F469958

General Info

Members Datasets Scaffolds Average Seq Length
620 314 575 426

Family's Representative Sequence

Representative Sequence 3300053109|Ga0500569_002571|Ga0500569_002571_1089_2543
Length 484
Sequence MDSLPCALYLSDLVRPNWDVLLHSSNSYKILIVKGEKAMPFLPFSFLPIFALHSMYMDYQQTLDYLYERLPMFTRVGASAFRKDLHNTIALCEQLGNPQHKFKSIHVAGTNGKGSSSHMLAAIFQQAGYKTGLYTSPHLKDFRERIRINGEMMPTTFVTEFVELMQPSIEALDPSFFELTVAMAFQYFALEQVDVAIIEVGLGGRLDSTNIITPELSLITNISYDHMNILGNTLPEIASEKAGIIKAGVPVVVSQTQSEIESVFIDKAASLNAPIHFADQEWIIQENEFSAGHLQLGILPHKGGYMRRLALDLSGQYQVKNILGVLSAVKILQQGDWKLPDAGVAEALSHVKKLTGLRGRWDIIDKHPLTILDVGHNEAGITEIVEQLRHMVYRQLHIVTGFVKDKEVDKVLSIFPPAATYYFCKAQIPRALDEKTLAEMALAKGLRGHTYTSVQQAFMTAKQHAHEEDIILVCGSFFIVAEAM

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
12 2818991437 Pedobacter terrae 518 Isolate Unclassified
13 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
14 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
15 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
16 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
17 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
18 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
19 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
20 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
21 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
22 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
23 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
24 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
25 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
26 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
27 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
28 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
29 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
30 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
31 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
32 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
33 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
34 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
35 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
36 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
37 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
38 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
39 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
40 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
41 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
42 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
43 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
44 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
45 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
46 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
47 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
51 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
52 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
53 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
54 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
55 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
63 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
64 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
65 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
66 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
67 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
68 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
76 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
77 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
78 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
79 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
80 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
81 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
82 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
83 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
84 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
85 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
89 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
90 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
97 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
100 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
101 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
102 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
103 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
104 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
149 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
150 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
151 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
156 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
158 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
159 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
216 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
217 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
224 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
225 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
226 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
245 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
246 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
247 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
248 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
249 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
286 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
291 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
292 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
293 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
298 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
299 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
300 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
301 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
302 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
303 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
304 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
310 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
311 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
312 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.74
Metatranscriptomes 0
Isolates 7.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.45
Nodule 0
Rhizoplane 0.32
Rhizosphere 76.77
Stem 0
Stem Tuber 0
Unclassified 11.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1054638 2162886007 Bacteria 2685
2 SwRhRL2b_contig_1490341 2162886007 Bacteria 8969
3 JGI24736J21556_1002967 3300001904 Bacteria 2968
4 JGI24740J21852_10001023 3300001979 Bacteria 12526
5 JGI24740J21852_10027557 3300001979 Bacteria 1889
6 JGI24739J22299_10011165 3300001989 Bacteria 3318
7 JGI24739J22299_10011387 3300001989 Unclassified 3285
8 JGI24735J21928_10000008 3300002067 Bacteria 319819
9 JGI24735J21928_10013851 3300002067 Bacteria 2529
10 JGI25162J39368_1000047 3300002737 Viruses 167507
11 JGI25162J39368_1000183 3300002737 Bacteria 67086
12 JGI25162J39368_1000940 3300002737 Bacteria 18700
13 JGI25154J39366_1000012 3300002738 Bacteria 287601
14 JGI25158J39367_1003512 3300002739 Unclassified 2417
15 JGI25164J39214_1000871 3300002772 Bacteria 10261
16 JGI25152J39213_1000457 3300002773 Bacteria 23842
17 JGI25150J39212_1000306 3300002774 Bacteria 24521
18 JGI25151J46595_10000824 3300003187 Bacteria 24698
19 JGI25406J46586_10001770 3300003203 Bacteria 10168
20 JGI25153J46596_10000509 3300003215 Bacteria 24520
21 JGI25153J46596_10000581 3300003215 Bacteria 22486
22 rootH1_10016586 3300003316 Bacteria 25446
23 rootH1_10025462 3300003316 Bacteria 3198
24 rootH1_10054479 3300003316 Bacteria 3604
25 rootH1_10170876 3300003316 Bacteria 2085
26 rootH1_10192434 3300003316 Bacteria 1460
27 rootH2_10013605 3300003320 Bacteria 52813
28 rootH2_10028771 3300003320 Bacteria 3934
29 rootH2_10041501 3300003320 Unclassified 1849
30 rootH2_10074885 3300003320 Bacteria 4387
31 rootH2_10092044 3300003320 Bacteria 4262
32 rootH2_10104003 3300003320 Bacteria 9877
33 rootL2_10025431 3300003322 Bacteria 3854
34 rootL2_10131654 3300003322 Bacteria 1609
35 rootL2_10155397 3300003322 Bacteria 4182
36 rootH1_10000992 3300003323 Bacteria 13722
37 rootH1_10000993 3300003323 Bacteria 7770
38 rootH1_10001262 3300003323 Bacteria 49298
39 rootH1_10002086 3300003323 Bacteria 48822
40 rootH1_10035028 3300003323 Bacteria 17012
41 rootH1_10120436 3300003323 Bacteria 3893
42 rootH1_10235163 3300003323 Bacteria 3420
43 rootH1_10247724 3300003323 Bacteria 2243
44 JGI25160J50197_1001214 3300003354 Bacteria 13094
45 Ga0055535_1004061 3300003761 Bacteria 3760
46 Ga0055542_1004524 3300003762 Bacteria 3351
47 Ga0055526_1010794 3300003771 Bacteria 4203
48 Ga0055526_1011540 3300003771 Bacteria 3964
49 Ga0055536_1000007 3300003781 Bacteria 345133
50 Ga0055528_1001120 3300003790 Bacteria 17577
51 Ga0055530_10001914 3300003791 Bacteria 14232
52 Ga0055531_10000287 3300003794 Bacteria 50954
53 Ga0055531_10004384 3300003794 Bacteria 8614
54 Ga0065165_1000958 3300005262 Bacteria 36282
55 Ga0065165_1001313 3300005262 Bacteria 27754
56 Ga0065714_10006135 3300005288 Bacteria 5121
57 Ga0065714_10064844 3300005288 Bacteria 17133
58 Ga0065714_10067074 3300005288 Bacteria 5922
59 Ga0065714_10068524 3300005288 Bacteria 4671
60 Ga0065714_10078351 3300005288 Bacteria 2606
61 Ga0065714_10093020 3300005288 Bacteria 1860
62 Ga0065704_10000572 3300005289 Bacteria 16112
63 Ga0065704_10075622 3300005289 Bacteria 5497
64 Ga0065704_10119989 3300005289 Bacteria 1742
65 Ga0070658_10000014 3300005327 Bacteria 244978
66 Ga0070683_100002140 3300005329 Bacteria 15613
67 Ga0070683_100092330 3300005329 Bacteria 2843
68 Ga0070690_100021708 3300005330 Bacteria 3922
69 Ga0070670_100255475 3300005331 Bacteria 1527
70 Ga0068869_100019171 3300005334 Bacteria 4670
71 Ga0068869_100028033 3300005334 Bacteria 3931
72 Ga0068869_100060425 3300005334 Bacteria 2777
73 Ga0070666_10021519 3300005335 Bacteria 4182
74 Ga0070682_100000115 3300005337 Bacteria 71292
75 Ga0068868_100009145 3300005338 Bacteria 7114
76 Ga0068868_100034039 3300005338 Bacteria 3931
77 Ga0070660_100202813 3300005339 Bacteria 1609
78 Ga0070689_100004971 3300005340 Bacteria 9030
79 Ga0070691_10083938 3300005341 Bacteria 1563
80 Ga0070661_100002067 3300005344 Bacteria 13820
81 Ga0070661_100058918 3300005344 Bacteria 2815
82 Ga0070668_100021168 3300005347 Bacteria 4916
83 Ga0070669_100008600 3300005353 Bacteria 7286
84 Ga0070669_100030864 3300005353 Bacteria 3869
85 Ga0070675_100060605 3300005354 Bacteria 3124
86 Ga0070675_100167529 3300005354 Unclassified 1893
87 Ga0070671_100005292 3300005355 Bacteria 10296
88 Ga0070673_100008346 3300005364 Bacteria 6881
89 Ga0070673_100019427 3300005364 Bacteria 4876
90 Ga0070673_100053975 3300005364 Bacteria 3160
91 Ga0070673_100054257 3300005364 Bacteria 3152
92 Ga0070673_100276761 3300005364 Bacteria 1471
93 Ga0070688_100054257 3300005365 Bacteria 2510
94 Ga0070659_100000188 3300005366 Bacteria 47486
95 Ga0070659_100009746 3300005366 Bacteria 7059
96 Ga0070659_100012085 3300005366 Bacteria 6393
97 Ga0070659_100062301 3300005366 Bacteria 2948
98 Ga0070667_100056224 3300005367 Bacteria 3324
99 Ga0070667_100065930 3300005367 Bacteria 3075
100 Ga0070700_100174510 3300005441 Bacteria 1491
101 Ga0070663_100017904 3300005455 Bacteria 4632
102 Ga0070678_100000566 3300005456 Bacteria 18121
103 Ga0070662_100000054 3300005457 Bacteria 60719
104 Ga0070662_100025824 3300005457 Bacteria 4060
105 Ga0070662_100044677 3300005457 Unclassified 3174
106 Ga0068867_100009805 3300005459 Bacteria 6749
107 Ga0068867_100027953 3300005459 Bacteria 4058
108 Ga0068867_100106472 3300005459 Unclassified 2148
109 Ga0070685_10002672 3300005466 Bacteria 9124
110 Ga0070698_100031095 3300005471 Bacteria 5535
111 Ga0070684_100005082 3300005535 Bacteria 10048
112 Ga0070684_100005635 3300005535 Bacteria 9623
113 Ga0068853_100004447 3300005539 Bacteria 10860
114 Ga0068853_100019354 3300005539 Bacteria 5644
115 Ga0068853_100087507 3300005539 Bacteria 2734
116 Ga0070672_100018247 3300005543 Bacteria 5067
117 Ga0070693_100093371 3300005547 Bacteria 1818
118 Ga0070665_100000010 3300005548 Bacteria 529545
119 Ga0068855_100033283 3300005563 Bacteria 6153
120 Ga0068855_100062882 3300005563 Bacteria 4333
121 Ga0068855_100215661 3300005563 Bacteria 2154
122 Ga0070664_100001152 3300005564 Bacteria 20949
123 Ga0068857_100005746 3300005577 Bacteria 10608
124 Ga0068857_100026983 3300005577 Bacteria 5066
125 Ga0068854_100069251 3300005578 Bacteria 2575
126 Ga0068854_100081647 3300005578 Unclassified 2388
127 Ga0068856_100005294 3300005614 Bacteria 12730
128 Ga0068856_100032967 3300005614 Bacteria 5073
129 Ga0068852_100004334 3300005616 Bacteria 10015
130 Ga0068852_100056669 3300005616 Bacteria 3388
131 Ga0068852_100162569 3300005616 Bacteria 2086
132 Ga0068859_100000534 3300005617 Bacteria 37702
133 Ga0068859_100161801 3300005617 Unclassified 2317
134 Ga0068864_100071597 3300005618 Unclassified 3019
135 Ga0068861_100003538 3300005719 Bacteria 10386
136 Ga0068861_100022889 3300005719 Bacteria 4504
137 Ga0068858_100050728 3300005842 Bacteria 3840
138 Ga0068858_100056432 3300005842 Bacteria 3630
139 Ga0068858_100127584 3300005842 Bacteria 2384
140 Ga0068860_100262280 3300005843 Bacteria 1684
141 Ga0068860_100278909 3300005843 Bacteria 1633
142 Ga0081539_10003031 3300005985 Bacteria 21772
143 Ga0097621_100000247 3300006237 Bacteria 36324
144 Ga0097621_100094515 3300006237 Bacteria 2506
145 Ga0075370_10058948 3300006353 Bacteria 2184
146 Ga0068871_100003906 3300006358 Bacteria 10272
147 Ga0068871_100043057 3300006358 Bacteria 3626
148 Ga0068865_100000076 3300006881 Bacteria 51732
149 Ga0068865_100241776 3300006881 Bacteria 1421
150 Ga0097620_100000534 3300006931 Bacteria 37702
151 Ga0097620_100161812 3300006931 Unclassified 2317
152 Ga0105240_10000037 3300009093 Bacteria 270462
153 Ga0105240_10096916 3300009093 Bacteria 3594
154 Ga0105240_10168375 3300009093 Bacteria 2597
155 Ga0105240_10298188 3300009093 Bacteria 1845
156 Ga0105240_10436381 3300009093 Bacteria 1468
157 Ga0111539_10004074 3300009094 Bacteria 19184
158 Ga0105243_10020938 3300009148 Bacteria 4962
159 Ga0105241_10001338 3300009174 Bacteria 18702
160 Ga0105241_10099865 3300009174 Bacteria 2305
161 Ga0105242_10055630 3300009176 Bacteria 3237
162 Ga0105248_10125182 3300009177 Bacteria 2899
163 Ga0105237_10000994 3300009545 Bacteria 38153
164 Ga0105237_10002957 3300009545 Bacteria 20562
165 Ga0105237_10008782 3300009545 Bacteria 10901
166 Ga0105237_10026331 3300009545 Bacteria 5944
167 Ga0105238_10004834 3300009551 Bacteria 13328
168 Ga0105249_10009057 3300009553 Bacteria 8701
169 Ga0105249_10307285 3300009553 Bacteria 1593
170 Ga0105239_10000162 3300010375 Bacteria 95804
171 Ga0105239_10000606 3300010375 Bacteria 51062
172 Ga0105239_10000816 3300010375 Bacteria 44236
173 Ga0105239_10003173 3300010375 Bacteria 20361
174 Ga0105239_10021827 3300010375 Bacteria 7057
175 Ga0105239_10047642 3300010375 Bacteria 4697
176 Ga0105239_10118580 3300010375 Bacteria 2937
177 Ga0105239_10174704 3300010375 Bacteria 2402
178 Ga0105239_10307345 3300010375 Bacteria 1787
179 Ga0157373_10001086 3300013100 Bacteria 20964
180 Ga0157373_10003109 3300013100 Bacteria 12543
181 Ga0157373_10048257 3300013100 Bacteria 3036
182 Ga0157373_10054333 3300013100 Bacteria 2846
183 Ga0157371_10000298 3300013102 Bacteria 65719
184 Ga0157371_10002074 3300013102 Bacteria 19640
185 Ga0157371_10002900 3300013102 Bacteria 16037
186 Ga0157371_10002916 3300013102 Bacteria 15984
187 Ga0157371_10004305 3300013102 Bacteria 12488
188 Ga0157371_10005923 3300013102 Bacteria 10208
189 Ga0157371_10017139 3300013102 Bacteria 5387
190 Ga0157371_10040301 3300013102 Bacteria 3336
191 Ga0157371_10128584 3300013102 Bacteria 1802
192 Ga0157370_10004368 3300013104 Bacteria 16230
193 Ga0157370_10006534 3300013104 Bacteria 12836
194 Ga0157370_10008717 3300013104 Bacteria 10910
195 Ga0157370_10013059 3300013104 Bacteria 8575
196 Ga0157370_10022056 3300013104 Bacteria 6340
197 Ga0157370_10024460 3300013104 Bacteria 5982
198 Ga0157370_10024483 3300013104 Bacteria 5979
199 Ga0157370_10067203 3300013104 Bacteria 3388
200 Ga0157370_10175488 3300013104 Bacteria 1992
201 Ga0157369_10000498 3300013105 Bacteria 51923
202 Ga0157369_10001614 3300013105 Bacteria 27591
203 Ga0157369_10010208 3300013105 Bacteria 10716
204 Ga0157369_10122353 3300013105 Bacteria 2760
205 Ga0157374_10000003 3300013296 Bacteria 854471
206 Ga0157374_10000847 3300013296 Bacteria 26750
207 Ga0157374_10001476 3300013296 Bacteria 19869
208 Ga0157374_10002139 3300013296 Bacteria 16656
209 Ga0157374_10005179 3300013296 Bacteria 10934
210 Ga0157374_10009869 3300013296 Bacteria 8195
211 Ga0157374_10012490 3300013296 Bacteria 7393
212 Ga0157374_10281967 3300013296 Bacteria 1641
213 Ga0157378_10019319 3300013297 Bacteria 5991
214 Ga0157378_10022103 3300013297 Bacteria 5597
215 Ga0157378_10036795 3300013297 Bacteria 4332
216 Ga0157378_10123501 3300013297 Bacteria 2389
217 Ga0163162_10000369 3300013306 Bacteria 40837
218 Ga0163162_10000379 3300013306 Bacteria 40471
219 Ga0163162_10007367 3300013306 Bacteria 10697
220 Ga0163162_10010696 3300013306 Bacteria 8926
221 Ga0163162_10088408 3300013306 Bacteria 3178
222 Ga0163162_10091008 3300013306 Bacteria 3133
223 Ga0163162_10120748 3300013306 Bacteria 2725
224 Ga0163162_10131756 3300013306 Bacteria 2609
225 Ga0163162_10247553 3300013306 Bacteria 1914
226 Ga0157372_10000026 3300013307 Bacteria 195407
227 Ga0157372_10000071 3300013307 Bacteria 109638
228 Ga0157372_10002043 3300013307 Bacteria 21955
229 Ga0157372_10023226 3300013307 Bacteria 6720
230 Ga0157372_10038935 3300013307 Bacteria 5248
231 Ga0157372_10115006 3300013307 Bacteria 3084
232 Ga0157375_10014385 3300013308 Bacteria 7057
233 Ga0157375_10016985 3300013308 Bacteria 6557
234 Ga0157375_10048424 3300013308 Bacteria 4158
235 Ga0157375_10129381 3300013308 Bacteria 2643
236 Ga0163163_10057325 3300014325 Unclassified 3851
237 Ga0157380_10000001 3300014326 Bacteria 254890
238 Ga0157380_10004095 3300014326 Bacteria 10075
239 Ga0182008_10000887 3300014497 Bacteria 20787
240 Ga0182008_10000955 3300014497 Bacteria 20144
241 Ga0182008_10001974 3300014497 Bacteria 13176
242 Ga0157377_10006317 3300014745 Bacteria 5642
243 Ga0157377_10008499 3300014745 Bacteria 5009
244 Ga0157377_10012788 3300014745 Bacteria 4231
245 Ga0157379_10025022 3300014968 Bacteria 5300
246 Ga0157379_10117056 3300014968 Bacteria 2397
247 Ga0157376_10038530 3300014969 Bacteria 3890
248 Ga0157376_10091130 3300014969 Bacteria 2640
249 Ga0157376_10122967 3300014969 Bacteria 2303
250 Ga0182006_1000120 3300015261 Bacteria 84872
251 Ga0182006_1000339 3300015261 Bacteria 39995
252 Ga0182006_1001468 3300015261 Bacteria 14185
253 Ga0182006_1002423 3300015261 Bacteria 10195
254 Ga0182006_1013711 3300015261 Bacteria 3508
255 Ga0182007_10000054 3300015262 Bacteria 91906
256 Ga0182007_10007410 3300015262 Bacteria 4603
257 Ga0182007_10015102 3300015262 Bacteria 2891
258 Ga0182007_10015496 3300015262 Bacteria 2840
259 Ga0182005_1000282 3300015265 Bacteria 32044
260 Ga0183373_1015 3300015682 Bacteria 63862
261 Ga0163161_10000315 3300017792 Bacteria 41700
262 Ga0163161_10000392 3300017792 Bacteria 36571
263 Ga0163161_10001301 3300017792 Bacteria 18595
264 Ga0163161_10002910 3300017792 Bacteria 12115
265 Ga0163161_10003310 3300017792 Bacteria 11307
266 Ga0163161_10103262 3300017792 Bacteria 2124
267 Ga0209436_101314 3300025208 Bacteria 8826
268 Ga0207427_100137 3300025231 Bacteria 88182
269 Ga0209437_100089 3300025233 Bacteria 250476
270 Ga0209437_100112 3300025233 Bacteria 214292
271 Ga0209258_100098 3300025242 Bacteria 215216
272 Ga0207425_1000488 3300025245 Bacteria 24881
273 Ga0209646_1000009 3300025246 Bacteria 652154
274 Ga0209026_1000221 3300025250 Bacteria 78071
275 Ga0209148_1000120 3300025254 Bacteria 186836
276 Ga0209129_1000587 3300025258 Bacteria 25009
277 Ga0209233_1000126 3300025261 Bacteria 214298
278 Ga0209233_1001941 3300025261 Bacteria 7883
279 Ga0209455_1001550 3300025272 Bacteria 10182
280 Ga0209673_1000016 3300025273 Bacteria 506202
281 Ga0209676_1000058 3300025292 Bacteria 345185
282 Ga0209025_1001846 3300025294 Bacteria 24881
283 Ga0209564_1002883 3300025295 Bacteria 12595
284 Ga0209564_1002893 3300025295 Bacteria 12542
285 Ga0209564_1027219 3300025295 Bacteria 1863
286 Ga0209758_1001686 3300025297 Bacteria 24881
287 Ga0209758_1003120 3300025297 Bacteria 15648
288 Ga0209758_1006677 3300025297 Bacteria 8151
289 Ga0209050_1000054 3300025298 Bacteria 345186
290 Ga0209050_1000124 3300025298 Bacteria 194022
291 Ga0207426_1000139 3300025302 Bacteria 195835
292 Ga0207426_1000477 3300025302 Bacteria 61236
293 Ga0207426_1001747 3300025302 Bacteria 16539
294 Ga0207426_1009837 3300025302 Bacteria 3750
295 Ga0209257_1000006 3300025304 Bacteria 1570111
296 Ga0209257_1000013 3300025304 Bacteria 1047305
297 Ga0209257_1003422 3300025304 Bacteria 13644
298 Ga0207680_10006649 3300025903 Bacteria 5609
299 Ga0207647_10000046 3300025904 Bacteria 90148
300 Ga0207647_10000154 3300025904 Bacteria 54378
301 Ga0207645_10002749 3300025907 Bacteria 13705
302 Ga0207645_10008615 3300025907 Bacteria 7102
303 Ga0207645_10121834 3300025907 Bacteria 1693
304 Ga0207643_10036207 3300025908 Bacteria 2767
305 Ga0207705_10000107 3300025909 Bacteria 94984
306 Ga0207654_10002429 3300025911 Bacteria 9511
307 Ga0207654_10017851 3300025911 Bacteria 3717
308 Ga0207695_10000092 3300025913 Bacteria 270514
309 Ga0207695_10024070 3300025913 Bacteria 6862
310 Ga0207695_10057854 3300025913 Bacteria 4026
311 Ga0207695_10082541 3300025913 Bacteria 3249
312 Ga0207695_10139059 3300025913 Bacteria 2379
313 Ga0207671_10002724 3300025914 Bacteria 18482
314 Ga0207671_10006180 3300025914 Bacteria 10754
315 Ga0207671_10007283 3300025914 Bacteria 9625
316 Ga0207660_10012777 3300025917 Bacteria 5497
317 Ga0207662_10176123 3300025918 Bacteria 1374
318 Ga0207657_10004159 3300025919 Bacteria 15337
319 Ga0207657_10149720 3300025919 Bacteria 1902
320 Ga0207649_10001551 3300025920 Bacteria 13457
321 Ga0207649_10179588 3300025920 Bacteria 1480
322 Ga0207681_10023019 3300025923 Bacteria 3979
323 Ga0207694_10016160 3300025924 Bacteria 5633
324 Ga0207650_10135421 3300025925 Unclassified 1932
325 Ga0207659_10040808 3300025926 Unclassified 3248
326 Ga0207659_10060288 3300025926 Bacteria 2730
327 Ga0207659_10278065 3300025926 Bacteria 1368
328 Ga0207644_10006244 3300025931 Bacteria 7766
329 Ga0207644_10084364 3300025931 Bacteria 2355
330 Ga0207690_10000293 3300025932 Bacteria 35416
331 Ga0207690_10015214 3300025932 Bacteria 4659
332 Ga0207690_10037304 3300025932 Bacteria 3155
333 Ga0207706_10000669 3300025933 Bacteria 36066
334 Ga0207706_10002444 3300025933 Bacteria 18134
335 Ga0207706_10015154 3300025933 Bacteria 6977
336 Ga0207706_10016096 3300025933 Bacteria 6757
337 Ga0207706_10021055 3300025933 Bacteria 5858
338 Ga0207670_10098531 3300025936 Unclassified 2083
339 Ga0207704_10000189 3300025938 Bacteria 32372
340 Ga0207691_10105644 3300025940 Unclassified 2508
341 Ga0207689_10016256 3300025942 Bacteria 6303
342 Ga0207689_10027569 3300025942 Bacteria 4752
343 Ga0207661_10001248 3300025944 Bacteria 16989
344 Ga0207661_10002558 3300025944 Bacteria 12513
345 Ga0207679_10000332 3300025945 Bacteria 35161
346 Ga0207679_10000543 3300025945 Bacteria 25394
347 Ga0207679_10036005 3300025945 Bacteria 3507
348 Ga0207679_10062594 3300025945 Bacteria 2773
349 Ga0207679_10230149 3300025945 Bacteria 1564
350 Ga0207667_10033758 3300025949 Bacteria 5499
351 Ga0207667_10045313 3300025949 Bacteria 4659
352 Ga0207651_10007987 3300025960 Bacteria 5679
353 Ga0207712_10003758 3300025961 Bacteria 9584
354 Ga0207658_10032132 3300025986 Bacteria 3733
355 Ga0207658_10071028 3300025986 Bacteria 2635
356 Ga0207677_10006981 3300026023 Bacteria 6211
357 Ga0207677_10031975 3300026023 Bacteria 3377
358 Ga0207677_10139557 3300026023 Bacteria 1853
359 Ga0207677_10206423 3300026023 Bacteria 1565
360 Ga0207703_10329878 3300026035 Unclassified 1399
361 Ga0207639_10045777 3300026041 Unclassified 3298
362 Ga0207639_10095980 3300026041 Bacteria 2384
363 Ga0207639_10172381 3300026041 Bacteria 1833
364 Ga0207678_10013879 3300026067 Bacteria 7078
365 Ga0207702_10127230 3300026078 Bacteria 2289
366 Ga0207648_10001991 3300026089 Bacteria 22314
367 Ga0207648_10156578 3300026089 Unclassified 2011
368 Ga0207676_10004046 3300026095 Bacteria 10340
369 Ga0207676_10081202 3300026095 Bacteria 2634
370 Ga0207674_10009383 3300026116 Bacteria 11189
371 Ga0207674_10010275 3300026116 Bacteria 10622
372 Ga0207674_10034429 3300026116 Bacteria 5293
373 Ga0207674_10142412 3300026116 Bacteria 2357
374 Ga0207675_100000938 3300026118 Bacteria 29125
375 Ga0207675_100019489 3300026118 Bacteria 6330
376 Ga0207683_10003548 3300026121 Bacteria 13605
377 Ga0207683_10004785 3300026121 Bacteria 11655
378 Ga0207698_10003020 3300026142 Bacteria 10086
379 Ga0207698_10029790 3300026142 Bacteria 3915
380 Ga0207698_10096588 3300026142 Bacteria 2436
381 Ga0268266_10000032 3300028379 Bacteria 395079
382 Ga0307517_10000429 3300028786 Bacteria 72171
383 Ga0307515_10000001 3300028794 Bacteria 4259510
384 Ga0307515_10000016 3300028794 Bacteria 554870
385 Ga0307515_10000341 3300028794 Bacteria 115360
386 Ga0307515_10000427 3300028794 Bacteria 101325
387 Ga0307515_10001574 3300028794 Bacteria 50970
388 Ga0307515_10014105 3300028794 Bacteria 14859
389 Ga0307515_10111780 3300028794 Bacteria 3184
390 Ga0316181_1263026 3300030744 Bacteria 2299
391 Ga0265328_10021589 3300031239 Bacteria 2455
392 Ga0265320_10067030 3300031240 Bacteria 1700
393 Ga0265331_10051475 3300031250 Bacteria 1971
394 Ga0265327_10000244 3300031251 Bacteria 108867
395 Ga0265327_10000415 3300031251 Bacteria 78296
396 Ga0265327_10037289 3300031251 Bacteria 2663
397 Ga0265327_10061112 3300031251 Bacteria 1924
398 Ga0265316_10002439 3300031344 Bacteria 19315
399 Ga0265316_10003123 3300031344 Bacteria 16878
400 Ga0307509_10098279 3300031507 Bacteria 2972
401 Ga0307509_10165048 3300031507 Unclassified 2105
402 Ga0307408_100001086 3300031548 Bacteria 20801
403 Ga0307408_100002564 3300031548 Bacteria 12675
404 Ga0307508_10001709 3300031616 Bacteria 24361
405 Ga0307514_10073178 3300031649 Bacteria 2563
406 Ga0316576_10094339 3300031727 Bacteria 2231
407 Ga0316578_10058451 3300031728 Bacteria 2267
408 Ga0316578_10115449 3300031728 Bacteria 1613
409 Ga0307405_10000397 3300031731 Bacteria 16341
410 Ga0316577_10017733 3300031733 Bacteria 3934
411 Ga0307407_10000041 3300031903 Bacteria 65180
412 Ga0307412_10000142 3300031911 Bacteria 51770
413 Ga0307409_100265174 3300031995 Bacteria 1579
414 Ga0307416_100000029 3300032002 Bacteria 164815
415 Ga0307416_100134676 3300032002 Bacteria 2232
416 Ga0307414_10004107 3300032004 Bacteria 7861
417 Ga0307414_10010667 3300032004 Bacteria 5347
418 Ga0307414_10047794 3300032004 Bacteria 2948
419 Ga0307414_10074458 3300032004 Bacteria 2460
420 Ga0307411_10040144 3300032005 Bacteria 2967
421 Ga0307415_100037567 3300032126 Bacteria 3184
422 Ga0307507_10000510 3300033179 Bacteria 81853
423 Ga0307510_10001152 3300033180 Bacteria 28416
424 Ga0316584_0032761 3300036712 Bacteria 3846
425 Ga0395899_0000055 3300037312 Bacteria 220579
426 Ga0395899_0000077 3300037312 Bacteria 177185
427 Ga0395899_0100575 3300037312 Bacteria 2088
428 Ga0395900_0000194 3300037418 Bacteria 97768
429 Ga0395900_0003186 3300037418 Bacteria 17778
430 Ga0395900_0038932 3300037418 Bacteria 4902
431 Ga0395898_0071488 3300037466 Bacteria 3353
432 Ga0395905_0000716 3300037471 Bacteria 43859
433 Ga0395905_0067919 3300037471 Bacteria 3339
434 Ga0395901_0001250 3300038443 Bacteria 27039
435 Ga0395901_0070567 3300038443 Bacteria 3640
436 Ga0400483_097687 3300039062 Bacteria 3494
437 Ga0400489_91474 3300039093 Bacteria 3436
438 Ga0436361_1068986 3300039447 Bacteria 20698
439 Ga0451855_1546415 3300041511 Bacteria 5202
440 Ga0439431_0022710 3300041997 Bacteria 1514
441 Ga0439449_0028009 3300042007 Bacteria 2101
442 Ga0451577_0000393 3300042876 Bacteria 80362
443 Ga0451577_0001546 3300042876 Bacteria 30192
444 Ga0451577_0014711 3300042876 Bacteria 7290
445 Ga0451577_0021342 3300042876 Bacteria 5928
446 Ga0451577_0025012 3300042876 Bacteria 5422
447 Ga0451577_0245372 3300042876 Bacteria 1621
448 Ga0466969_0054855 3300044656 Bacteria 1951
449 Ga0466972_0034546 3300044658 Bacteria 2476
450 Ga0453683_0000140 3300044673 Bacteria 105316
451 Ga0453683_0000159 3300044673 Bacteria 99307
452 Ga0453683_0000538 3300044673 Bacteria 42284
453 Ga0453683_0058783 3300044673 Bacteria 2405
454 Ga0453683_0059938 3300044673 Bacteria 2379
455 Ga0453683_0088197 3300044673 Bacteria 1945
456 Ga0453683_0097274 3300044673 Bacteria 1847
457 Ga0453683_0157841 3300044673 Bacteria 1434
458 Ga0466961_0024982 3300044693 Unclassified 3845
459 Ga0466961_0066900 3300044693 Bacteria 2282
460 Ga0453684_0000051 3300044712 Bacteria 551033
461 Ga0453684_0000264 3300044712 Bacteria 225672
462 Ga0453684_0000948 3300044712 Bacteria 95689
463 Ga0453684_0001191 3300044712 Bacteria 80362
464 Ga0453684_0001653 3300044712 Bacteria 60468
465 Ga0453684_0005947 3300044712 Bacteria 23665
466 Ga0453684_0006374 3300044712 Bacteria 22484
467 Ga0453684_0010142 3300044712 Bacteria 16174
468 Ga0453684_0012531 3300044712 Bacteria 13960
469 Ga0453684_0020704 3300044712 Bacteria 9898
470 Ga0453684_0026132 3300044712 Bacteria 8449
471 Ga0453684_0029550 3300044712 Bacteria 7778
472 Ga0453684_0036821 3300044712 Bacteria 6733
473 Ga0453684_0046716 3300044712 Bacteria 5754
474 Ga0453684_0058789 3300044712 Bacteria 4963
475 Ga0453684_0058945 3300044712 Bacteria 4955
476 Ga0453684_0088422 3300044712 Bacteria 3836
477 Ga0453684_0104130 3300044712 Bacteria 3465
478 Ga0453684_0137227 3300044712 Bacteria 2926
479 Ga0453684_0154136 3300044712 Bacteria 2726
480 Ga0453684_0227487 3300044712 Bacteria 2156
481 Ga0453684_0233190 3300044712 Bacteria 2123
482 Ga0453684_0255657 3300044712 Unclassified 2009
483 Ga0453684_0289981 3300044712 Bacteria 1864
484 Ga0466959_0003337 3300045049 Bacteria 10487
485 Ga0466959_0013017 3300045049 Bacteria 6024
486 Ga0466959_0066497 3300045049 Bacteria 2615
487 Ga0451576_0000003 3300045051 Bacteria 1550573
488 Ga0451576_0000148 3300045051 Bacteria 178544
489 Ga0451576_0000551 3300045051 Bacteria 80362
490 Ga0451576_0000795 3300045051 Bacteria 61946
491 Ga0451576_0002016 3300045051 Bacteria 32101
492 Ga0451576_0002843 3300045051 Bacteria 24890
493 Ga0451576_0009157 3300045051 Bacteria 11505
494 Ga0451576_0009644 3300045051 Bacteria 11172
495 Ga0451576_0011967 3300045051 Bacteria 9803
496 Ga0451576_0015813 3300045051 Bacteria 8348
497 Ga0451576_0017040 3300045051 Bacteria 7997
498 Ga0451576_0107743 3300045051 Bacteria 2899
499 Ga0451576_0145843 3300045051 Bacteria 2468
500 Ga0466967_0110974 3300045976 Bacteria 2520
501 Ga0495627_002060 3300046453 Bacteria 10254
502 Ga0495650_0000119 3300046471 Bacteria 185719
503 Ga0495585_0000173 3300046492 Bacteria 69500
504 Ga0495585_0060350 3300046492 Bacteria 2087
505 Ga0495583_0009025 3300046506 Bacteria 6008
506 Ga0495606_0000008 3300046507 Bacteria 321373
507 Ga0495606_0004549 3300046507 Bacteria 13788
508 Ga0495606_0010713 3300046507 Bacteria 7563
509 Ga0495606_0094807 3300046507 Bacteria 1828
510 Ga0495610_0000093 3300046512 Bacteria 105873
511 Ga0495610_0001776 3300046512 Bacteria 18849
512 Ga0495610_0002038 3300046512 Bacteria 17252
513 Ga0495616_0008951 3300046513 Bacteria 5883
514 Ga0495616_0047267 3300046513 Bacteria 2168
515 Ga0495644_0005967 3300046523 Bacteria 4748
516 Ga0495648_0018281 3300046524 Bacteria 4970
517 Ga0495586_0101241 3300046535 Bacteria 1599
518 Ga0495633_0003104 3300046558 Bacteria 11274
519 Ga0495668_0000009 3300046616 Bacteria 492623
520 Ga0495668_0000803 3300046616 Bacteria 36102
521 Ga0495611_0072330 3300046648 Bacteria 1578
522 Ga0495625_0000017 3300046660 Bacteria 299728
523 Ga0495625_0000831 3300046660 Bacteria 42424
524 Ga0495625_0001531 3300046660 Bacteria 27626
525 Ga0495625_0004710 3300046660 Bacteria 12772
526 Ga0495625_0062865 3300046660 Bacteria 2622
527 Ga0495625_0096339 3300046660 Bacteria 2038
528 Ga0495661_0057955 3300046665 Bacteria 2310
529 Ga0495669_0078520 3300046684 Bacteria 1512
530 Ga0495649_0000121 3300046694 Bacteria 68443
531 Ga0495660_0002198 3300046810 Bacteria 12554
532 Ga0495636_0000306 3300047318 Bacteria 19268
533 Ga0495683_0027502 3300047323 Bacteria 2908
534 Ga0495687_004610 3300047443 Bacteria 9209
535 Ga0495687_021857 3300047443 Bacteria 3083
536 Ga0495686_0001124 3300047472 Bacteria 31635
537 Ga0496115_0028606 3300048918 Bacteria 4370
538 Ga0496121_0000026 3300048924 Bacteria 450157
539 Ga0496122_0000782 3300048925 Bacteria 61189
540 Ga0496123_0006205 3300048926 Bacteria 11666
541 Ga0495678_020889 3300049459 Bacteria 2890
542 Ga0501298_010516 3300049521 Unclassified 1594
543 Ga0501033_0012262 3300049570 Bacteria 6542
544 Ga0501034_0000277 3300049571 Bacteria 92445
545 Ga0501034_0027495 3300049571 Bacteria 5787
546 Ga0501034_0078894 3300049571 Bacteria 3296
547 Ga0501047_0042834 3300049581 Unclassified 4373
548 Ga0501047_0049809 3300049581 Bacteria 4044
549 Ga0501198_010533 3300049649 Bacteria 1369
550 Ga0501202_005089 3300049652 Bacteria 2321
551 Ga0501225_0011958 3300049705 Bacteria 2440
552 Ga0501241_006565 3300049758 Bacteria 2140
553 Ga0501044_0013455 3300049823 Bacteria 8849
554 Ga0501044_0025159 3300049823 Bacteria 6312
555 Ga0501044_0041803 3300049823 Unclassified 4772
556 nmdc:mga0k408_31155_c1 3300050493 Bacteria 3043
557 nmdc:mga07m45_28263_c1 3300050496 Bacteria 3095
558 Ga0500635_0002479 3300053080 Bacteria 4578
559 Ga0500644_0001956 3300053088 Bacteria 5257
560 Ga0500646_0011223 3300053090 Unclassified 2302
561 Ga0500569_002571 3300053109 Bacteria 3598
562 Ga0500607_011430 3300053121 Bacteria 5253
563 Ga0500608_002735 3300053122 Bacteria 6488
564 Ga0500608_023329 3300053122 Bacteria 2879
565 Ga0500618_000040 3300053125 Bacteria 112548
566 Ga0500652_049191 3300053131 Bacteria 1717
567 Ga0500658_0003180 3300053134 Bacteria 6265
568 Ga0500568_0047920 3300053139 Bacteria 1691
569 Ga0500590_078699 3300053148 Bacteria 1624
570 Ga0500622_0000295 3300053156 Bacteria 51064
571 Ga0500627_0027016 3300053158 Bacteria 2373
572 Ga0500633_0012242 3300053160 Bacteria 2364
573 Ga0500645_008945 3300053730 Bacteria 3386
574 Ga0500661_012330 3300055283 Bacteria 1543
575 Ga0466962_0047961 3300061719 Bacteria 2041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049521 Ga0501298_010516 Ga0501298_010516_451_1563 345
2 3300013307 Ga0157372_10002043 Ga0157372_100020437 358
3 3300044693 Ga0466961_0066900 Ga0466961_0066900_1039_2154 358
4 3300053139 Ga0500568_0047920 Ga0500568_0047920_527_1639 366
5 3300046660 Ga0495625_0062865 Ga0495625_0062865_669_1943 384
6 3300017792 Ga0163161_10000315 Ga0163161_100003156 385
7 3300031903 Ga0307407_10000041 Ga0307407_100000414 386
8 3300032002 Ga0307416_100000029 Ga0307416_100000029137 386
9 3300046507 Ga0495606_0010713 Ga0495606_0010713_2320_3618 386
10 3300049649 Ga0501198_010533 Ga0501198_010533_20_1264 389
11 3300015682 Ga0183373_1015 Ga0183373_101544 391
12 3300046512 Ga0495610_0000093 Ga0495610_0000093_94195_95439 391
13 3300044712 Ga0453684_0006374 Ga0453684_0006374_13878_15173 395
14 3300013297 Ga0157378_10036795 Ga0157378_100367954 397
15 3300014968 Ga0157379_10117056 Ga0157379_101170562 397
16 3300031251 Ga0265327_10061112 Ga0265327_100611121 397
17 3300005335 Ga0070666_10021519 Ga0070666_100215192 398
18 3300013104 Ga0157370_10067203 Ga0157370_100672032 398
19 3300013296 Ga0157374_10009869 Ga0157374_100098692 398
20 3300014969 Ga0157376_10122967 Ga0157376_101229672 398
21 3300025919 Ga0207657_10004159 Ga0207657_100041591 398
22 3300025920 Ga0207649_10179588 Ga0207649_101795881 398
23 3300026023 Ga0207677_10031975 Ga0207677_100319752 398
24 3300013306 Ga0163162_10000369 Ga0163162_1000036945 399
25 3300028794 Ga0307515_10000016 Ga0307515_10000016262 399
26 3300031649 Ga0307514_10073178 Ga0307514_100731782 399
27 3300025926 Ga0207659_10278065 Ga0207659_102780651 401
28 iso_pu_bacteria 2965320100 2965321839 401
29 3300017792 Ga0163161_10000392 Ga0163161_100003926 402
30 3300044712 Ga0453684_0005947 Ga0453684_0005947_10593_11867 402
31 3300044712 Ga0453684_0036821 Ga0453684_0036821_399_1673 402
32 3300044712 Ga0453684_0088422 Ga0453684_0088422_198_1472 402
33 3300053125 Ga0500618_000040 Ga0500618_000040_75088_76464 402
34 3300013307 Ga0157372_10038935 Ga0157372_100389354 403
35 3300045051 Ga0451576_0011967 Ga0451576_0011967_7803_9014 403
36 3300049571 Ga0501034_0000277 Ga0501034_0000277_60671_61915 403
37 3300001904 JGI24736J21556_1002967 JGI24736J21556_10029673 404
38 3300005329 Ga0070683_100092330 Ga0070683_1000923301 404
39 3300005334 Ga0068869_100019171 Ga0068869_1000191713 404
40 3300005340 Ga0070689_100004971 Ga0070689_1000049715 404
41 3300005344 Ga0070661_100058918 Ga0070661_1000589183 404
42 3300005354 Ga0070675_100167529 Ga0070675_1001675292 404
43 3300005364 Ga0070673_100276761 Ga0070673_1002767612 404
44 3300005365 Ga0070688_100054257 Ga0070688_1000542574 404
45 3300005457 Ga0070662_100044677 Ga0070662_1000446772 404
46 3300005535 Ga0070684_100005082 Ga0070684_10000508211 404
47 3300005577 Ga0068857_100005746 Ga0068857_10000574611 404
48 3300005617 Ga0068859_100161801 Ga0068859_1001618014 404
49 3300005618 Ga0068864_100071597 Ga0068864_1000715971 404
50 3300005842 Ga0068858_100127584 Ga0068858_1001275843 404
51 3300005843 Ga0068860_100262280 Ga0068860_1002622802 404
52 3300006931 Ga0097620_100161812 Ga0097620_1001618121 404
53 3300013296 Ga0157374_10000847 Ga0157374_1000084720 404
54 3300013306 Ga0163162_10091008 Ga0163162_100910083 404
55 3300013306 Ga0163162_10131756 Ga0163162_101317562 404
56 3300014497 Ga0182008_10001974 Ga0182008_100019747 404
57 3300015261 Ga0182006_1001468 Ga0182006_10014686 404
58 3300025920 Ga0207649_10001551 Ga0207649_100015511 404
59 3300025925 Ga0207650_10135421 Ga0207650_101354213 404
60 3300025926 Ga0207659_10040808 Ga0207659_100408083 404
61 3300025933 Ga0207706_10015154 Ga0207706_100151544 404
62 3300025936 Ga0207670_10098531 Ga0207670_100985313 404
63 3300025940 Ga0207691_10105644 Ga0207691_101056444 404
64 3300025942 Ga0207689_10016256 Ga0207689_100162562 404
65 3300025944 Ga0207661_10002558 Ga0207661_100025583 404
66 3300025945 Ga0207679_10000543 Ga0207679_100005434 404
67 3300025945 Ga0207679_10062594 Ga0207679_100625943 404
68 3300026095 Ga0207676_10004046 Ga0207676_100040468 404
69 3300026116 Ga0207674_10034429 Ga0207674_100344294 404
70 3300028794 Ga0307515_10111780 Ga0307515_101117802 404
71 3300050493 nmdc:mga0k408_31155_c1 nmdc:mga0k408_31155_c1_726_2018 404
72 iso_pu_bacteria 2585427687 2586210761 404
73 iso_pu_bacteria 2738541302 2738852365 404
74 iso_pu_bacteria 2818991437 2819550345 404
75 3300003316 rootH1_10054479 rootH1_100544794 405
76 3300003320 rootH2_10013605 rootH2_1001360522 405
77 3300013102 Ga0157371_10002074 Ga0157371_100020745 405
78 3300015261 Ga0182006_1000339 Ga0182006_10003397 405
79 3300046512 Ga0495610_0001776 Ga0495610_0001776_7830_9119 405
80 3300013100 Ga0157373_10003109 Ga0157373_100031099 406
81 3300013102 Ga0157371_10000298 Ga0157371_100002987 406
82 3300013306 Ga0163162_10000379 Ga0163162_100003796 406
83 3300013307 Ga0157372_10000071 Ga0157372_1000007167 406
84 3300044673 Ga0453683_0059938 Ga0453683_0059938_937_2187 406
85 3300044673 Ga0453683_0088197 Ga0453683_0088197_664_1914 406
86 3300044712 Ga0453684_0026132 Ga0453684_0026132_2226_3476 406
87 3300044712 Ga0453684_0154136 Ga0453684_0154136_102_1352 406
88 3300045051 Ga0451576_0002843 Ga0451576_0002843_1200_2450 406
89 3300045051 Ga0451576_0107743 Ga0451576_0107743_1017_2267 406
90 3300046513 Ga0495616_0047267 Ga0495616_0047267_792_2066 406
91 3300046660 Ga0495625_0096339 Ga0495625_0096339_132_1406 406
92 3300049459 Ga0495678_020889 Ga0495678_020889_1375_2649 406
93 3300003323 rootH1_10001262 rootH1_1000126236 407
94 3300032002 Ga0307416_100134676 Ga0307416_1001346762 407
95 3300032005 Ga0307411_10040144 Ga0307411_100401443 407
96 3300032126 Ga0307415_100037567 Ga0307415_1000375672 407
97 3300046492 Ga0495585_0000173 Ga0495585_0000173_55578_56846 407
98 3300046513 Ga0495616_0008951 Ga0495616_0008951_556_1824 407
99 3300046660 Ga0495625_0000017 Ga0495625_0000017_241247_242515 407
100 3300046694 Ga0495649_0000121 Ga0495649_0000121_9972_11240 407
101 3300046810 Ga0495660_0002198 Ga0495660_0002198_10002_11270 407
102 3300049652 Ga0501202_005089 Ga0501202_005089_386_1684 407
103 3300049705 Ga0501225_0011958 Ga0501225_0011958_175_1473 407
104 3300002773 JGI25152J39213_1000457 JGI25152J39213_10004574 408
105 3300002774 JGI25150J39212_1000306 JGI25150J39212_100030614 408
106 3300003187 JGI25151J46595_10000824 JGI25151J46595_100008245 408
107 3300003215 JGI25153J46596_10000509 JGI25153J46596_1000050914 408
108 3300003215 JGI25153J46596_10000581 JGI25153J46596_100005813 408
109 3300003781 Ga0055536_1000007 Ga0055536_1000007294 408
110 3300005288 Ga0065714_10068524 Ga0065714_100685243 408
111 3300005329 Ga0070683_100002140 Ga0070683_1000021409 408
112 3300005344 Ga0070661_100002067 Ga0070661_1000020675 408
113 3300005366 Ga0070659_100000188 Ga0070659_10000018833 408
114 3300005366 Ga0070659_100012085 Ga0070659_1000120854 408
115 3300005367 Ga0070667_100056224 Ga0070667_1000562245 408
116 3300005457 Ga0070662_100025824 Ga0070662_1000258243 408
117 3300005535 Ga0070684_100005635 Ga0070684_1000056356 408
118 3300005564 Ga0070664_100001152 Ga0070664_1000011526 408
119 3300005616 Ga0068852_100162569 Ga0068852_1001625693 408
120 3300005842 Ga0068858_100050728 Ga0068858_1000507283 408
121 3300010375 Ga0105239_10174704 Ga0105239_101747041 408
122 3300013100 Ga0157373_10054333 Ga0157373_100543334 408
123 3300014325 Ga0163163_10057325 Ga0163163_100573255 408
124 3300014968 Ga0157379_10025022 Ga0157379_100250224 408
125 3300015261 Ga0182006_1000120 Ga0182006_10001205 408
126 3300015261 Ga0182006_1013711 Ga0182006_10137114 408
127 3300015262 Ga0182007_10007410 Ga0182007_100074103 408
128 3300015262 Ga0182007_10015102 Ga0182007_100151022 408
129 3300017792 Ga0163161_10001301 Ga0163161_1000130111 408
130 3300025245 Ga0207425_1000488 Ga0207425_10004885 408
131 3300025258 Ga0209129_1000587 Ga0209129_10005875 408
132 3300025292 Ga0209676_1000058 Ga0209676_1000058286 408
133 3300025294 Ga0209025_1001846 Ga0209025_10018465 408
134 3300025297 Ga0209758_1001686 Ga0209758_10016865 408
135 3300025298 Ga0209050_1000054 Ga0209050_1000054286 408
136 3300025931 Ga0207644_10084364 Ga0207644_100843644 408
137 3300025932 Ga0207690_10000293 Ga0207690_1000029326 408
138 3300025944 Ga0207661_10001248 Ga0207661_1000124813 408
139 3300025945 Ga0207679_10000332 Ga0207679_100003324 408
140 3300025986 Ga0207658_10032132 Ga0207658_100321321 408
141 3300026023 Ga0207677_10206423 Ga0207677_102064232 408
142 3300026041 Ga0207639_10095980 Ga0207639_100959801 408
143 3300026095 Ga0207676_10081202 Ga0207676_100812023 408
144 3300026116 Ga0207674_10009383 Ga0207674_100093834 408
145 3300026142 Ga0207698_10096588 Ga0207698_100965882 408
146 3300031731 Ga0307405_10000397 Ga0307405_100003977 408
147 3300037312 Ga0395899_0100575 Ga0395899_0100575_558_1850 408
148 3300037418 Ga0395900_0038932 Ga0395900_0038932_375_1667 408
149 3300037466 Ga0395898_0071488 Ga0395898_0071488_835_2127 408
150 3300037471 Ga0395905_0000716 Ga0395905_0000716_21265_22557 408
151 3300038443 Ga0395901_0001250 Ga0395901_0001250_3635_4927 408
152 3300039447 Ga0436361_1068986 Ga0436361_1068986_12452_13762 408
153 3300048918 Ga0496115_0028606 Ga0496115_0028606_2503_3744 408
154 3300025913 Ga0207695_10139059 Ga0207695_101390592 409
155 3300032004 Ga0307414_10074458 Ga0307414_100744583 409
156 3300003322 rootL2_10025431 rootL2_100254313 410
157 3300005471 Ga0070698_100031095 Ga0070698_1000310952 410
158 3300032004 Ga0307414_10047794 Ga0307414_100477944 410
159 3300046507 Ga0495606_0094807 Ga0495606_0094807_396_1685 410
160 3300003320 rootH2_10074885 rootH2_100748852 411
161 3300031239 Ga0265328_10021589 Ga0265328_100215892 411
162 3300031240 Ga0265320_10067030 Ga0265320_100670301 411
163 3300031250 Ga0265331_10051475 Ga0265331_100514752 411
164 3300031251 Ga0265327_10000244 Ga0265327_10000244126 411
165 3300037418 Ga0395900_0003186 Ga0395900_0003186_1806_3095 411
166 3300046616 Ga0495668_0000803 Ga0495668_0000803_4266_5549 411
167 3300053158 Ga0500627_0027016 Ga0500627_0027016_512_1843 411
168 iso_pu_bacteria 2852623160 2852624880 411
169 3300003794 Ga0055531_10000287 Ga0055531_1000028732 412
170 3300005330 Ga0070690_100021708 Ga0070690_1000217081 412
171 3300005334 Ga0068869_100060425 Ga0068869_1000604252 412
172 3300005341 Ga0070691_10083938 Ga0070691_100839382 412
173 3300005367 Ga0070667_100065930 Ga0070667_1000659303 412
174 3300005459 Ga0068867_100027953 Ga0068867_1000279533 412
175 3300005616 Ga0068852_100056669 Ga0068852_1000566694 412
176 3300005842 Ga0068858_100056432 Ga0068858_1000564323 412
177 3300006237 Ga0097621_100094515 Ga0097621_1000945154 412
178 3300013296 Ga0157374_10012490 Ga0157374_100124905 412
179 3300017792 Ga0163161_10002910 Ga0163161_100029108 412
180 3300025304 Ga0209257_1000006 Ga0209257_1000006120 412
181 3300025903 Ga0207680_10006649 Ga0207680_100066493 412
182 3300025907 Ga0207645_10121834 Ga0207645_101218342 412
183 3300025933 Ga0207706_10002444 Ga0207706_100024445 412
184 3300025942 Ga0207689_10027569 Ga0207689_100275694 412
185 3300025945 Ga0207679_10036005 Ga0207679_100360054 412
186 3300026035 Ga0207703_10329878 Ga0207703_103298781 412
187 3300026121 Ga0207683_10004785 Ga0207683_100047854 412
188 3300042876 Ga0451577_0025012 Ga0451577_0025012_877_2166 412
189 3300044673 Ga0453683_0157841 Ga0453683_0157841_65_1354 412
190 3300005364 Ga0070673_100053975 Ga0070673_1000539753 413
191 3300005366 Ga0070659_100062301 Ga0070659_1000623013 413
192 3300005547 Ga0070693_100093371 Ga0070693_1000933712 413
193 3300005578 Ga0068854_100069251 Ga0068854_1000692513 413
194 3300010375 Ga0105239_10118580 Ga0105239_101185804 413
195 3300013105 Ga0157369_10010208 Ga0157369_100102083 413
196 3300025908 Ga0207643_10036207 Ga0207643_100362071 413
197 3300025918 Ga0207662_10176123 Ga0207662_101761231 413
198 3300025933 Ga0207706_10016096 Ga0207706_100160968 413
199 3300026023 Ga0207677_10139557 Ga0207677_101395572 413
200 3300026116 Ga0207674_10142412 Ga0207674_101424121 413
201 3300026118 Ga0207675_100019489 Ga0207675_1000194895 413
202 3300053090 Ga0500646_0011223 Ga0500646_0011223_717_1961 413
203 iso_pu_bacteria 2839989709 2839991552 413
204 3300005337 Ga0070682_100000115 Ga0070682_10000011519 414
205 3300005617 Ga0068859_100000534 Ga0068859_1000005342 414
206 3300006931 Ga0097620_100000534 Ga0097620_10000053443 414
207 3300042876 Ga0451577_0021342 Ga0451577_0021342_3855_5114 414
208 iso_pu_bacteria 2884634485 2884635329 414
209 3300009093 Ga0105240_10168375 Ga0105240_101683751 415
210 iso_pu_bacteria 2884933994 2884936225 415
211 iso_pu_bacteria 2910245624 2910247646 415
212 iso_pu_bacteria 2977232053 2977233639 415
213 3300044712 Ga0453684_0001653 Ga0453684_0001653_26868_28145 416
214 3300044712 Ga0453684_0020704 Ga0453684_0020704_2252_3529 416
215 3300045051 Ga0451576_0017040 Ga0451576_0017040_2069_3346 416
216 iso_pu_bacteria 2599185184 2599476633 416
217 iso_pu_bacteria 2928078545 2928078582 416
218 3300005262 Ga0065165_1001313 Ga0065165_100131325 417
219 3300046660 Ga0495625_0000831 Ga0495625_0000831_6708_8009 417
220 3300002067 JGI24735J21928_10013851 JGI24735J21928_100138512 418
221 3300002737 JGI25162J39368_1000047 JGI25162J39368_100004754 418
222 3300002737 JGI25162J39368_1000183 JGI25162J39368_100018359 418
223 3300003320 rootH2_10092044 rootH2_100920443 418
224 3300005366 Ga0070659_100009746 Ga0070659_1000097467 418
225 3300005563 Ga0068855_100215661 Ga0068855_1002156611 418
226 3300009545 Ga0105237_10008782 Ga0105237_100087823 418
227 3300010375 Ga0105239_10000816 Ga0105239_1000081635 418
228 3300010375 Ga0105239_10003173 Ga0105239_1000317314 418
229 3300013102 Ga0157371_10040301 Ga0157371_100403013 418
230 3300013104 Ga0157370_10024460 Ga0157370_100244603 418
231 3300025233 Ga0209437_100089 Ga0209437_100089122 418
232 3300025261 Ga0209233_1001941 Ga0209233_10019418 418
233 3300025904 Ga0207647_10000154 Ga0207647_1000015449 418
234 3300025914 Ga0207671_10006180 Ga0207671_100061805 418
235 3300025932 Ga0207690_10015214 Ga0207690_100152146 418
236 3300025932 Ga0207690_10037304 Ga0207690_100373043 418
237 3300025949 Ga0207667_10045313 Ga0207667_100453135 418
238 3300028794 Ga0307515_10000427 Ga0307515_1000042735 418
239 3300031728 Ga0316578_10058451 Ga0316578_100584512 418
240 3300031733 Ga0316577_10017733 Ga0316577_100177332 418
241 3300036712 Ga0316584_0032761 Ga0316584_0032761_1755_3128 418
242 3300046506 Ga0495583_0009025 Ga0495583_0009025_4293_5609 418
243 3300046665 Ga0495661_0057955 Ga0495661_0057955_505_1821 418
244 3300053160 Ga0500633_0012242 Ga0500633_0012242_836_2128 418
245 iso_pu_bacteria 2919437846 2919442715 418
246 iso_pu_bacteria 2928147474 2928151741 418
247 3300003316 rootH1_10016586 rootH1_1001658611 419
248 3300003320 rootH2_10041501 rootH2_100415011 419
249 3300003323 rootH1_10000992 rootH1_100009924 419
250 3300003323 rootH1_10000993 rootH1_100009932 419
251 3300003323 rootH1_10002086 rootH1_1000208611 419
252 3300003761 Ga0055535_1004061 Ga0055535_10040614 419
253 3300003762 Ga0055542_1004524 Ga0055542_10045242 419
254 3300005338 Ga0068868_100034039 Ga0068868_1000340394 419
255 3300005457 Ga0070662_100000054 Ga0070662_10000005429 419
256 3300005614 Ga0068856_100032967 Ga0068856_1000329672 419
257 3300009093 Ga0105240_10298188 Ga0105240_102981881 419
258 3300009174 Ga0105241_10001338 Ga0105241_100013386 419
259 3300009174 Ga0105241_10099865 Ga0105241_100998652 419
260 3300010375 Ga0105239_10021827 Ga0105239_100218278 419
261 3300013100 Ga0157373_10048257 Ga0157373_100482574 419
262 3300013102 Ga0157371_10017139 Ga0157371_100171396 419
263 3300013104 Ga0157370_10008717 Ga0157370_1000871710 419
264 3300013104 Ga0157370_10175488 Ga0157370_101754882 419
265 3300013105 Ga0157369_10122353 Ga0157369_101223532 419
266 3300013296 Ga0157374_10002139 Ga0157374_1000213913 419
267 3300013307 Ga0157372_10023226 Ga0157372_100232266 419
268 3300014745 Ga0157377_10012788 Ga0157377_100127884 419
269 3300025242 Ga0209258_100098 Ga0209258_10009894 419
270 3300025254 Ga0209148_1000120 Ga0209148_100012068 419
271 3300025904 Ga0207647_10000046 Ga0207647_1000004632 419
272 3300025911 Ga0207654_10002429 Ga0207654_100024296 419
273 3300025911 Ga0207654_10017851 Ga0207654_100178514 419
274 3300025913 Ga0207695_10082541 Ga0207695_100825413 419
275 3300025933 Ga0207706_10000669 Ga0207706_1000066929 419
276 3300026023 Ga0207677_10006981 Ga0207677_100069816 419
277 3300028794 Ga0307515_10001574 Ga0307515_1000157421 419
278 3300033179 Ga0307507_10000510 Ga0307507_1000051024 419
279 3300045051 Ga0451576_0009644 Ga0451576_0009644_7481_8779 419
280 3300046507 Ga0495606_0004549 Ga0495606_0004549_192_1511 419
281 3300046660 Ga0495625_0001531 Ga0495625_0001531_4532_5836 419
282 3300053122 Ga0500608_023329 Ga0500608_023329_273_1580 419
283 3300053148 Ga0500590_078699 Ga0500590_078699_143_1435 419
284 iso_pu_bacteria 2738541283 2738759591 419
285 iso_pu_bacteria 2738541284 2738763783 419
286 iso_pu_bacteria 2739367651 2739589745 419
287 iso_pu_bacteria 2739367656 2739617946 419
288 iso_pu_bacteria 2775506987 2776614918 419
289 iso_pu_bacteria 2842722452 2842722458 419
290 iso_pu_bacteria 2842909656 2842914621 419
291 iso_pu_bacteria 2849281842 2849286348 419
292 iso_pu_bacteria 2852627209 2852630037 419
293 iso_pu_bacteria 2857627736 2857632324 419
294 iso_pu_bacteria 2902048731 2902049072 419
295 iso_pu_bacteria 2904445276 2904449791 419
296 iso_pu_bacteria 2919186247 2919188325 419
297 iso_pu_bacteria 2939664404 2939664408 419
298 iso_pu_bacteria 2945997725 2945999407 419
299 iso_pu_bacteria 2954016120 2954016135 419
300 3300001979 JGI24740J21852_10027557 JGI24740J21852_100275572 420
301 3300002067 JGI24735J21928_10000008 JGI24735J21928_10000008158 420
302 3300005455 Ga0070663_100017904 Ga0070663_1000179043 420
303 3300009545 Ga0105237_10000994 Ga0105237_1000099411 420
304 3300013102 Ga0157371_10004305 Ga0157371_100043054 420
305 3300013105 Ga0157369_10001614 Ga0157369_100016147 420
306 3300013307 Ga0157372_10000026 Ga0157372_1000002622 420
307 3300025272 Ga0209455_1001550 Ga0209455_10015501 420
308 3300025914 Ga0207671_10002724 Ga0207671_100027247 420
309 3300025917 Ga0207660_10012777 Ga0207660_100127776 420
310 3300026067 Ga0207678_10013879 Ga0207678_100138794 420
311 3300026142 Ga0207698_10029790 Ga0207698_100297902 420
312 3300037312 Ga0395899_0000055 Ga0395899_0000055_212546_213847 420
313 3300041511 Ga0451855_1546415 Ga0451855_1546415_3669_4955 420
314 3300044656 Ga0466969_0054855 Ga0466969_0054855_384_1685 420
315 3300044693 Ga0466961_0024982 Ga0466961_0024982_11_1297 420
316 3300045049 Ga0466959_0003337 Ga0466959_0003337_8239_9525 420
317 3300045049 Ga0466959_0066497 Ga0466959_0066497_734_2035 420
318 3300046492 Ga0495585_0060350 Ga0495585_0060350_255_1562 420
319 3300046524 Ga0495648_0018281 Ga0495648_0018281_1758_3065 420
320 3300046616 Ga0495668_0000009 Ga0495668_0000009_28842_30149 420
321 3300046660 Ga0495625_0004710 Ga0495625_0004710_5562_6869 420
322 3300047472 Ga0495686_0001124 Ga0495686_0001124_13635_14942 420
323 3300061719 Ga0466962_0047961 Ga0466962_0047961_472_1758 420
324 iso_pu_bacteria 2739367663 2739644104 420
325 iso_pu_bacteria 2932082852 2932084356 420
326 3300002737 JGI25162J39368_1000940 JGI25162J39368_100094020 421
327 3300002772 JGI25164J39214_1000871 JGI25164J39214_10008712 421
328 3300005288 Ga0065714_10006135 Ga0065714_100061355 421
329 3300005288 Ga0065714_10093020 Ga0065714_100930202 421
330 3300005327 Ga0070658_10000014 Ga0070658_10000014195 421
331 3300005563 Ga0068855_100033283 Ga0068855_1000332834 421
332 3300009093 Ga0105240_10000037 Ga0105240_1000003784 421
333 3300010375 Ga0105239_10000606 Ga0105239_1000060640 421
334 3300013296 Ga0157374_10281967 Ga0157374_102819672 421
335 3300025231 Ga0207427_100137 Ga0207427_10013762 421
336 3300025233 Ga0209437_100112 Ga0209437_100112120 421
337 3300025261 Ga0209233_1000126 Ga0209233_100012661 421
338 3300025909 Ga0207705_10000107 Ga0207705_1000010752 421
339 3300025913 Ga0207695_10000092 Ga0207695_10000092162 421
340 3300031344 Ga0265316_10003123 Ga0265316_100031232 421
341 3300031727 Ga0316576_10094339 Ga0316576_100943392 421
342 3300031728 Ga0316578_10115449 Ga0316578_101154492 421
343 3300037312 Ga0395899_0000077 Ga0395899_0000077_129664_130977 421
344 3300037471 Ga0395905_0067919 Ga0395905_0067919_1754_3064 421
345 3300038443 Ga0395901_0070567 Ga0395901_0070567_519_1829 421
346 3300039093 Ga0400489_91474 Ga0400489_91474_1413_2702 421
347 3300042876 Ga0451577_0000393 Ga0451577_0000393_9308_10606 421
348 3300042876 Ga0451577_0001546 Ga0451577_0001546_23771_25069 421
349 3300042876 Ga0451577_0014711 Ga0451577_0014711_528_1826 421
350 3300042876 Ga0451577_0245372 Ga0451577_0245372_196_1485 421
351 3300044673 Ga0453683_0000159 Ga0453683_0000159_46073_47371 421
352 3300044673 Ga0453683_0000538 Ga0453683_0000538_31679_32977 421
353 3300044673 Ga0453683_0058783 Ga0453683_0058783_80_1381 421
354 3300044712 Ga0453684_0000051 Ga0453684_0000051_127482_128780 421
355 3300044712 Ga0453684_0000264 Ga0453684_0000264_155017_156315 421
356 3300044712 Ga0453684_0000948 Ga0453684_0000948_6947_8236 421
357 3300044712 Ga0453684_0001191 Ga0453684_0001191_69757_71055 421
358 3300044712 Ga0453684_0010142 Ga0453684_0010142_12275_13564 421
359 3300044712 Ga0453684_0029550 Ga0453684_0029550_1011_2300 421
360 3300044712 Ga0453684_0046716 Ga0453684_0046716_3039_4325 421
361 3300044712 Ga0453684_0058945 Ga0453684_0058945_2892_4187 421
362 3300044712 Ga0453684_0227487 Ga0453684_0227487_211_1509 421
363 3300044712 Ga0453684_0233190 Ga0453684_0233190_713_2011 421
364 3300044712 Ga0453684_0255657 Ga0453684_0255657_239_1528 421
365 3300044712 Ga0453684_0289981 Ga0453684_0289981_207_1505 421
366 3300045051 Ga0451576_0000003 Ga0451576_0000003_652792_654078 421
367 3300045051 Ga0451576_0000148 Ga0451576_0000148_86406_87704 421
368 3300045051 Ga0451576_0000551 Ga0451576_0000551_9308_10606 421
369 3300045051 Ga0451576_0002016 Ga0451576_0002016_26631_27932 421
370 3300045051 Ga0451576_0015813 Ga0451576_0015813_1685_2980 421
371 3300046507 Ga0495606_0000008 Ga0495606_0000008_95981_97348 421
372 3300046523 Ga0495644_0005967 Ga0495644_0005967_1609_2937 421
373 3300053080 Ga0500635_0002479 Ga0500635_0002479_879_2180 421
374 3300001989 JGI24739J22299_10011165 JGI24739J22299_100111652 422
375 3300003316 rootH1_10025462 rootH1_100254622 422
376 3300005339 Ga0070660_100202813 Ga0070660_1002028131 422
377 3300009093 Ga0105240_10436381 Ga0105240_104363811 422
378 3300009176 Ga0105242_10055630 Ga0105242_100556301 422
379 3300013297 Ga0157378_10019319 Ga0157378_100193194 422
380 3300013306 Ga0163162_10007367 Ga0163162_100073675 422
381 3300025919 Ga0207657_10149720 Ga0207657_101497201 422
382 3300044673 Ga0453683_0000140 Ga0453683_0000140_15195_16499 422
383 3300044673 Ga0453683_0097274 Ga0453683_0097274_31_1344 422
384 3300044712 Ga0453684_0012531 Ga0453684_0012531_10541_11842 422
385 3300044712 Ga0453684_0058789 Ga0453684_0058789_1356_2660 422
386 3300044712 Ga0453684_0137227 Ga0453684_0137227_278_1570 422
387 3300045051 Ga0451576_0000795 Ga0451576_0000795_15064_16368 422
388 3300045051 Ga0451576_0009157 Ga0451576_0009157_6798_8102 422
389 3300045051 Ga0451576_0145843 Ga0451576_0145843_594_1895 422
390 3300046471 Ga0495650_0000119 Ga0495650_0000119_146575_147888 422
391 3300046512 Ga0495610_0002038 Ga0495610_0002038_5226_6539 422
392 3300046558 Ga0495633_0003104 Ga0495633_0003104_125_1438 422
393 3300047318 Ga0495636_0000306 Ga0495636_0000306_1527_2843 422
394 3300047443 Ga0495687_021857 Ga0495687_021857_1033_2367 422
395 2162886007 SwRhRL2b_contig_1490341 SwRhRL2b_0557.00003630 423
396 3300003323 rootH1_10247724 rootH1_102477242 423
397 3300005288 Ga0065714_10064844 Ga0065714_100648444 423
398 3300005288 Ga0065714_10078351 Ga0065714_100783512 423
399 3300005289 Ga0065704_10000572 Ga0065704_100005725 423
400 3300005355 Ga0070671_100005292 Ga0070671_1000052925 423
401 3300005364 Ga0070673_100054257 Ga0070673_1000542574 423
402 3300005456 Ga0070678_100000566 Ga0070678_1000005669 423
403 3300005459 Ga0068867_100009805 Ga0068867_1000098052 423
404 3300005539 Ga0068853_100087507 Ga0068853_1000875072 423
405 3300005543 Ga0070672_100018247 Ga0070672_1000182474 423
406 3300005563 Ga0068855_100062882 Ga0068855_1000628823 423
407 3300005616 Ga0068852_100004334 Ga0068852_1000043344 423
408 3300006237 Ga0097621_100000247 Ga0097621_10000024724 423
409 3300006358 Ga0068871_100003906 Ga0068871_10000390613 423
410 3300006881 Ga0068865_100000076 Ga0068865_10000007626 423
411 3300009093 Ga0105240_10096916 Ga0105240_100969162 423
412 3300009545 Ga0105237_10002957 Ga0105237_100029577 423
413 3300009545 Ga0105237_10026331 Ga0105237_100263315 423
414 3300009551 Ga0105238_10004834 Ga0105238_100048348 423
415 3300010375 Ga0105239_10047642 Ga0105239_100476422 423
416 3300013100 Ga0157373_10001086 Ga0157373_1000108613 423
417 3300013102 Ga0157371_10002900 Ga0157371_100029007 423
418 3300013102 Ga0157371_10002916 Ga0157371_100029167 423
419 3300013102 Ga0157371_10005923 Ga0157371_100059237 423
420 3300013104 Ga0157370_10004368 Ga0157370_100043685 423
421 3300013104 Ga0157370_10006534 Ga0157370_100065342 423
422 3300013104 Ga0157370_10022056 Ga0157370_100220563 423
423 3300013104 Ga0157370_10024483 Ga0157370_100244836 423
424 3300013105 Ga0157369_10000498 Ga0157369_1000049833 423
425 3300013296 Ga0157374_10001476 Ga0157374_100014766 423
426 3300013297 Ga0157378_10022103 Ga0157378_100221035 423
427 3300013308 Ga0157375_10014385 Ga0157375_100143856 423
428 3300014497 Ga0182008_10000887 Ga0182008_1000088711 423
429 3300014497 Ga0182008_10000955 Ga0182008_100009554 423
430 3300015261 Ga0182006_1002423 Ga0182006_10024235 423
431 3300015262 Ga0182007_10000054 Ga0182007_1000005470 423
432 3300015262 Ga0182007_10015496 Ga0182007_100154962 423
433 3300017792 Ga0163161_10003310 Ga0163161_100033107 423
434 3300025907 Ga0207645_10002749 Ga0207645_1000274916 423
435 3300025913 Ga0207695_10057854 Ga0207695_100578542 423
436 3300025914 Ga0207671_10007283 Ga0207671_1000728311 423
437 3300025924 Ga0207694_10016160 Ga0207694_100161605 423
438 3300025931 Ga0207644_10006244 Ga0207644_100062446 423
439 3300025938 Ga0207704_10000189 Ga0207704_1000018917 423
440 3300025949 Ga0207667_10033758 Ga0207667_100337583 423
441 3300025986 Ga0207658_10071028 Ga0207658_100710282 423
442 3300026041 Ga0207639_10172381 Ga0207639_101723812 423
443 3300026089 Ga0207648_10001991 Ga0207648_1000199114 423
444 3300026121 Ga0207683_10003548 Ga0207683_1000354810 423
445 3300026142 Ga0207698_10003020 Ga0207698_100030204 423
446 3300028786 Ga0307517_10000429 Ga0307517_1000042922 423
447 3300028794 Ga0307515_10014105 Ga0307515_100141055 423
448 3300030744 Ga0316181_1263026 Ga0316181_12630262 423
449 3300031911 Ga0307412_10000142 Ga0307412_100001425 423
450 3300032004 Ga0307414_10004107 Ga0307414_100041074 423
451 3300032004 Ga0307414_10010667 Ga0307414_100106672 423
452 3300046535 Ga0495586_0101241 Ga0495586_0101241_57_1343 423
453 3300048925 Ga0496122_0000782 Ga0496122_0000782_53287_54573 423
454 3300048926 Ga0496123_0006205 Ga0496123_0006205_6567_7853 423
455 iso_pu_bacteria 2738543023 2739304497 423
456 3300005548 Ga0070665_100000010 Ga0070665_100000010270 424
457 3300005614 Ga0068856_100005294 Ga0068856_1000052947 424
458 3300006353 Ga0075370_10058948 Ga0075370_100589482 424
459 3300010375 Ga0105239_10000162 Ga0105239_1000016230 424
460 3300013296 Ga0157374_10005179 Ga0157374_100051796 424
461 3300028379 Ga0268266_10000032 Ga0268266_10000032306 424
462 3300031344 Ga0265316_10002439 Ga0265316_1000243915 424
463 3300033180 Ga0307510_10001152 Ga0307510_1000115226 424
464 3300037418 Ga0395900_0000194 Ga0395900_0000194_7802_9112 424
465 3300039062 Ga0400483_097687 Ga0400483_097687_1958_3259 424
466 3300046684 Ga0495669_0078520 Ga0495669_0078520_40_1359 424
467 3300047323 Ga0495683_0027502 Ga0495683_0027502_1239_2558 424
468 3300047443 Ga0495687_004610 Ga0495687_004610_5346_6656 424
469 3300050496 nmdc:mga07m45_28263_c1 nmdc:mga07m45_28263_c1_176_1495 424
470 3300053122 Ga0500608_002735 Ga0500608_002735_376_1695 424
471 iso_pu_bacteria 2818991442 2819575715 424
472 iso_pu_bacteria 2821136567 2821138269 424
473 iso_pu_bacteria 2904467357 2904469065 424
474 iso_pu_bacteria 2929239360 2929242938 424
475 iso_pu_bacteria 2929921140 2929924444 424
476 iso_pu_bacteria 8003151029 8003155329 424
477 3300001989 JGI24739J22299_10011387 JGI24739J22299_100113872 425
478 3300005289 Ga0065704_10119989 Ga0065704_101199891 425
479 3300014326 Ga0157380_10000001 Ga0157380_1000000183 425
480 3300025913 Ga0207695_10024070 Ga0207695_100240703 425
481 3300031548 Ga0307408_100001086 Ga0307408_10000108613 425
482 3300031548 Ga0307408_100002564 Ga0307408_1000025643 425
483 iso_pu_bacteria 2884791551 2884792103 425
484 iso_pu_bacteria 2896109856 2896110397 425
485 iso_pu_bacteria 2929177148 2929181907 425
486 iso_pu_bacteria 2945977869 2945984303 425
487 iso_pu_bacteria 2946013367 2946016304 425
488 3300003323 rootH1_10035028 rootH1_1003502815 426
489 3300013104 Ga0157370_10013059 Ga0157370_100130598 426
490 3300031251 Ga0265327_10037289 Ga0265327_100372892 426
491 3300003322 rootL2_10155397 rootL2_101553974 427
492 3300013296 Ga0157374_10000003 Ga0157374_10000003652 427
493 3300013306 Ga0163162_10010696 Ga0163162_100106965 427
494 3300014969 Ga0157376_10038530 Ga0157376_100385305 427
495 3300001979 JGI24740J21852_10001023 JGI24740J21852_100010236 428
496 3300002738 JGI25154J39366_1000012 JGI25154J39366_100001234 428
497 3300002739 JGI25158J39367_1003512 JGI25158J39367_10035122 428
498 3300003203 JGI25406J46586_10001770 JGI25406J46586_100017705 428
499 3300003316 rootH1_10170876 rootH1_101708762 428
500 3300003316 rootH1_10192434 rootH1_101924341 428
501 3300003320 rootH2_10028771 rootH2_100287713 428
502 3300003320 rootH2_10104003 rootH2_101040038 428
503 3300003322 rootL2_10131654 rootL2_101316542 428
504 3300003323 rootH1_10120436 rootH1_101204365 428
505 3300003323 rootH1_10235163 rootH1_102351634 428
506 3300003354 JGI25160J50197_1001214 JGI25160J50197_10012149 428
507 3300003771 Ga0055526_1010794 Ga0055526_10107945 428
508 3300003771 Ga0055526_1011540 Ga0055526_10115404 428
509 3300003790 Ga0055528_1001120 Ga0055528_100112017 428
510 3300003791 Ga0055530_10001914 Ga0055530_100019146 428
511 3300003794 Ga0055531_10004384 Ga0055531_100043848 428
512 3300005262 Ga0065165_1000958 Ga0065165_100095818 428
513 3300005331 Ga0070670_100255475 Ga0070670_1002554752 428
514 3300005334 Ga0068869_100028033 Ga0068869_1000280335 428
515 3300005338 Ga0068868_100009145 Ga0068868_1000091454 428
516 3300005347 Ga0070668_100021168 Ga0070668_1000211686 428
517 3300005353 Ga0070669_100008600 Ga0070669_1000086004 428
518 3300005353 Ga0070669_100030864 Ga0070669_1000308645 428
519 3300005354 Ga0070675_100060605 Ga0070675_1000606052 428
520 3300005364 Ga0070673_100008346 Ga0070673_1000083461 428
521 3300005364 Ga0070673_100019427 Ga0070673_1000194274 428
522 3300005441 Ga0070700_100174510 Ga0070700_1001745101 428
523 3300005466 Ga0070685_10002672 Ga0070685_100026724 428
524 3300005577 Ga0068857_100026983 Ga0068857_1000269832 428
525 3300005578 Ga0068854_100081647 Ga0068854_1000816472 428
526 3300005719 Ga0068861_100003538 Ga0068861_1000035386 428
527 3300005719 Ga0068861_100022889 Ga0068861_1000228892 428
528 3300005843 Ga0068860_100278909 Ga0068860_1002789092 428
529 3300005985 Ga0081539_10003031 Ga0081539_100030316 428
530 3300006881 Ga0068865_100241776 Ga0068865_1002417761 428
531 3300009094 Ga0111539_10004074 Ga0111539_1000407412 428
532 3300009148 Ga0105243_10020938 Ga0105243_100209388 428
533 3300009177 Ga0105248_10125182 Ga0105248_101251822 428
534 3300009553 Ga0105249_10009057 Ga0105249_100090573 428
535 3300009553 Ga0105249_10307285 Ga0105249_103072852 428
536 3300010375 Ga0105239_10307345 Ga0105239_103073451 428
537 3300013102 Ga0157371_10128584 Ga0157371_101285842 428
538 3300013297 Ga0157378_10123501 Ga0157378_101235012 428
539 3300013306 Ga0163162_10088408 Ga0163162_100884083 428
540 3300013306 Ga0163162_10120748 Ga0163162_101207482 428
541 3300013306 Ga0163162_10247553 Ga0163162_102475531 428
542 3300013307 Ga0157372_10115006 Ga0157372_101150063 428
543 3300013308 Ga0157375_10016985 Ga0157375_100169858 428
544 3300013308 Ga0157375_10048424 Ga0157375_100484243 428
545 3300013308 Ga0157375_10129381 Ga0157375_101293812 428
546 3300014326 Ga0157380_10004095 Ga0157380_100040956 428
547 3300014745 Ga0157377_10006317 Ga0157377_100063173 428
548 3300014745 Ga0157377_10008499 Ga0157377_100084995 428
549 3300014969 Ga0157376_10091130 Ga0157376_100911301 428
550 3300015265 Ga0182005_1000282 Ga0182005_100028223 428
551 3300017792 Ga0163161_10103262 Ga0163161_101032623 428
552 3300025208 Ga0209436_101314 Ga0209436_1013148 428
553 3300025246 Ga0209646_1000009 Ga0209646_1000009240 428
554 3300025250 Ga0209026_1000221 Ga0209026_100022126 428
555 3300025273 Ga0209673_1000016 Ga0209673_1000016112 428
556 3300025295 Ga0209564_1002883 Ga0209564_10028832 428
557 3300025295 Ga0209564_1002893 Ga0209564_10028939 428
558 3300025295 Ga0209564_1027219 Ga0209564_10272192 428
559 3300025297 Ga0209758_1003120 Ga0209758_10031205 428
560 3300025297 Ga0209758_1006677 Ga0209758_10066777 428
561 3300025298 Ga0209050_1000124 Ga0209050_100012466 428
562 3300025302 Ga0207426_1000139 Ga0207426_100013948 428
563 3300025302 Ga0207426_1000477 Ga0207426_100047724 428
564 3300025302 Ga0207426_1001747 Ga0207426_10017474 428
565 3300025302 Ga0207426_1009837 Ga0207426_10098371 428
566 3300025304 Ga0209257_1000013 Ga0209257_1000013629 428
567 3300025304 Ga0209257_1003422 Ga0209257_100342214 428
568 3300025907 Ga0207645_10008615 Ga0207645_100086155 428
569 3300025923 Ga0207681_10023019 Ga0207681_100230191 428
570 3300025926 Ga0207659_10060288 Ga0207659_100602883 428
571 3300025933 Ga0207706_10021055 Ga0207706_100210554 428
572 3300025945 Ga0207679_10230149 Ga0207679_102301491 428
573 3300025960 Ga0207651_10007987 Ga0207651_100079873 428
574 3300025961 Ga0207712_10003758 Ga0207712_100037587 428
575 3300026089 Ga0207648_10156578 Ga0207648_101565781 428
576 3300026116 Ga0207674_10010275 Ga0207674_100102759 428
577 3300026118 Ga0207675_100000938 Ga0207675_1000009384 428
578 3300028794 Ga0307515_10000341 Ga0307515_1000034131 428
579 3300031251 Ga0265327_10000415 Ga0265327_1000041544 428
580 3300031507 Ga0307509_10098279 Ga0307509_100982792 428
581 3300031507 Ga0307509_10165048 Ga0307509_101650481 428
582 3300031995 Ga0307409_100265174 Ga0307409_1002651741 428
583 3300041997 Ga0439431_0022710 Ga0439431_0022710_175_1461 428
584 3300042007 Ga0439449_0028009 Ga0439449_0028009_213_1583 428
585 3300044658 Ga0466972_0034546 Ga0466972_0034546_92_1381 428
586 3300045049 Ga0466959_0013017 Ga0466959_0013017_1592_2881 428
587 3300045976 Ga0466967_0110974 Ga0466967_0110974_1214_2509 428
588 3300046453 Ga0495627_002060 Ga0495627_002060_7481_8767 428
589 3300046648 Ga0495611_0072330 Ga0495611_0072330_130_1416 428
590 3300048924 Ga0496121_0000026 Ga0496121_0000026_446870_448156 428
591 3300049570 Ga0501033_0012262 Ga0501033_0012262_1626_2921 428
592 3300049571 Ga0501034_0078894 Ga0501034_0078894_1954_3249 428
593 3300049581 Ga0501047_0042834 Ga0501047_0042834_808_2106 428
594 3300049581 Ga0501047_0049809 Ga0501047_0049809_1458_2747 428
595 3300049758 Ga0501241_006565 Ga0501241_006565_696_1982 428
596 3300049823 Ga0501044_0013455 Ga0501044_0013455_4615_5904 428
597 3300049823 Ga0501044_0025159 Ga0501044_0025159_3033_4328 428
598 3300049823 Ga0501044_0041803 Ga0501044_0041803_2289_3587 428
599 3300053088 Ga0500644_0001956 Ga0500644_0001956_1108_2397 428
600 3300053109 Ga0500569_002571 Ga0500569_002571_1089_2543 428
601 3300053121 Ga0500607_011430 Ga0500607_011430_3841_5127 428
602 3300053131 Ga0500652_049191 Ga0500652_049191_142_1440 428
603 3300053134 Ga0500658_0003180 Ga0500658_0003180_4226_5512 428
604 3300053156 Ga0500622_0000295 Ga0500622_0000295_2570_3940 428
605 3300053730 Ga0500645_008945 Ga0500645_008945_802_2091 428
606 3300055283 Ga0500661_012330 Ga0500661_012330_198_1487 428
607 iso_pu_bacteria 2818991460 2819678996 428
608 2162886007 SwRhRL2b_contig_1054638 SwRhRL2b_0826.00000930 429
609 3300005288 Ga0065714_10067074 Ga0065714_100670747 429
610 3300005289 Ga0065704_10075622 Ga0065704_100756222 429
611 3300005459 Ga0068867_100106472 Ga0068867_1001064721 429
612 3300005539 Ga0068853_100004447 Ga0068853_10000444711 429
613 3300005539 Ga0068853_100019354 Ga0068853_1000193547 429
614 3300006358 Ga0068871_100043057 Ga0068871_1000430572 429
615 3300026041 Ga0207639_10045777 Ga0207639_100457772 429
616 3300026078 Ga0207702_10127230 Ga0207702_101272302 429
617 3300028794 Ga0307515_10000001 Ga0307515_10000001864 429
618 3300031616 Ga0307508_10001709 Ga0307508_100017092 429
619 3300044712 Ga0453684_0104130 Ga0453684_0104130_1110_2423 429
620 3300049571 Ga0501034_0027495 Ga0501034_0027495_1254_2546 429

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

359

477

0.95

PF08245

Mur_ligase_M

Mur ligase middle domain

107

329

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w7k-assembly1.cif.gz_A e.coli folc in complex with adp, without folate substrate 0.9221 2 425
3nrs-assembly1.cif.gz_A crystal structure of ligand-free bifunctional folylpolyglutamate synthase/dihydrofolate synthase from yersinia pestis c092 0.919 29 425
3qcz-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase with mn, amppnp and l-glutamate bound 0.9178 26 425
3pyz-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase complexed with amppnp and mn ion from yersinia pestis c092 0.9028 1 425
2vor-assembly1.cif.gz_A crystal structures of mycobacterium tuberculosis folylpolyglutamate synthase complexed with adp and amppcp 0.9004 28 425
ID Description Score Start End Superfamily
af_A0A1D6KRC8_83_409_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9328 3 212 3.40.1190.10
1o5zA01 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9255 3 293 3.40.1190.10
af_Q9UTD0_1_272_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.923 26 292 3.40.1190.10
3n2aA02 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9154 303 424 3.90.190.20
1fgsA01 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9103 1 295 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A3B0TLD1-F1-model_v4 Dihydrofolate synthase @ Folylpolyglutamate synthase (EC 6.3.2.12, EC 6.3.2.17) 0.9944 337 426 GO:0004326
GO:0008841
AF-K1TSW2-F1-model_v4 Tetrahydrofolate synthase 0.9942 85 222 GO:0004326
GO:0005524
GO:0005737
GO:0008841
AF-A0A432K2N0-F1-model_v4 Bifunctional folylpolyglutamate synthase/dihydrofolate synthase 0.9941 3 195 GO:0004326
GO:0005524
GO:0005737
GO:0008841
AF-A0A7C2R485-F1-model_v4 Bifunctional folylpolyglutamate synthase/dihydrofolate synthase 0.9939 1 216 GO:0004326
GO:0005524
GO:0005737
GO:0008841
AF-A0A2V7L4N5-F1-model_v4 Dihydrofolate synthase 0.9891 39 161 GO:0004326
GO:0005524
GO:0005737
GO:0008841

Feature Viewer

pLDDT pTM Quality
93.03 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map