687_002535 3300047443 Bacteria 14477
463 Ga0495677_0005333 3300047445 Bacteria 4876
464 Ga0495679_004309 3300047446 Bacteria 6598
465 Ga0495679_006614 3300047446 Bacteria 4958
466 Ga0495685_020713 3300047447 Bacteria 2261
467 Ga0495673_0000715 3300047469 Bacteria 32151
468 Ga0495673_0000815 3300047469 Bacteria 29262
469 Ga0495673_0001057 3300047469 Bacteria 24173
470 Ga0495673_0001315 3300047469 Bacteria 20236
471 Ga0495673_0002132 3300047469 Bacteria 14364
472 Ga0495673_0003720 3300047469 Bacteria 9912
473 Ga0495673_0008286 3300047469 Bacteria 5861
474 Ga0495673_0028738 3300047469 Bacteria 2630
475 Ga0495673_0038778 3300047469 Bacteria 2165
476 Ga0495673_0066793 3300047469 Bacteria 1523
477 Ga0495681_0000075 3300047470 Bacteria 89696
478 Ga0495681_0000232 3300047470 Bacteria 46130
479 Ga0495681_0000486 3300047470 Bacteria 30522
480 Ga0495681_0004085 3300047470 Bacteria 10041
481 Ga0495681_0004699 3300047470 Bacteria 9262
482 Ga0495681_0006958 3300047470 Bacteria 7327
483 Ga0495681_0009975 3300047470 Bacteria 5787
484 Ga0495681_0043373 3300047470 Bacteria 2169
485 Ga0495684_0070342 3300047471 Bacteria 2660
486 Ga0495686_0000990 3300047472 Bacteria 34619
487 Ga0495686_0033300 3300047472 Bacteria 3328
488 Ga0495686_0214328 3300047472 Bacteria 1098
489 Ga0495686_0230478 3300047472 Bacteria 1049
490 Ga0495593_0014975 3300047673 Bacteria 4402
491 Ga0495593_0084718 3300047673 Bacteria 1636
492 Ga0495593_0147249 3300047673 Bacteria 1191
493 Ga0495626_0000057 3300048091 Bacteria 148288
494 Ga0495626_0000065 3300048091 Bacteria 141689
495 Ga0495626_0000361 3300048091 Bacteria 47557
496 Ga0495626_0021676 3300048091 Bacteria 3183
497 Ga0495626_0022592 3300048091 Bacteria 3104
498 Ga0496100_0276044 3300048903 Bacteria 1251
499 Ga0496101_0315024 3300048904 Bacteria 1227
500 Ga0496102_0000073 3300048905 Bacteria 149887
501 Ga0496102_0024626 3300048905 Bacteria 5352
502 Ga0496103_0000363 3300048906 Bacteria 40883
503 Ga0496104_0000574 3300048907 Bacteria 31370
504 Ga0496104_0004271 3300048907 Bacteria 12418
505 Ga0496105_0025244 3300048908 Bacteria 4835
506 Ga0496105_0051185 3300048908 Bacteria 3412
507 Ga0496106_0004084 3300048909 Bacteria 10889
508 Ga0496106_0393215 3300048909 Bacteria 1114
509 Ga0496108_0072316 3300048911 Bacteria 2911
510 Ga0496108_0110688 3300048911 Bacteria 2348
511 Ga0496109_0044658 3300048912 Bacteria 4020
512 Ga0496110_0131608 3300048913 Bacteria 2259
513 Ga0496110_0221351 3300048913 Bacteria 1721
514 Ga0496112_0146838 3300048915 Bacteria 2327
515 Ga0496112_0500928 3300048915 Bacteria 1150
516 Ga0496113_0059806 3300048916 Bacteria 2871
517 Ga0496113_0223189 3300048916 Bacteria 1502
518 Ga0496114_0090359 3300048917 Bacteria 2599
519 Ga0496115_0076770 3300048918 Bacteria 2716
520 Ga0496116_0160569 3300048919 Bacteria 1233
521 Ga0496117_0001418 3300048920 Bacteria 34748
522 Ga0496117_0093021 3300048920 Bacteria 1935
523 Ga0496118_0005094 3300048921 Bacteria 15115
524 Ga0496118_0102033 3300048921 Bacteria 1935
525 Ga0496124_0001820 3300048927 Bacteria 29489
526 Ga0496124_0058717 3300048927 Bacteria 3234
527 Ga0496125_0005291 3300048928 Bacteria 14440
528 Ga0495678_001342 3300049459 Bacteria 19691
529 Ga0495678_008751 3300049459 Bacteria 5073
530 Ga0495678_008974 3300049459 Bacteria 4995
531 Ga0495678_018474 3300049459 Bacteria 3134
532 Ga0495678_019438 3300049459 Bacteria 3029
533 Ga0495678_025298 3300049459 Bacteria 2551
534 Ga0495678_029172 3300049459 Bacteria 2319
535 Ga0495678_061241 3300049459 Bacteria 1413
536 Ga0495682_0005309 3300049460 Bacteria 5371
537 Ga0495682_0032217 3300049460 Bacteria 1936
538 Ga0495682_0065814 3300049460 Bacteria 1306
539 Ga0495682_0070062 3300049460 Bacteria 1262
540 Ga0495682_0076654 3300049460 Bacteria 1202
541 Ga0501290_000012 3300049513 Bacteria 28888
542 Ga0501292_000043 3300049515 Bacteria 28998
543 Ga0501294_000563 3300049517 Bacteria 4265
544 Ga0501300_000322 3300049523 Bacteria 7249
545 Ga0501038_0288083 3300049574 Bacteria 1291
546 Ga0501039_0055108 3300049575 Bacteria 3079
547 Ga0501041_0042511 3300049577 Bacteria 2762
548 Ga0501043_0099918 3300049579 Bacteria 2281
549 Ga0501046_0046827 3300049580 Bacteria 3431
550 Ga0501071_0348901 3300049587 Bacteria 1126
551 Ga0501072_0119851 3300049588 Bacteria 2096
552 Ga0501075_0021036 3300049591 Bacteria 4753
553 Ga0501075_0140174 3300049591 Bacteria 1842
554 Ga0501076_0010479 3300049592 Bacteria 6881
555 Ga0501076_0113232 3300049592 Bacteria 2194
556 Ga0501077_0119769 3300049593 Bacteria 1668
557 Ga0501206_002530 3300049653 Bacteria 2305
558 Ga0501222_016270 3300049662 Bacteria 983
559 Ga0501223_001009 3300049663 Bacteria 6650
560 Ga0501224_000380 3300049664 Bacteria 5258
561 Ga0501227_007734 3300049665 Bacteria 2305
562 Ga0501235_000932 3300049669 Bacteria 6041
563 Ga0501259_003243 3300049688 Bacteria 2602
564 Ga0501261_000028 3300049690 Bacteria 32508
565 Ga0501221_008232 3300049704 Bacteria 1808
566 Ga0501225_0000335 3300049705 Bacteria 14740
567 Ga0501245_001972 3300049708 Bacteria 2713
568 Ga0501083_0303802 3300049744 Bacteria 1038
569 Ga0501279_000030 3300049775 Bacteria 37693
570 Ga0501280_000040 3300049776 Bacteria 38251
571 Ga0501281_02273 3300049777 Bacteria 1410
572 Ga0501283_012527 3300049779 Bacteria 1275
573 Ga0501045_0102623 3300049824 Bacteria 2117
574 nmdc:mga03683_23160_c1 3300050489 Bacteria 2416
575 nmdc:mga08y16_18347_c1 3300050511 Bacteria 7374
576 nmdc:mga0rr50_480387_c1 3300050513 Bacteria 1055
577 nmdc:mga0rr50_65342_c1 3300050513 Bacteria 2755
578 nmdc:mga0rr50_88628_c1 3300050513 Bacteria 2404
579 nmdc:mga08x19_144_c1 3300050514 Bacteria 61986
580 nmdc:mga08x19_15499_c1 3300050514 Bacteria 4638
581 nmdc:mga08x19_185908_c1 3300050514 Bacteria 1420
582 nmdc:mga08x19_19327_c1 3300050514 Bacteria 4179
583 nmdc:mga0a205_200314_c1 3300050515 Bacteria 1887
584 Ga0500592_000077 3300053116 Bacteria 24748
585 Ga0500593_000329 3300053117 Bacteria 19123
586 Ga0500622_0048923 3300053156 Bacteria 2180
587 Ga0500627_0006006 3300053158 Bacteria 4090
588 Ga0501084_0096320 3300054114 Bacteria 2485
589 Ga0501084_0124215 3300054114 Bacteria 2171
590 Ga0501082_0088555 3300060353 Bacteria 2671
591 Ga0530510_0132007 3300061734 Bacteria 1837
592 2829746298 2829745981 Bacteria 5406054
593 2511301209 2511231012 Bacteria 6738011
594 2511313003 2511231014 Bacteria 6462302
595 2511323449 2511231015 Bacteria 6598026
596 2511340461 2511231018 Bacteria 6436256
597 2511346661 2511231019 Bacteria 6520662
598 2511353570 2511231021 Bacteria 7302637
599 2587727861 2585428057 Bacteria 6737412
600 2643846036 2643221565 Bacteria 6216018
601 2643953878 2643221589 Bacteria 6250934
602 2644021812 2643221602 Bacteria 6249926
603 2644186965 2643221633 Bacteria 6733554
604 2739199980 2738543004 Bacteria 6381073
605 2739260139 2738543015 Bacteria 6750701
606 2774118895 2773857670 Bacteria 6407454
607 2784312534 2784132072 Bacteria 6596533
608 2808960108 2808606382 Bacteria 6841132
609 2842700331 2842698319 Bacteria 5190321
610 2861693839 2861691609 Bacteria 5628931
611 2904554546 2904550169 Bacteria 6221258
612 2908449725 2908446538 Bacteria 6829095
613 2939640188 2939636861 Bacteria 6297853
614 2946790686 2946787523 Bacteria 4366789
615 3007514982 3007511990 Bacteria 6481491
616 3007620285 3007619802 Bacteria 6411688
617 641336706 641228493 Bacteria 3999591
618 643391225 643348555 Bacteria 3914947
619 8056129634 8056125926 Bacteria 6228218
620 8056183997 8056177738 Bacteria 6748268
621 MRS2a_Contig_1683
622 JGI25406J46586_10013109
623 Ga0065714_10003326
624 Ga0065714_10007124
625 Ga0065714_10008554
626 Ga0065714_10017731
627 Ga0065712_10003822
628 Ga0065715_10131774
629 Ga0065707_10085957
630 Ga0070658_10452507
631 Ga0070690_100053755
632 Ga0070690_100078903
633 Ga0070670_100244776
634 Ga0070666_10004502
635 Ga0070680_100148030
636 Ga0070680_100460207
637 Ga0068868_100005917
638 Ga0070660_100199296
639 Ga0070689_100000450
640 Ga0070668_100241366
641 Ga0070675_100005533
642 Ga0070674_100092639
643 Ga0070673_100006766
644 Ga0070667_100004652
645 Ga0070667_100066329
646 Ga0070709_10006639
647 Ga0070714_100084424
648 Ga0070713_100060241
649 Ga0070662_100044454
650 Ga0070706_100496301
651 Ga0070699_100021566
652 Ga0070699_100220518
653 Ga0070697_100438995
654 Ga0070672_100003112
655 Ga0070693_100047535
656 Ga0068859_100655220
657 Ga0068858_100013306
658 Ga0081455_10051393
659 Ga0081539_10000178
660 Ga0075364_10017503
661 Ga0075364_10056866
662 Ga0075362_10034827
663 Ga0068871_100044103
664 Ga0075428_100655621
665 Ga0075433_10383526
666 Ga0075434_100089594
667 Ga0075436_100000191
668 Ga0075436_100012337
669 Ga0075436_100012626
670 Ga0075436_100077286
671 Ga0079104_1000441
672 Ga0099826_10185119
673 Ga0075435_100011103
674 Ga0075435_100240174
675 Ga0099794_10002127
676 Ga0099794_10157337
677 Ga0099795_10105637
678 Ga0105251_10000551
679 Ga0105251_10002380
680 Ga0105244_10029351
681 Ga0105250_10091296
682 Ga0111539_10001236
683 Ga0111539_10001845
684 Ga0114129_10097609
685 Ga0114129_10448467
686 Ga0105248_10099781
687 Ga0105238_10417517
688 Ga0105246_10054656
689 Ga0105246_10319892
690 Ga0157371_10000379
691 Ga0157371_10208249
692 Ga0157378_10000218
693 Ga0163162_10175494
694 Ga0157375_10000481
695 Ga0157375_11086145
696 Ga0157380_10647647
697 Ga0182008_10032685
698 Ga0157376_10021802
699 Ga0182006_1026969
700 Ga0182007_10015569
701 Ga0182005_1000698
702 Ga0163161_10000293
703 Ga0163161_10002662
704 Ga0163161_10015094
705 Ga0163161_10232070
706 Ga0209676_1003111
707 Ga0209050_1000458
708 Ga0207696_1005499
709 Ga0207655_1054065
710 Ga0207713_1000521
711 Ga0207713_1007742
712 Ga0207713_1021400
713 Ga0207713_1030195
714 Ga0207682_10023771
715 Ga0207680_10040324
716 Ga0207645_10003799
717 Ga0207705_10199821
718 Ga0207684_10575282
719 Ga0207660_10129466
720 Ga0207657_10092379
721 Ga0207646_10258273
722 Ga0207659_10013114
723 Ga0207706_10058721
724 Ga0207669_10265400
725 Ga0207665_10075160
726 Ga0207665_10328210
727 Ga0207691_10000725
728 Ga0207679_10180323
729 Ga0207651_10000222
730 Ga0207668_10490304
731 Ga0207677_10131301
732 Ga0207683_10001120
733 Ga0209281_1000199
734 Ga0209973_1011877
735 Ga0209969_1026055
736 Ga0209967_1000770
737 Ga0209984_1004976
738 Ga0210000_1000942
739 Ga0209968_1014239
740 Ga0209983_1002649
741 Ga0209971_1006495
742 Ga0209974_10002525
743 Ga0207428_10007642
744 Ga0207428_10015713
745 Ga0207428_10086386
746 Ga0207428_10127145
747 Ga0207428_10195904
748 Ga0268266_10084824
749 Ga0307515_10132061
750 Ga0307408_100138770
751 Ga0307406_10074048
752 Ga0316583_10006413
753 Ga0373934_0000565
754 Ga0373934_0073737
755 Ga0373923_0035778
756 Ga0373953_0035057
757 Ga0373956_0000155
758 Ga0373957_0004772
759 Ga0373957_0050542
760 Ga0373960_0006797
761 Ga0373960_0019353
762 Ga0373955_0008818
763 Ga0373955_0017170
764 Ga0373924_0002992
765 Ga0373924_0019114
766 Ga0373931_0028044
767 Ga0373931_0113746
768 Ga0373933_0002424
769 Ga0373933_0005656
770 Ga0373937_0012998
771 Ga0373937_0048170
772 Ga0373937_0104981
773 Ga0373937_0215012
774 Ga0373937_0291673
775 Ga0439438_000700
776 Ga0439438_009008
777 Ga0439447_000261
778 Ga0439466_0000837
779 Ga0439466_0000966
780 Ga0439466_0008123
781 Ga0451841_0767028
782 Ga0439432_011691
783 Ga0439432_050483
784 Ga0439452_000035
785 Ga0439452_000332
786 Ga0439452_000618
787 Ga0439452_004502
788 Ga0439456_000702
789 Ga0450911_000727
790 Ga0450911_007927
791 Ga0450920_013195
792 Ga0450922_004406
793 Ga0450902_000710
794 Ga0450902_005830
795 Ga0450903_000017
796 Ga0450903_002873
797 Ga0450903_007156
798 Ga0450903_008812
799 Ga0450903_011746
800 Ga0450905_006491
801 Ga0450907_000001
802 Ga0450907_011683
803 Ga0450910_002735
804 Ga0439446_0021229
805 Ga0450908_007407
806 Ga0450909_000419
807 Ga0439434_0000001
808 Ga0439460_0005837
809 Ga0439460_0057416
810 Ga0450901_003480
811 Ga0439440_0003315
812 Ga0453684_0586013
813 Ga0451576_0219374
814 Ga0495617_000175
815 Ga0495617_002727
816 Ga0495617_003664
817 Ga0495617_005932
818 Ga0495617_012954
819 Ga0495617_014958
820 Ga0495617_167061
821 Ga0495627_004957
822 Ga0495592_0001120
823 Ga0495603_0000689
824 Ga0495590_0000040
825 Ga0495590_0001025
826 Ga0495590_0006082
827 Ga0495590_0006255
828 Ga0495590_0009157
829 Ga0495591_000049
830 Ga0495591_001688
831 Ga0495591_002062
832 Ga0495591_004642
833 Ga0495591_011864
834 Ga0495591_012342
835 Ga0495591_022392
836 Ga0495591_029269
837 Ga0495629_0021846
838 Ga0495638_0000116
839 Ga0495638_0000568
840 Ga0495638_0000626
841 Ga0495638_0000684
842 Ga0495638_0001444
843 Ga0495638_0001526
844 Ga0495638_0003800
845 Ga0495638_0013821
846 Ga0495638_0017973
847 Ga0495638_0031352
848 Ga0495638_0049527
849 Ga0495638_0051116
850 Ga0495638_0051302
851 Ga0495638_0133747
852 Ga0495651_0004288
853 Ga0495653_0019288
854 Ga0495650_0002085
855 Ga0495650_0012910
856 Ga0495650_0029121
857 Ga0495650_0089035
858 Ga0495582_0010136
859 Ga0495605_0000215
860 Ga0495605_0000572
861 Ga0495605_0024567
862 Ga0495605_0033021
863 Ga0495605_0042306
864 Ga0495639_0003018
865 Ga0495639_0032371
866 Ga0495584_0000054
867 Ga0495584_0001003
868 Ga0495584_0010795
869 Ga0495584_0010844
870 Ga0495584_0011119
871 Ga0495584_0015087
872 Ga0495584_0026533
873 Ga0495585_0000016
874 Ga0495585_0000227
875 Ga0495585_0000441
876 Ga0495585_0005990
877 Ga0495585_0012924
878 Ga0495585_0027294
879 Ga0495585_0178955
880 Ga0495594_0007963
881 Ga0495594_0035128
882 Ga0495596_0000454
883 Ga0495607_0003174
884 Ga0495607_0004998
885 Ga0495607_0029839
886 Ga0495607_0029905
887 Ga0495607_0035679
888 Ga0495607_0052048
889 Ga0495607_0119643
890 Ga0495583_0000708
891 Ga0495583_0001334
892 Ga0495583_0001922
893 Ga0495583_0003944
894 Ga0495583_0018098
895 Ga0495606_0005566
896 Ga0495606_0011906
897 Ga0495606_0025479
898 Ga0495606_0106352
899 Ga0495610_0000631
900 Ga0495610_0007082
901 Ga0495610_0007858
902 Ga0495610_0008870
903 Ga0495610_0016042
904 Ga0495610_0016473
905 Ga0495610_0026890
906 Ga0495616_0005072
907 Ga0495616_0007353
908 Ga0495616_0036653
909 Ga0495616_0087734
910 Ga0495616_0119348
911 Ga0495620_0003703
912 Ga0495620_0003805
913 Ga0495620_0010547
914 Ga0495620_0044898
915 Ga0495620_0076235
916 Ga0495628_0000904
917 Ga0495628_0097041
918 Ga0495630_0011457
919 Ga0495630_0046637
920 Ga0495630_0154175
921 Ga0495631_0001303
922 Ga0495631_0024545
923 Ga0495631_0053923
924 Ga0495631_0099821
925 Ga0495632_0000166
926 Ga0495632_0000992
927 Ga0495632_0002945
928 Ga0495632_0004432
929 Ga0495632_0006992
930 Ga0495632_0013964
931 Ga0495632_0016929
932 Ga0495632_0027449
933 Ga0495637_0000608
934 Ga0495637_0000852
935 Ga0495637_0000879
936 Ga0495637_0002271
937 Ga0495637_0002854
938 Ga0495637_0004013
939 Ga0495637_0006642
940 Ga0495637_0012723
941 Ga0495637_0032071
942 Ga0495637_0033439
943 Ga0495637_0040331
944 Ga0495637_0060596
945 Ga0495643_0022744
946 Ga0495643_0026534
947 Ga0495643_0027535
948 Ga0495643_0055927
949 Ga0495643_0059589
950 Ga0495643_0065708
951 Ga0495643_0089977
952 Ga0495644_0000323
953 Ga0495644_0000338
954 Ga0495644_0006154
955 Ga0495644_0021656
956 Ga0495644_0035971
957 Ga0495648_0000429
958 Ga0495648_0000812
959 Ga0495648_0001001
960 Ga0495648_0009633
961 Ga0495648_0026715
962 Ga0495648_0060724
963 Ga0495648_0125306
964 Ga0495666_0010679
965 Ga0495666_0027288
966 Ga0495642_0000016
967 Ga0495642_0000023
968 Ga0495652_0005891
969 Ga0495654_0001623
970 Ga0495654_0001726
971 Ga0495654_0001827
972 Ga0495654_0001856
973 Ga0495654_0002118
974 Ga0495654_0002516
975 Ga0495654_0002819
976 Ga0495654_0009258
977 Ga0495654_0018429
978 Ga0495654_0031684
979 Ga0495654_0159542
980 Ga0495587_0000989
981 Ga0495587_0041805
982 Ga0495609_0079041
983 Ga0495609_0101386
984 Ga0495597_0003494
985 Ga0495597_0014775
986 Ga0495597_0017058
987 Ga0495597_0020516
988 Ga0495597_0022736
989 Ga0495597_0026792
990 Ga0495597_0036388
991 Ga0495597_0053033
992 Ga0495645_0000272
993 Ga0495645_0042198
994 Ga0495645_0200304
995 Ga0495622_0000335
996 Ga0495622_0044069
997 Ga0495633_0066673
998 Ga0495667_0064961
999 Ga0495656_0073407
1000 Ga0495656_0078310
1001 Ga0495656_0113875
1002 Ga0495668_0002065
1003 Ga0495668_0022748
1004 Ga0495634_0000572
1005 Ga0495611_0021658
1006 Ga0495625_0005341
1007 Ga0495625_0009587
1008 Ga0495625_0011666
1009 Ga0495625_0045370
1010 Ga0495625_0179276
1011 Ga0495625_0245748
1012 Ga0495635_0000115
1013 Ga0495635_0048482
1014 Ga0495659_0013740
1015 Ga0495661_0000686
1016 Ga0495661_0004926
1017 Ga0495661_0008810
1018 Ga0495661_0020156
1019 Ga0495588_0008021
1020 Ga0495657_0026028
1021 Ga0495657_0296348
1022 Ga0495599_0001029
1023 Ga0495599_0247828
1024 Ga0495623_0000178
1025 Ga0495623_0122830
1026 Ga0495646_0008931
1027 Ga0495669_0031713
1028 Ga0495669_0107278
1029 Ga0495613_0014787
1030 Ga0495613_0072838
1031 Ga0495670_0000434
1032 Ga0495670_0008239
1033 Ga0495670_0012801
1034 Ga0495670_0059680
1035 Ga0495671_0000525
1036 Ga0495671_0015204
1037 Ga0495671_0023703
1038 Ga0495671_0036388
1039 Ga0495671_0037313
1040 Ga0495671_0083391
1041 Ga0495671_0253987
1042 Ga0495649_0000763
1043 Ga0495649_0004154
1044 Ga0495649_0005691
1045 Ga0495649_0009385
1046 Ga0495649_0024657
1047 Ga0495649_0026407
1048 Ga0495649_0034645
1049 Ga0495589_0003127
1050 Ga0495589_0003965
1051 Ga0495589_0068118
1052 Ga0495660_0001030
1053 Ga0495660_0005589
1054 Ga0495660_0006827
1055 Ga0495660_0024645
1056 Ga0495660_0045562
1057 Ga0495660_0179098
1058 Ga0495581_0112418
1059 Ga0495604_0029107
1060 Ga0495604_0060721
1061 Ga0495604_0111365
1062 Ga0495672_0001022
1063 Ga0495672_0001954
1064 Ga0495672_0002006
1065 Ga0495672_0005214
1066 Ga0495672_0006243
1067 Ga0495672_0013902
1068 Ga0495672_0034687
1069 Ga0495672_0037343
1070 Ga0495672_0042569
1071 Ga0495672_0093475
1072 Ga0495672_0115239
1073 Ga0495680_0000459
1074 Ga0495680_0017091
1075 Ga0495683_0000116
1076 Ga0495683_0010374
1077 Ga0495683_0011556
1078 Ga0495683_0026108
1079 Ga0495683_0044127
1080 Ga0495683_0071844
1081 Ga0495687_000490
1082 Ga0495687_002535
1083 Ga0495677_0005333
1084 Ga0495679_004309
1085 Ga0495679_006614
1086 Ga0495685_020713
1087 Ga0495673_0000715
1088 Ga0495673_0000815
1089 Ga0495673_0001057
1090 Ga0495673_0001315
1091 Ga0495673_0002132
1092 Ga0495673_0003720
1093 Ga0495673_0008286
1094 Ga0495673_0028738
1095 Ga0495673_0038778
1096 Ga0495673_0066793
1097 Ga0495681_0000075
1098 Ga0495681_0000232
1099 Ga0495681_0000486
1100 Ga0495681_0004085
1101 Ga0495681_0004699
1102 Ga0495681_0006958
1103 Ga0495681_0009975
1104 Ga0495681_0043373
1105 Ga0495684_0070342
1106 Ga0495686_0000990
1107 Ga0495686_0033300
1108 Ga0495686_0214328
1109 Ga0495686_0230478
1110 Ga0495593_0014975
1111 Ga0495593_0084718
1112 Ga0495593_0147249
1113 Ga0495626_0000057
1114 Ga0495626_0000065
1115 Ga0495626_0000361
1116 Ga0495626_0021676
1117 Ga0495626_0022592
1118 Ga0496100_0276044
1119 Ga0496101_0315024
1120 Ga0496102_0000073
1121 Ga0496102_0024626
1122 Ga0496103_0000363
1123 Ga0496104_0000574
1124 Ga0496104_0004271
1125 Ga0496105_0025244
1126 Ga0496105_0051185
1127 Ga0496106_0004084
1128 Ga0496106_0393215
1129 Ga0496108_0072316
1130 Ga0496108_0110688
1131 Ga0496109_0044658
1132 Ga0496110_0131608
1133 Ga0496110_0221351
1134 Ga0496112_0146838
1135 Ga0496112_0500928
1136 Ga0496113_0059806
1137 Ga0496113_0223189
1138 Ga0496114_0090359
1139 Ga0496115_0076770
1140 Ga0496116_0160569
1141 Ga0496117_0001418
1142 Ga0496117_0093021
1143 Ga0496118_0005094
1144 Ga0496118_0102033
1145 Ga0496124_0001820
1146 Ga0496124_0058717
1147 Ga0496125_0005291
1148 Ga0495678_001342
1149 Ga0495678_008751
1150 Ga0495678_008974
1151 Ga0495678_018474
1152 Ga0495678_019438
1153 Ga0495678_025298
1154 Ga0495678_029172
1155 Ga0495678_061241
1156 Ga0495682_0005309
1157 Ga0495682_0032217
1158 Ga0495682_0065814
1159 Ga0495682_0070062
1160 Ga0495682_0076654
1161 Ga0501290_000012
1162 Ga0501292_000043
1163 Ga0501294_000563
1164 Ga0501300_000322
1165 Ga0501038_0288083
1166 Ga0501039_0055108
1167 Ga0501041_0042511
1168 Ga0501043_0099918
1169 Ga0501046_0046827
1170 Ga0501071_0348901
1171 Ga0501072_0119851
1172 Ga0501075_0021036
1173 Ga0501075_0140174
1174 Ga0501076_0010479
1175 Ga0501076_0113232
1176 Ga0501077_0119769
1177 Ga0501206_002530
1178 Ga0501222_016270
1179 Ga0501223_001009
1180 Ga0501224_000380
1181 Ga0501227_007734
1182 Ga0501235_000932
1183 Ga0501259_003243
1184 Ga0501261_000028
1185 Ga0501221_008232
1186 Ga0501225_0000335
1187 Ga0501245_001972
1188 Ga0501083_0303802
1189 Ga0501279_000030
1190 Ga0501280_000040
1191 Ga0501281_02273
1192 Ga0501283_012527
1193 Ga0501045_0102623
1194 nmdc:mga03683_23160_c1
1195 nmdc:mga08y16_18347_c1
1196 nmdc:mga0rr50_480387_c1
1197 nmdc:mga0rr50_65342_c1
1198 nmdc:mga0rr50_88628_c1
1199 nmdc:mga08x19_144_c1
1200 nmdc:mga08x19_15499_c1
1201 nmdc:mga08x19_185908_c1
1202 nmdc:mga08x19_19327_c1
1203 nmdc:mga0a205_200314_c1
1204 Ga0500592_000077
1205 Ga0500593_000329
1206 Ga0500622_0048923
1207 Ga0500627_0006006
1208 Ga0501084_0096320
1209 Ga0501084_0124215
1210 Ga0501082_0088555
1211 Ga0530510_0132007
1212 2829746298
1213 2511301209
1214 2511313003
1215 2511323449
1216 2511340461
1217 2511346661
1218 2511353570
1219 2587727861
1220 2643846036
1221 2643953878
1222 2644021812
1223 2644186965
1224 2739199980
1225 2739260139
1226 2774118895
1227 2784312534
1228 2808960108
1229 2842700331
1230 2861693839
1231 2904554546
1232 2908449725
1233 2939640188
1234 2946790686
1235 3007514982
1236 3007620285
1237 641336706
1238 643391225
1239 8056129634
1240 8056183997

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

86

188

0.86

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

182

277

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9295 115 245
1sox-assembly1.cif.gz_A sulfite oxidase from chicken liver 0.9083 107 245
2a99-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9058 107 243
2a9b-assembly1.cif.gz_A crystal structure of r138q mutant of recombinant sulfite oxidase at resting state 0.9016 107 245
3r19-assembly1.cif.gz_A-2 chicken sulfite oxidase triple mutant with altered activity and substrate affinity 0.9004 107 245
ID Description Score Start End Superfamily
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8981 107 243 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8647 96 243 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8445 86 254 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8384 96 243 3.90.420.10
af_A0A0R4IKF7_192_441_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8207 86 243 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A537TEQ0-F1-model_v4 Molybdopterin-binding protein 0.9552 80 257
AF-A0A380AE90-F1-model_v4 Sulfoxide reductase catalytic subunit yedY (EC 1.8.-.-) 0.9433 82 257 GO:0016491
AF-A0A2V8U2V9-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9418 108 246
AF-A0A1F5DHC0-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9416 106 248
AF-A0A1Q5QVM3-F1-model_v4 Molybdopterin-binding protein 0.9391 115 257

Map