F469924

General Info

Members Datasets Scaffolds Average Seq Length
620 255 1240 258

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10306361|Ga0316578_103063611
Length 289
Sequence MSAIFDYVGFLLDQFAWKDLAEILIVAWLVYRILLMYTGTRAFQVLLGFVLLVSVYVLAQAAGLRLIPYILSQVFTYGAFALIVIFQQEIRAALARLGRSRLFLVFARREQQEVVEEIVRAADRLAKAKIGGIIAIERQVDLANHVDHGTPINAQVSAELLTTIFTPYSPLHDGAVIVRRDQVAYAGSVILRLSESPALDRALGTRHRAALGLSEETDALVVVISEETGQISLAHRGLLHRGLRPDDLAGRLAAGGEEEPAVQAAVPAPAGLDPVERTGVVPAGSDSGV

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
185 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.45
Rhizosphere 98.55
Stem 0
Stem Tuber 0
Unclassified 8.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10306361 3300031728 Unclassified 949
2 Ga0070658_10006376 3300005327 Bacteria 9560
3 Ga0070658_10029990 3300005327 Bacteria 4370
4 Ga0070658_10056015 3300005327 Bacteria 3204
5 Ga0070658_10115908 3300005327 Bacteria 2223
6 Ga0070658_10151612 3300005327 Bacteria 1941
7 Ga0070658_10301867 3300005327 Bacteria 1365
8 Ga0070676_10001218 3300005328 Bacteria 12913
9 Ga0070676_10045820 3300005328 Bacteria 2548
10 Ga0070676_10096639 3300005328 Bacteria 1818
11 Ga0070683_100003200 3300005329 Bacteria 13216
12 Ga0070683_100003366 3300005329 Bacteria 12954
13 Ga0070683_100004580 3300005329 Bacteria 11411
14 Ga0070683_100103744 3300005329 Bacteria 2680
15 Ga0070683_100107162 3300005329 Bacteria 2635
16 Ga0070690_100010218 3300005330 Bacteria 5455
17 Ga0070690_100043135 3300005330 Bacteria 2859
18 Ga0070670_100181453 3300005331 Unclassified 1828
19 Ga0070670_100264348 3300005331 Bacteria 1500
20 Ga0070677_10017611 3300005333 Bacteria 2560
21 Ga0070677_10026893 3300005333 Bacteria 2161
22 Ga0070680_100008766 3300005336 Bacteria 7757
23 Ga0070680_100010696 3300005336 Bacteria 7082
24 Ga0070680_100041264 3300005336 Bacteria 3741
25 Ga0070680_100104489 3300005336 Bacteria 2354
26 Ga0070680_100129461 3300005336 Unclassified 2110
27 Ga0070680_100146489 3300005336 Bacteria 1981
28 Ga0070680_100260684 3300005336 Bacteria 1466
29 Ga0070680_100273968 3300005336 Bacteria 1429
30 Ga0070680_100344314 3300005336 Bacteria 1267
31 Ga0070680_100460636 3300005336 Bacteria 1086
32 Ga0070682_100272183 3300005337 Bacteria 1231
33 Ga0068868_100389114 3300005338 Bacteria 1201
34 Ga0070660_100024288 3300005339 Bacteria 4498
35 Ga0070660_100054114 3300005339 Bacteria 3098
36 Ga0070660_100119792 3300005339 Unclassified 2100
37 Ga0070660_100148897 3300005339 Bacteria 1881
38 Ga0070660_100209821 3300005339 Bacteria 1581
39 Ga0070687_100062634 3300005343 Bacteria 1970
40 Ga0070687_100099988 3300005343 Bacteria 1622
41 Ga0070661_100007493 3300005344 Bacteria 7529
42 Ga0070661_100016178 3300005344 Bacteria 5267
43 Ga0070661_100031025 3300005344 Bacteria 3864
44 Ga0070661_100042797 3300005344 Bacteria 3307
45 Ga0070692_10028741 3300005345 Bacteria 2766
46 Ga0070668_100029008 3300005347 Bacteria 4200
47 Ga0070668_100150064 3300005347 Bacteria 1884
48 Ga0070668_100226657 3300005347 Bacteria 1543
49 Ga0070668_100445536 3300005347 Bacteria 1112
50 Ga0070669_100135652 3300005353 Bacteria 1893
51 Ga0070675_100176253 3300005354 Bacteria 1846
52 Ga0070671_100051939 3300005355 Bacteria 3409
53 Ga0070671_100284163 3300005355 Bacteria 1407
54 Ga0070674_100000059 3300005356 Bacteria 48494
55 Ga0070674_100361733 3300005356 Bacteria 1175
56 Ga0070659_100161002 3300005366 Bacteria 1835
57 Ga0070659_100526097 3300005366 Bacteria 1010
58 Ga0070703_10000938 3300005406 Bacteria 9292
59 Ga0070703_10003381 3300005406 Bacteria 4549
60 Ga0070703_10005347 3300005406 Bacteria 3587
61 Ga0070709_10003364 3300005434 Bacteria 8597
62 Ga0070714_100012543 3300005435 Bacteria 6772
63 Ga0070714_100016210 3300005435 Bacteria 6011
64 Ga0070714_100056301 3300005435 Bacteria 3363
65 Ga0070713_100007470 3300005436 Bacteria 7675
66 Ga0070701_10002052 3300005438 Bacteria 7653
67 Ga0070711_100000023 3300005439 Bacteria 118053
68 Ga0070711_100155069 3300005439 Bacteria 1731
69 Ga0070705_100005356 3300005440 Bacteria 6249
70 Ga0070705_100032596 3300005440 Bacteria 2896
71 Ga0070705_100040058 3300005440 Unclassified 2662
72 Ga0070705_100063883 3300005440 Bacteria 2197
73 Ga0070705_100068828 3300005440 Bacteria 2132
74 Ga0070705_100217263 3300005440 Bacteria 1321
75 Ga0070705_100369109 3300005440 Unclassified 1052
76 Ga0070700_100070403 3300005441 Bacteria 2230
77 Ga0070700_100224627 3300005441 Unclassified 1333
78 Ga0070694_100003480 3300005444 Bacteria 9425
79 Ga0070694_100032587 3300005444 Bacteria 3422
80 Ga0070694_100071577 3300005444 Bacteria 2390
81 Ga0070694_100140685 3300005444 Bacteria 1753
82 Ga0070694_100165053 3300005444 Unclassified 1628
83 Ga0070708_100003739 3300005445 Bacteria 11935
84 Ga0070708_100004792 3300005445 Bacteria 10668
85 Ga0070708_100012587 3300005445 Bacteria 6908
86 Ga0070708_100017715 3300005445 Bacteria 5948
87 Ga0070708_100317669 3300005445 Bacteria 1467
88 Ga0070708_100328598 3300005445 Unclassified 1441
89 Ga0070663_100134232 3300005455 Bacteria 1883
90 Ga0070678_100001819 3300005456 Bacteria 11499
91 Ga0070678_100562080 3300005456 Bacteria 1014
92 Ga0070662_100001077 3300005457 Bacteria 16629
93 Ga0070681_10009056 3300005458 Bacteria 9785
94 Ga0070681_10031356 3300005458 Bacteria 5336
95 Ga0070681_10059849 3300005458 Bacteria 3788
96 Ga0070681_10066934 3300005458 Bacteria 3561
97 Ga0070681_10114294 3300005458 Bacteria 2638
98 Ga0070681_10163571 3300005458 Bacteria 2149
99 Ga0070681_10389421 3300005458 Unclassified 1305
100 Ga0068867_100017893 3300005459 Bacteria 5034
101 Ga0068867_100061458 3300005459 Bacteria 2789
102 Ga0068867_100572652 3300005459 Bacteria 981
103 Ga0070685_10043225 3300005466 Bacteria 2575
104 Ga0070706_100019732 3300005467 Bacteria 6217
105 Ga0070706_100023279 3300005467 Bacteria 5707
106 Ga0070706_100035491 3300005467 Bacteria 4605
107 Ga0070706_100074158 3300005467 Bacteria 3150
108 Ga0070706_100128245 3300005467 Bacteria 2367
109 Ga0070706_100390832 3300005467 Bacteria 1295
110 Ga0070707_100003897 3300005468 Bacteria 14048
111 Ga0070707_100009248 3300005468 Bacteria 9145
112 Ga0070707_100115931 3300005468 Bacteria 2600
113 Ga0070707_100136278 3300005468 Bacteria 2388
114 Ga0070698_100005698 3300005471 Bacteria 13632
115 Ga0070698_100008988 3300005471 Bacteria 10746
116 Ga0070698_100388671 3300005471 Bacteria 1328
117 Ga0070699_100004005 3300005518 Bacteria 13019
118 Ga0070699_100009601 3300005518 Bacteria 8384
119 Ga0070699_100020510 3300005518 Bacteria 5702
120 Ga0070699_100049207 3300005518 Bacteria 3648
121 Ga0070699_100080053 3300005518 Bacteria 2847
122 Ga0070699_100102799 3300005518 Bacteria 2505
123 Ga0070699_100360512 3300005518 Bacteria 1310
124 Ga0070699_100448638 3300005518 Unclassified 1169
125 Ga0070679_100015968 3300005530 Bacteria 7230
126 Ga0070679_100017179 3300005530 Bacteria 6998
127 Ga0070679_100017275 3300005530 Bacteria 6981
128 Ga0070679_100025085 3300005530 Bacteria 5847
129 Ga0070679_100029644 3300005530 Bacteria 5398
130 Ga0070679_100074933 3300005530 Bacteria 3374
131 Ga0070679_100141868 3300005530 Unclassified 2381
132 Ga0070679_100146738 3300005530 Bacteria 2336
133 Ga0070679_100185806 3300005530 Bacteria 2049
134 Ga0070679_100232955 3300005530 Bacteria 1801
135 Ga0070679_100286911 3300005530 Bacteria 1598
136 Ga0070679_100563414 3300005530 Bacteria 1083
137 Ga0070684_100004941 3300005535 Bacteria 10176
138 Ga0070684_100068259 3300005535 Bacteria 3124
139 Ga0070697_100010500 3300005536 Bacteria 7228
140 Ga0070697_100064129 3300005536 Bacteria 3001
141 Ga0070697_100094848 3300005536 Bacteria 2473
142 Ga0070697_100280176 3300005536 Unclassified 1430
143 Ga0068853_100113204 3300005539 Bacteria 2412
144 Ga0068853_100181710 3300005539 Bacteria 1908
145 Ga0068853_100346980 3300005539 Bacteria 1380
146 Ga0070672_100272657 3300005543 Bacteria 1429
147 Ga0070686_100025124 3300005544 Bacteria 3580
148 Ga0070695_100001849 3300005545 Bacteria 11944
149 Ga0070695_100017623 3300005545 Bacteria 4333
150 Ga0070695_100037204 3300005545 Bacteria 3067
151 Ga0070695_100045411 3300005545 Bacteria 2800
152 Ga0070695_100054533 3300005545 Bacteria 2573
153 Ga0070695_100183575 3300005545 Bacteria 1484
154 Ga0070696_100001569 3300005546 Bacteria 14972
155 Ga0070696_100001843 3300005546 Bacteria 13928
156 Ga0070696_100003663 3300005546 Bacteria 10249
157 Ga0070696_100008170 3300005546 Bacteria 7003
158 Ga0070696_100082190 3300005546 Bacteria 2283
159 Ga0070696_100316709 3300005546 Bacteria 1199
160 Ga0070693_100039404 3300005547 Bacteria 2646
161 Ga0070704_100004738 3300005549 Bacteria 7870
162 Ga0070704_100005143 3300005549 Bacteria 7602
163 Ga0070704_100075500 3300005549 Bacteria 2462
164 Ga0070704_100141812 3300005549 Bacteria 1877
165 Ga0070704_100148725 3300005549 Bacteria 1839
166 Ga0070704_100285386 3300005549 Bacteria 1369
167 Ga0070704_100449575 3300005549 Unclassified 1109
168 Ga0068855_100047711 3300005563 Bacteria 5059
169 Ga0068855_100130958 3300005563 Bacteria 2865
170 Ga0068855_100176132 3300005563 Unclassified 2420
171 Ga0068855_100403349 3300005563 Bacteria 1498
172 Ga0070664_100008399 3300005564 Bacteria 8350
173 Ga0070664_100031908 3300005564 Bacteria 4405
174 Ga0070664_100078589 3300005564 Bacteria 2838
175 Ga0070664_100290206 3300005564 Bacteria 1477
176 Ga0068857_100001519 3300005577 Bacteria 18526
177 Ga0068854_100002110 3300005578 Bacteria 12188
178 Ga0068854_100027555 3300005578 Bacteria 3917
179 Ga0068856_100130697 3300005614 Bacteria 2515
180 Ga0068856_100314420 3300005614 Bacteria 1584
181 Ga0070702_100045989 3300005615 Bacteria 2472
182 Ga0070702_100157401 3300005615 Unclassified 1464
183 Ga0068852_100011290 3300005616 Bacteria 6719
184 Ga0068852_100037353 3300005616 Bacteria 4071
185 Ga0068852_100433017 3300005616 Bacteria 1299
186 Ga0068852_100468889 3300005616 Bacteria 1249
187 Ga0068859_100155568 3300005617 Bacteria 2363
188 Ga0068864_100002344 3300005618 Bacteria 15662
189 Ga0068864_100065616 3300005618 Bacteria 3149
190 Ga0068866_10000191 3300005718 Bacteria 28693
191 Ga0068861_100144146 3300005719 Bacteria 1947
192 Ga0068861_100342075 3300005719 Bacteria 1309
193 Ga0068870_10060861 3300005840 Bacteria 2028
194 Ga0068858_100183692 3300005842 Bacteria 1975
195 Ga0068860_100001544 3300005843 Bacteria 24792
196 Ga0068860_100090513 3300005843 Bacteria 2914
197 Ga0068862_100323970 3300005844 Bacteria 1423
198 Ga0068862_100389407 3300005844 Bacteria 1302
199 Ga0075432_10108620 3300006058 Bacteria 1032
200 Ga0070715_10065820 3300006163 Unclassified 1605
201 Ga0070716_100539589 3300006173 Bacteria 867
202 Ga0097621_100180649 3300006237 Bacteria 1823
203 Ga0075428_100050762 3300006844 Bacteria 4548
204 Ga0075428_100165014 3300006844 Bacteria 2403
205 Ga0075428_100269140 3300006844 Unclassified 1833
206 Ga0075428_100348747 3300006844 Unclassified 1589
207 Ga0075430_100006336 3300006846 Bacteria 9984
208 Ga0075430_100268836 3300006846 Unclassified 1411
209 Ga0075430_100288785 3300006846 Bacteria 1357
210 Ga0075430_100367236 3300006846 Unclassified 1188
211 Ga0075431_100003201 3300006847 Bacteria 15836
212 Ga0075431_100249049 3300006847 Unclassified 1805
213 Ga0075433_10006955 3300006852 Bacteria 8966
214 Ga0075433_10041343 3300006852 Bacteria 3994
215 Ga0075433_10109842 3300006852 Bacteria 2446
216 Ga0075434_100006431 3300006871 Bacteria 10764
217 Ga0075434_100019424 3300006871 Bacteria 6578
218 Ga0075434_100029182 3300006871 Bacteria 5424
219 Ga0075434_100046892 3300006871 Bacteria 4288
220 Ga0075434_100246642 3300006871 Bacteria 1805
221 Ga0075434_100279031 3300006871 Bacteria 1690
222 Ga0075429_100556134 3300006880 Bacteria 1005
223 Ga0068865_100005025 3300006881 Bacteria 8000
224 Ga0075436_100007164 3300006914 Bacteria 7630
225 Ga0075436_100007288 3300006914 Bacteria 7562
226 Ga0075436_100007493 3300006914 Bacteria 7458
227 Ga0075436_100018530 3300006914 Bacteria 4765
228 Ga0075436_100019356 3300006914 Bacteria 4665
229 Ga0075436_100055214 3300006914 Bacteria 2742
230 Ga0075436_100068021 3300006914 Bacteria 2461
231 Ga0075436_100069010 3300006914 Bacteria 2442
232 Ga0075436_100119624 3300006914 Bacteria 1842
233 Ga0075436_100148382 3300006914 Bacteria 1649
234 Ga0075436_100281349 3300006914 Bacteria 1189
235 Ga0097620_100155573 3300006931 Bacteria 2363
236 Ga0075435_100002047 3300007076 Bacteria 13206
237 Ga0075435_100082589 3300007076 Bacteria 2641
238 Ga0075435_100104291 3300007076 Bacteria 2352
239 Ga0075435_100167423 3300007076 Bacteria 1853
240 Ga0075435_100172264 3300007076 Bacteria 1826
241 Ga0075435_100209972 3300007076 Bacteria 1651
242 Ga0075435_100457869 3300007076 Bacteria 1100
243 Ga0099794_10000140 3300007265 Bacteria 26766
244 Ga0099794_10022068 3300007265 Bacteria 2899
245 Ga0105240_10004437 3300009093 Bacteria 21401
246 Ga0105240_10150848 3300009093 Bacteria 2768
247 Ga0105240_10160544 3300009093 Unclassified 2670
248 Ga0105240_10249348 3300009093 Unclassified 2054
249 Ga0105240_10289793 3300009093 Bacteria 1877
250 Ga0111539_10112921 3300009094 Bacteria 3187
251 Ga0105245_10157408 3300009098 Bacteria 2153
252 Ga0105245_10235377 3300009098 Bacteria 1773
253 Ga0114129_10104950 3300009147 Bacteria 3905
254 Ga0114129_10719351 3300009147 Bacteria 1281
255 Ga0105243_10018895 3300009148 Bacteria 5225
256 Ga0105241_10033349 3300009174 Bacteria 3865
257 Ga0105241_10098524 3300009174 Bacteria 2320
258 Ga0105242_10000288 3300009176 Bacteria 40129
259 Ga0105248_10001971 3300009177 Bacteria 22813
260 Ga0105248_10129019 3300009177 Bacteria 2853
261 Ga0105238_10019296 3300009551 Bacteria 6946
262 Ga0105238_10091665 3300009551 Bacteria 3026
263 Ga0105249_10000187 3300009553 Bacteria 71740
264 Ga0105249_10046906 3300009553 Bacteria 3934
265 Ga0105239_10038891 3300010375 Bacteria 5211
266 Ga0105239_10361229 3300010375 Unclassified 1640
267 Ga0105246_10234228 3300011119 Bacteria 1448
268 Ga0157373_10000674 3300013100 Bacteria 26717
269 Ga0157373_10102035 3300013100 Bacteria 2018
270 Ga0157373_10109090 3300013100 Bacteria 1946
271 Ga0157373_10475894 3300013100 Bacteria 901
272 Ga0157371_10183695 3300013102 Bacteria 1496
273 Ga0157370_10018291 3300013104 Bacteria 7049
274 Ga0157370_10027488 3300013104 Bacteria 5609
275 Ga0157370_10034964 3300013104 Bacteria 4889
276 Ga0157370_10053553 3300013104 Bacteria 3847
277 Ga0157370_10274738 3300013104 Bacteria 1557
278 Ga0157370_10444190 3300013104 Bacteria 1192
279 Ga0157369_10058320 3300013105 Bacteria 4164
280 Ga0157369_10073621 3300013105 Bacteria 3665
281 Ga0157369_10155445 3300013105 Unclassified 2416
282 Ga0157369_10190492 3300013105 Bacteria 2155
283 Ga0157369_10405180 3300013105 Bacteria 1415
284 Ga0157369_10738713 3300013105 Bacteria 1013
285 Ga0157378_10006364 3300013297 Bacteria 10330
286 Ga0163162_10055336 3300013306 Bacteria 3993
287 Ga0163162_10283502 3300013306 Bacteria 1788
288 Ga0163162_10613937 3300013306 Bacteria 1213
289 Ga0157372_10007933 3300013307 Bacteria 11284
290 Ga0157372_10010304 3300013307 Bacteria 9931
291 Ga0157372_10012913 3300013307 Bacteria 8904
292 Ga0157372_10015092 3300013307 Bacteria 8269
293 Ga0157372_10048382 3300013307 Bacteria 4727
294 Ga0157372_10238049 3300013307 Unclassified 2112
295 Ga0157375_10023419 3300013308 Bacteria 5698
296 Ga0157375_10070033 3300013308 Bacteria 3516
297 Ga0157375_10153230 3300013308 Bacteria 2442
298 Ga0157375_10355404 3300013308 Unclassified 1631
299 Ga0157380_10133317 3300014326 Bacteria 2123
300 Ga0157380_10344768 3300014326 Bacteria 1391
301 Ga0157380_10483607 3300014326 Bacteria 1198
302 Ga0182008_10010579 3300014497 Bacteria 4933
303 Ga0157377_10038627 3300014745 Bacteria 2637
304 Ga0157379_10032769 3300014968 Bacteria 4633
305 Ga0157376_10882830 3300014969 Bacteria 911
306 Ga0163161_10021098 3300017792 Bacteria 4578
307 Ga0163161_10118245 3300017792 Bacteria 1989
308 Ga0207697_10043913 3300025315 Bacteria 1838
309 Ga0207653_10000108 3300025885 Bacteria 58664
310 Ga0207653_10002462 3300025885 Bacteria 5883
311 Ga0207653_10006477 3300025885 Bacteria 3653
312 Ga0207682_10030510 3300025893 Bacteria 2159
313 Ga0207688_10030665 3300025901 Bacteria 2966
314 Ga0207685_10087717 3300025905 Unclassified 1303
315 Ga0207699_10005071 3300025906 Bacteria 6300
316 Ga0207699_10035615 3300025906 Bacteria 2833
317 Ga0207645_10001444 3300025907 Bacteria 19469
318 Ga0207645_10072691 3300025907 Bacteria 2202
319 Ga0207643_10001464 3300025908 Bacteria 13546
320 Ga0207643_10062461 3300025908 Bacteria 2129
321 Ga0207705_10014712 3300025909 Bacteria 5626
322 Ga0207705_10050212 3300025909 Bacteria 3003
323 Ga0207705_10067319 3300025909 Bacteria 2592
324 Ga0207705_10091343 3300025909 Bacteria 2230
325 Ga0207705_10096739 3300025909 Bacteria 2168
326 Ga0207684_10002029 3300025910 Bacteria 20864
327 Ga0207684_10039891 3300025910 Bacteria 3980
328 Ga0207684_10054562 3300025910 Bacteria 3391
329 Ga0207684_10124609 3300025910 Bacteria 2210
330 Ga0207654_10009134 3300025911 Bacteria 5027
331 Ga0207654_10099735 3300025911 Bacteria 1787
332 Ga0207707_10006392 3300025912 Bacteria 10289
333 Ga0207707_10011859 3300025912 Bacteria 7582
334 Ga0207707_10011932 3300025912 Bacteria 7559
335 Ga0207707_10032579 3300025912 Bacteria 4561
336 Ga0207707_10050378 3300025912 Bacteria 3627
337 Ga0207707_10052257 3300025912 Bacteria 3558
338 Ga0207707_10053525 3300025912 Bacteria 3513
339 Ga0207707_10093462 3300025912 Bacteria 2627
340 Ga0207707_10202358 3300025912 Bacteria 1731
341 Ga0207707_10304969 3300025912 Bacteria 1376
342 Ga0207707_10330089 3300025912 Unclassified 1316
343 Ga0207695_10003486 3300025913 Bacteria 22123
344 Ga0207695_10037157 3300025913 Bacteria 5256
345 Ga0207695_10054823 3300025913 Bacteria 4159
346 Ga0207695_10160898 3300025913 Bacteria 2177
347 Ga0207663_10000085 3300025916 Bacteria 44183
348 Ga0207660_10000760 3300025917 Bacteria 21451
349 Ga0207660_10023630 3300025917 Bacteria 4154
350 Ga0207660_10032029 3300025917 Bacteria 3626
351 Ga0207660_10033190 3300025917 Unclassified 3568
352 Ga0207660_10047768 3300025917 Bacteria 3028
353 Ga0207660_10126081 3300025917 Bacteria 1944
354 Ga0207657_10033729 3300025919 Bacteria 4612
355 Ga0207657_10046589 3300025919 Bacteria 3797
356 Ga0207657_10176718 3300025919 Unclassified 1727
357 Ga0207657_10331845 3300025919 Bacteria 1201
358 Ga0207649_10005599 3300025920 Bacteria 6792
359 Ga0207649_10048229 3300025920 Bacteria 2626
360 Ga0207649_10144935 3300025920 Bacteria 1629
361 Ga0207649_10211976 3300025920 Bacteria 1375
362 Ga0207652_10000783 3300025921 Bacteria 30376
363 Ga0207652_10012958 3300025921 Bacteria 6747
364 Ga0207652_10013892 3300025921 Bacteria 6517
365 Ga0207652_10016698 3300025921 Bacteria 5998
366 Ga0207652_10018078 3300025921 Bacteria 5779
367 Ga0207652_10039039 3300025921 Bacteria 4028
368 Ga0207652_10326780 3300025921 Bacteria 1385
369 Ga0207652_10369708 3300025921 Bacteria 1294
370 Ga0207652_10476406 3300025921 Bacteria 1124
371 Ga0207646_10002990 3300025922 Bacteria 19523
372 Ga0207646_10003863 3300025922 Bacteria 16637
373 Ga0207646_10040255 3300025922 Bacteria 4203
374 Ga0207646_10047926 3300025922 Bacteria 3831
375 Ga0207646_10101568 3300025922 Bacteria 2578
376 Ga0207646_10228220 3300025922 Bacteria 1682
377 Ga0207681_10020497 3300025923 Bacteria 4191
378 Ga0207694_10080965 3300025924 Bacteria 2549
379 Ga0207659_10065964 3300025926 Bacteria 2625
380 Ga0207659_10074077 3300025926 Bacteria 2495
381 Ga0207687_10105252 3300025927 Bacteria 2084
382 Ga0207700_10036865 3300025928 Bacteria 3536
383 Ga0207664_10019612 3300025929 Bacteria 5001
384 Ga0207664_10020727 3300025929 Bacteria 4879
385 Ga0207664_10072632 3300025929 Bacteria 2774
386 Ga0207664_10330036 3300025929 Unclassified 1347
387 Ga0207706_10000154 3300025933 Bacteria 75674
388 Ga0207706_10104949 3300025933 Bacteria 2486
389 Ga0207686_10000088 3300025934 Bacteria 76743
390 Ga0207686_10112833 3300025934 Bacteria 1837
391 Ga0207709_10165921 3300025935 Bacteria 1545
392 Ga0207669_10008031 3300025937 Bacteria 4931
393 Ga0207669_10262790 3300025937 Bacteria 1292
394 Ga0207704_10001360 3300025938 Bacteria 10928
395 Ga0207704_10031974 3300025938 Bacteria 2972
396 Ga0207665_10007084 3300025939 Bacteria 7424
397 Ga0207665_10035323 3300025939 Bacteria 3317
398 Ga0207691_10006396 3300025940 Bacteria 11377
399 Ga0207691_10018122 3300025940 Bacteria 6668
400 Ga0207711_10009831 3300025941 Bacteria 7955
401 Ga0207711_10134811 3300025941 Bacteria 2217
402 Ga0207711_10830330 3300025941 Unclassified 860
403 Ga0207689_10001413 3300025942 Bacteria 22922
404 Ga0207661_10011046 3300025944 Bacteria 6526
405 Ga0207661_10049449 3300025944 Bacteria 3347
406 Ga0207661_10080494 3300025944 Bacteria 2688
407 Ga0207661_10391820 3300025944 Bacteria 1258
408 Ga0207661_10433715 3300025944 Bacteria 1195
409 Ga0207679_10037324 3300025945 Bacteria 3453
410 Ga0207679_10047211 3300025945 Bacteria 3127
411 Ga0207679_10092895 3300025945 Bacteria 2338
412 Ga0207679_10106608 3300025945 Bacteria 2203
413 Ga0207667_10022677 3300025949 Bacteria 6926
414 Ga0207667_10144566 3300025949 Bacteria 2448
415 Ga0207667_10145918 3300025949 Bacteria 2436
416 Ga0207667_10279137 3300025949 Bacteria 1707
417 Ga0207712_10000356 3300025961 Bacteria 40659
418 Ga0207712_10008853 3300025961 Bacteria 6364
419 Ga0207712_10012348 3300025961 Bacteria 5458
420 Ga0207668_10154006 3300025972 Bacteria 1783
421 Ga0207668_10497588 3300025972 Bacteria 1048
422 Ga0207640_10002551 3300025981 Bacteria 9762
423 Ga0207640_10354096 3300025981 Bacteria 1180
424 Ga0207658_10063438 3300025986 Bacteria 2769
425 Ga0207658_10091440 3300025986 Bacteria 2361
426 Ga0207703_10043632 3300026035 Bacteria 3600
427 Ga0207703_10053802 3300026035 Bacteria 3272
428 Ga0207639_10054719 3300026041 Bacteria 3051
429 Ga0207639_10204154 3300026041 Bacteria 1697
430 Ga0207639_10293337 3300026041 Bacteria 1435
431 Ga0207678_10068427 3300026067 Bacteria 3046
432 Ga0207678_10168624 3300026067 Bacteria 1869
433 Ga0207708_10063350 3300026075 Bacteria 2825
434 Ga0207702_10542991 3300026078 Bacteria 1136
435 Ga0207641_11199321 3300026088 Unclassified 759
436 Ga0207648_10000096 3300026089 Bacteria 83916
437 Ga0207648_10126436 3300026089 Bacteria 2249
438 Ga0207648_10201131 3300026089 Bacteria 1767
439 Ga0207676_10290560 3300026095 Bacteria 1488
440 Ga0207674_10002460 3300026116 Bacteria 23376
441 Ga0207674_10018169 3300026116 Bacteria 7651
442 Ga0207674_10030161 3300026116 Bacteria 5704
443 Ga0207675_100024896 3300026118 Bacteria 5569
444 Ga0207675_100223188 3300026118 Bacteria 1816
445 Ga0207683_10317813 3300026121 Bacteria 1426
446 Ga0207698_10056972 3300026142 Bacteria 3020
447 Ga0207698_10234738 3300026142 Bacteria 1667
448 Ga0209995_1029023 3300027471 Bacteria 924
449 Ga0209999_1027388 3300027543 Bacteria 1055
450 Ga0209983_1003738 3300027665 Bacteria 3223
451 Ga0209588_1000540 3300027671 Bacteria 9705
452 Ga0209588_1001174 3300027671 Bacteria 6751
453 Ga0209971_1023924 3300027682 Bacteria 1458
454 Ga0209998_10024911 3300027717 Bacteria 1300
455 Ga0209974_10020883 3300027876 Bacteria 2170
456 Ga0207428_10132186 3300027907 Bacteria 1909
457 Ga0268265_10214979 3300028380 Bacteria 1678
458 Ga0268264_10035412 3300028381 Bacteria 4110
459 Ga0268264_10294066 3300028381 Unclassified 1526
460 Ga0307408_100004972 3300031548 Bacteria 8936
461 Ga0307408_100261348 3300031548 Bacteria 1433
462 Ga0316579_10023509 3300031691 Bacteria 2767
463 Ga0316579_10101587 3300031691 Unclassified 1377
464 Ga0316576_10006944 3300031727 Bacteria 7079
465 Ga0316576_10011562 3300031727 Bacteria 5792
466 Ga0316576_10035823 3300031727 Bacteria 3546
467 Ga0316576_10050538 3300031727 Bacteria 3023
468 Ga0316576_10090557 3300031727 Bacteria 2278
469 Ga0316578_10000017 3300031728 Bacteria 35606
470 Ga0316578_10010647 3300031728 Bacteria 4781
471 Ga0316578_10050500 3300031728 Bacteria 2433
472 Ga0307405_10036774 3300031731 Bacteria 2936
473 Ga0316577_10000003 3300031733 Bacteria 53158
474 Ga0316577_10002118 3300031733 Bacteria 9704
475 Ga0316577_10007440 3300031733 Bacteria 5844
476 Ga0316577_10115223 3300031733 Bacteria 1509
477 Ga0307413_10000716 3300031824 Bacteria 11383
478 Ga0307410_10318197 3300031852 Bacteria 1233
479 Ga0307410_10412419 3300031852 Unclassified 1094
480 Ga0307406_10318643 3300031901 Bacteria 1202
481 Ga0307407_10001612 3300031903 Bacteria 8331
482 Ga0307407_10229320 3300031903 Bacteria 1260
483 Ga0307412_10003480 3300031911 Bacteria 8748
484 Ga0307412_10299146 3300031911 Bacteria 1271
485 Ga0307409_100065289 3300031995 Bacteria 2863
486 Ga0307409_100066947 3300031995 Bacteria 2834
487 Ga0307409_100071862 3300031995 Bacteria 2753
488 Ga0307409_100260284 3300031995 Bacteria 1592
489 Ga0307409_100554881 3300031995 Bacteria 1128
490 Ga0307416_100005279 3300032002 Bacteria 7912
491 Ga0307416_100327212 3300032002 Bacteria 1538
492 Ga0307416_100850149 3300032002 Bacteria 1010
493 Ga0307414_10026858 3300032004 Bacteria 3710
494 Ga0307415_100005888 3300032126 Bacteria 6557
495 Ga0307415_100097715 3300032126 Bacteria 2144
496 Ga0307415_100192106 3300032126 Unclassified 1612
497 Ga0307415_100450912 3300032126 Bacteria 1112
498 Ga0316585_10041677 3300032137 Unclassified 1463
499 Ga0316580_10011701 3300032139 Bacteria 2666
500 Ga0316574_0085049 3300035398 Bacteria 2012
501 Ga0316574_0120155 3300035398 Bacteria 1687
502 Ga0316574_0249837 3300035398 Bacteria 1133
503 Ga0373933_0252966 3300035724 Bacteria 1135
504 Ga0316582_0140976 3300036647 Bacteria 1625
505 Ga0316584_0003557 3300036712 Bacteria 10169
506 Ga0316584_0023670 3300036712 Bacteria 4488
507 Ga0316584_0051195 3300036712 Bacteria 3089
508 Ga0316584_0138522 3300036712 Bacteria 1816
509 Ga0395900_0445845 3300037418 Bacteria 1251
510 Ga0395898_0465239 3300037466 Bacteria 1204
511 Ga0395905_0031961 3300037471 Bacteria 4951
512 Ga0395905_0482487 3300037471 Bacteria 1139
513 Ga0316581_0013628 3300037588 Bacteria 2307
514 Ga0395901_0011475 3300038443 Bacteria 8979
515 Ga0451577_0034290 3300042876 Bacteria 4576
516 Ga0451577_0101913 3300042876 Bacteria 2565
517 Ga0451577_0237001 3300042876 Bacteria 1651
518 Ga0453683_0011832 3300044673 Bacteria 5742
519 Ga0453683_0112178 3300044673 Bacteria 1715
520 Ga0453683_0164915 3300044673 Unclassified 1402
521 Ga0466960_0319725 3300044901 Bacteria 879
522 Ga0466959_0229853 3300045049 Bacteria 1284
523 Ga0451576_0011334 3300045051 Bacteria 10145
524 Ga0451576_0021045 3300045051 Bacteria 7096
525 Ga0451576_0053070 3300045051 Bacteria 4248
526 Ga0451576_0073539 3300045051 Bacteria 3557
527 Ga0451576_0122102 3300045051 Bacteria 2713
528 Ga0451576_0126880 3300045051 Bacteria 2658
529 Ga0451576_0198850 3300045051 Bacteria 2093
530 Ga0466958_0035235 3300045836 Bacteria 2990
531 Ga0466967_0543934 3300045976 Bacteria 1143
532 Ga0495603_0024133 3300046455 Bacteria 3677
533 Ga0495580_0203060 3300046472 Bacteria 1365
534 Ga0495584_0206830 3300046491 Bacteria 998
535 Ga0495585_0092537 3300046492 Bacteria 1627
536 Ga0495630_0433502 3300046517 Bacteria 1007
537 Ga0495663_0023024 3300046525 Unclassified 1802
538 Ga0495586_0162757 3300046535 Unclassified 1259
539 Ga0495587_0038177 3300046536 Bacteria 2881
540 Ga0495621_0004402 3300046539 Bacteria 3959
541 Ga0495621_0021287 3300046539 Bacteria 2137
542 Ga0495667_0166574 3300046559 Bacteria 1417
543 Ga0495613_0029234 3300046689 Bacteria 4099
544 Ga0495636_0028078 3300047318 Bacteria 2293
545 Ga0495675_0250367 3300047444 Bacteria 1064
546 Ga0496101_0032869 3300048904 Bacteria 3655
547 Ga0496101_0033534 3300048904 Bacteria 3622
548 Ga0496102_0160200 3300048905 Bacteria 2116
549 Ga0496104_0106956 3300048907 Bacteria 2681
550 Ga0496106_0015472 3300048909 Bacteria 5647
551 Ga0496106_0094864 3300048909 Bacteria 2307
552 Ga0496108_0119449 3300048911 Bacteria 2260
553 Ga0496112_0222015 3300048915 Bacteria 1845
554 Ga0496115_0250319 3300048918 Unclassified 1459
555 Ga0501031_0064595 3300049568 Unclassified 2384
556 Ga0501033_0103581 3300049570 Bacteria 2075
557 Ga0501036_0312140 3300049572 Unclassified 1314
558 Ga0501037_0072283 3300049573 Bacteria 2509
559 Ga0501037_0083922 3300049573 Bacteria 2308
560 Ga0501038_0686457 3300049574 Bacteria 768
561 Ga0501039_0152596 3300049575 Bacteria 1815
562 Ga0501040_0102821 3300049576 Unclassified 1994
563 Ga0501040_0120362 3300049576 Bacteria 1842
564 Ga0501041_0044520 3300049577 Bacteria 2698
565 Ga0501042_0101395 3300049578 Unclassified 2070
566 Ga0501043_0090869 3300049579 Bacteria 2401
567 Ga0501043_0129735 3300049579 Unclassified 1976
568 Ga0501043_0229013 3300049579 Unclassified 1436
569 Ga0501046_0054132 3300049580 Bacteria 3158
570 Ga0501047_0000971 3300049581 Bacteria 28888
571 Ga0501047_0118595 3300049581 Bacteria 2528
572 Ga0501048_0085704 3300049582 Bacteria 2222
573 Ga0501069_0143207 3300049585 Bacteria 1372
574 Ga0501069_0245922 3300049585 Bacteria 1043
575 Ga0501070_0016688 3300049586 Bacteria 6167
576 Ga0501070_0105531 3300049586 Bacteria 2329
577 Ga0501070_0108119 3300049586 Bacteria 2298
578 Ga0501074_0075289 3300049590 Unclassified 2423
579 Ga0501075_0155350 3300049591 Unclassified 1744
580 Ga0501076_0002889 3300049592 Bacteria 11893
581 Ga0501077_0082045 3300049593 Unclassified 2043
582 Ga0501079_0020590 3300049741 Bacteria 5043
583 Ga0501080_0237283 3300049742 Unclassified 1665
584 Ga0501080_0707769 3300049742 Bacteria 888
585 Ga0501035_0002277 3300049822 Bacteria 18971
586 Ga0501035_0328858 3300049822 Bacteria 1283
587 Ga0501044_0002874 3300049823 Bacteria 19608
588 Ga0501045_0265365 3300049824 Bacteria 1278
589 nmdc:mga05p37_244460_c1 3300050507 Bacteria 2156
590 nmdc:mga09592_166252_c1 3300050508 Bacteria 1907
591 nmdc:mga0qj67_156076_c1 3300050509 Bacteria 1852
592 nmdc:mga0qj67_906396_c1 3300050509 Bacteria 694
593 nmdc:mga06r32_82049_c1 3300050510 Bacteria 3140
594 nmdc:mga08y16_252235_c1 3300050511 Bacteria 1823
595 nmdc:mga0n895_110829_c1 3300050512 Bacteria 2761
596 nmdc:mga0n895_30262_c1 3300050512 Bacteria 5172
597 nmdc:mga0n895_30987_c1 3300050512 Bacteria 5116
598 nmdc:mga0n895_36775_c1 3300050512 Bacteria 4730
599 nmdc:mga0n895_487602_c1 3300050512 Bacteria 1243
600 nmdc:mga0n895_7446_c1 3300050512 Bacteria 9394
601 nmdc:mga0rr50_15553_c1 3300050513 Bacteria 5026
602 nmdc:mga0rr50_372292_c1 3300050513 Bacteria 1204
603 nmdc:mga0rr50_46648_c1 3300050513 Bacteria 3191
604 nmdc:mga0rr50_62684_c1 3300050513 Bacteria 2806
605 nmdc:mga08x19_100600_c1 3300050514 Bacteria 1918
606 nmdc:mga08x19_132629_c1 3300050514 Bacteria 1677
607 nmdc:mga08x19_15884_c1 3300050514 Bacteria 4585
608 nmdc:mga08x19_167508_c1 3300050514 Bacteria 1495
609 nmdc:mga08x19_226879_c1 3300050514 Bacteria 1285
610 nmdc:mga08x19_33154_c1 3300050514 Bacteria 3259
611 nmdc:mga08x19_57611_c2 3300050514 Bacteria 2184
612 nmdc:mga08x19_73578_c1 3300050514 Bacteria 2231
613 nmdc:mga08x19_87842_c1 3300050514 Bacteria 2049
614 nmdc:mga0a205_118517_c1 3300050515 Bacteria 2545
615 nmdc:mga0a205_15947_c1 3300050515 Bacteria 7030
616 nmdc:mga0a205_27789_c1 3300050515 Bacteria 5404
617 nmdc:mga0a205_55360_c1 3300050515 Bacteria 3831
618 nmdc:mga0a205_6175_c1 3300050515 Bacteria 10810
619 Ga0501084_0028554 3300054114 Bacteria 4663
620 Ga0501084_0270746 3300054114 Bacteria 1434
621 Ga0316578_10306361
622 Ga0070658_10006376
623 Ga0070658_10029990
624 Ga0070658_10056015
625 Ga0070658_10115908
626 Ga0070658_10151612
627 Ga0070658_10301867
628 Ga0070676_10001218
629 Ga0070676_10045820
630 Ga0070676_10096639
631 Ga0070683_100003200
632 Ga0070683_100003366
633 Ga0070683_100004580
634 Ga0070683_100103744
635 Ga0070683_100107162
636 Ga0070690_100010218
637 Ga0070690_100043135
638 Ga0070670_100181453
639 Ga0070670_100264348
640 Ga0070677_10017611
641 Ga0070677_10026893
642 Ga0070680_100008766
643 Ga0070680_100010696
644 Ga0070680_100041264
645 Ga0070680_100104489
646 Ga0070680_100129461
647 Ga0070680_100146489
648 Ga0070680_100260684
649 Ga0070680_100273968
650 Ga0070680_100344314
651 Ga0070680_100460636
652 Ga0070682_100272183
653 Ga0068868_100389114
654 Ga0070660_100024288
655 Ga0070660_100054114
656 Ga0070660_100119792
657 Ga0070660_100148897
658 Ga0070660_100209821
659 Ga0070687_100062634
660 Ga0070687_100099988
661 Ga0070661_100007493
662 Ga0070661_100016178
663 Ga0070661_100031025
664 Ga0070661_100042797
665 Ga0070692_10028741
666 Ga0070668_100029008
667 Ga0070668_100150064
668 Ga0070668_100226657
669 Ga0070668_100445536
670 Ga0070669_100135652
671 Ga0070675_100176253
672 Ga0070671_100051939
673 Ga0070671_100284163
674 Ga0070674_100000059
675 Ga0070674_100361733
676 Ga0070659_100161002
677 Ga0070659_100526097
678 Ga0070703_10000938
679 Ga0070703_10003381
680 Ga0070703_10005347
681 Ga0070709_10003364
682 Ga0070714_100012543
683 Ga0070714_100016210
684 Ga0070714_100056301
685 Ga0070713_100007470
686 Ga0070701_10002052
687 Ga0070711_100000023
688 Ga0070711_100155069
689 Ga0070705_100005356
690 Ga0070705_100032596
691 Ga0070705_100040058
692 Ga0070705_100063883
693 Ga0070705_100068828
694 Ga0070705_100217263
695 Ga0070705_100369109
696 Ga0070700_100070403
697 Ga0070700_100224627
698 Ga0070694_100003480
699 Ga0070694_100032587
700 Ga0070694_100071577
701 Ga0070694_100140685
702 Ga0070694_100165053
703 Ga0070708_100003739
704 Ga0070708_100004792
705 Ga0070708_100012587
706 Ga0070708_100017715
707 Ga0070708_100317669
708 Ga0070708_100328598
709 Ga0070663_100134232
710 Ga0070678_100001819
711 Ga0070678_100562080
712 Ga0070662_100001077
713 Ga0070681_10009056
714 Ga0070681_10031356
715 Ga0070681_10059849
716 Ga0070681_10066934
717 Ga0070681_10114294
718 Ga0070681_10163571
719 Ga0070681_10389421
720 Ga0068867_100017893
721 Ga0068867_100061458
722 Ga0068867_100572652
723 Ga0070685_10043225
724 Ga0070706_100019732
725 Ga0070706_100023279
726 Ga0070706_100035491
727 Ga0070706_100074158
728 Ga0070706_100128245
729 Ga0070706_100390832
730 Ga0070707_100003897
731 Ga0070707_100009248
732 Ga0070707_100115931
733 Ga0070707_100136278
734 Ga0070698_100005698
735 Ga0070698_100008988
736 Ga0070698_100388671
737 Ga0070699_100004005
738 Ga0070699_100009601
739 Ga0070699_100020510
740 Ga0070699_100049207
741 Ga0070699_100080053
742 Ga0070699_100102799
743 Ga0070699_100360512
744 Ga0070699_100448638
745 Ga0070679_100015968
746 Ga0070679_100017179
747 Ga0070679_100017275
748 Ga0070679_100025085
749 Ga0070679_100029644
750 Ga0070679_100074933
751 Ga0070679_100141868
752 Ga0070679_100146738
753 Ga0070679_100185806
754 Ga0070679_100232955
755 Ga0070679_100286911
756 Ga0070679_100563414
757 Ga0070684_100004941
758 Ga0070684_100068259
759 Ga0070697_100010500
760 Ga0070697_100064129
761 Ga0070697_100094848
762 Ga0070697_100280176
763 Ga0068853_100113204
764 Ga0068853_100181710
765 Ga0068853_100346980
766 Ga0070672_100272657
767 Ga0070686_100025124
768 Ga0070695_100001849
769 Ga0070695_100017623
770 Ga0070695_100037204
771 Ga0070695_100045411
772 Ga0070695_100054533
773 Ga0070695_100183575
774 Ga0070696_100001569
775 Ga0070696_100001843
776 Ga0070696_100003663
777 Ga0070696_100008170
778 Ga0070696_100082190
779 Ga0070696_100316709
780 Ga0070693_100039404
781 Ga0070704_100004738
782 Ga0070704_100005143
783 Ga0070704_100075500
784 Ga0070704_100141812
785 Ga0070704_100148725
786 Ga0070704_100285386
787 Ga0070704_100449575
788 Ga0068855_100047711
789 Ga0068855_100130958
790 Ga0068855_100176132
791 Ga0068855_100403349
792 Ga0070664_100008399
793 Ga0070664_100031908
794 Ga0070664_100078589
795 Ga0070664_100290206
796 Ga0068857_100001519
797 Ga0068854_100002110
798 Ga0068854_100027555
799 Ga0068856_100130697
800 Ga0068856_100314420
801 Ga0070702_100045989
802 Ga0070702_100157401
803 Ga0068852_100011290
804 Ga0068852_100037353
805 Ga0068852_100433017
806 Ga0068852_100468889
807 Ga0068859_100155568
808 Ga0068864_100002344
809 Ga0068864_100065616
810 Ga0068866_10000191
811 Ga0068861_100144146
812 Ga0068861_100342075
813 Ga0068870_10060861
814 Ga0068858_100183692
815 Ga0068860_100001544
816 Ga0068860_100090513
817 Ga0068862_100323970
818 Ga0068862_100389407
819 Ga0075432_10108620
820 Ga0070715_10065820
821 Ga0070716_100539589
822 Ga0097621_100180649
823 Ga0075428_100050762
824 Ga0075428_100165014
825 Ga0075428_100269140
826 Ga0075428_100348747
827 Ga0075430_100006336
828 Ga0075430_100268836
829 Ga0075430_100288785
830 Ga0075430_100367236
831 Ga0075431_100003201
832 Ga0075431_100249049
833 Ga0075433_10006955
834 Ga0075433_10041343
835 Ga0075433_10109842
836 Ga0075434_100006431
837 Ga0075434_100019424
838 Ga0075434_100029182
839 Ga0075434_100046892
840 Ga0075434_100246642
841 Ga0075434_100279031
842 Ga0075429_100556134
843 Ga0068865_100005025
844 Ga0075436_100007164
845 Ga0075436_100007288
846 Ga0075436_100007493
847 Ga0075436_100018530
848 Ga0075436_100019356
849 Ga0075436_100055214
850 Ga0075436_100068021
851 Ga0075436_100069010
852 Ga0075436_100119624
853 Ga0075436_100148382
854 Ga0075436_100281349
855 Ga0097620_100155573
856 Ga0075435_100002047
857 Ga0075435_100082589
858 Ga0075435_100104291
859 Ga0075435_100167423
860 Ga0075435_100172264
861 Ga0075435_100209972
862 Ga0075435_100457869
863 Ga0099794_10000140
864 Ga0099794_10022068
865 Ga0105240_10004437
866 Ga0105240_10150848
867 Ga0105240_10160544
868 Ga0105240_10249348
869 Ga0105240_10289793
870 Ga0111539_10112921
871 Ga0105245_10157408
872 Ga0105245_10235377
873 Ga0114129_10104950
874 Ga0114129_10719351
875 Ga0105243_10018895
876 Ga0105241_10033349
877 Ga0105241_10098524
878 Ga0105242_10000288
879 Ga0105248_10001971
880 Ga0105248_10129019
881 Ga0105238_10019296
882 Ga0105238_10091665
883 Ga0105249_10000187
884 Ga0105249_10046906
885 Ga0105239_10038891
886 Ga0105239_10361229
887 Ga0105246_10234228
888 Ga0157373_10000674
889 Ga0157373_10102035
890 Ga0157373_10109090
891 Ga0157373_10475894
892 Ga0157371_10183695
893 Ga0157370_10018291
894 Ga0157370_10027488
895 Ga0157370_10034964
896 Ga0157370_10053553
897 Ga0157370_10274738
898 Ga0157370_10444190
899 Ga0157369_10058320
900 Ga0157369_10073621
901 Ga0157369_10155445
902 Ga0157369_10190492
903 Ga0157369_10405180
904 Ga0157369_10738713
905 Ga0157378_10006364
906 Ga0163162_10055336
907 Ga0163162_10283502
908 Ga0163162_10613937
909 Ga0157372_10007933
910 Ga0157372_10010304
911 Ga0157372_10012913
912 Ga0157372_10015092
913 Ga0157372_10048382
914 Ga0157372_10238049
915 Ga0157375_10023419
916 Ga0157375_10070033
917 Ga0157375_10153230
918 Ga0157375_10355404
919 Ga0157380_10133317
920 Ga0157380_10344768
921 Ga0157380_10483607
922 Ga0182008_10010579
923 Ga0157377_10038627
924 Ga0157379_10032769
925 Ga0157376_10882830
926 Ga0163161_10021098
927 Ga0163161_10118245
928 Ga0207697_10043913
929 Ga0207653_10000108
930 Ga0207653_10002462
931 Ga0207653_10006477
932 Ga0207682_10030510
933 Ga0207688_10030665
934 Ga0207685_10087717
935 Ga0207699_10005071
936 Ga0207699_10035615
937 Ga0207645_10001444
938 Ga0207645_10072691
939 Ga0207643_10001464
940 Ga0207643_10062461
941 Ga0207705_10014712
942 Ga0207705_10050212
943 Ga0207705_10067319
944 Ga0207705_10091343
945 Ga0207705_10096739
946 Ga0207684_10002029
947 Ga0207684_10039891
948 Ga0207684_10054562
949 Ga0207684_10124609
950 Ga0207654_10009134
951 Ga0207654_10099735
952 Ga0207707_10006392
953 Ga0207707_10011859
954 Ga0207707_10011932
955 Ga0207707_10032579
956 Ga0207707_10050378
957 Ga0207707_10052257
958 Ga0207707_10053525
959 Ga0207707_10093462
960 Ga0207707_10202358
961 Ga0207707_10304969
962 Ga0207707_10330089
963 Ga0207695_10003486
964 Ga0207695_10037157
965 Ga0207695_10054823
966 Ga0207695_10160898
967 Ga0207663_10000085
968 Ga0207660_10000760
969 Ga0207660_10023630
970 Ga0207660_10032029
971 Ga0207660_10033190
972 Ga0207660_10047768
973 Ga0207660_10126081
974 Ga0207657_10033729
975 Ga0207657_10046589
976 Ga0207657_10176718
977 Ga0207657_10331845
978 Ga0207649_10005599
979 Ga0207649_10048229
980 Ga0207649_10144935
981 Ga0207649_10211976
982 Ga0207652_10000783
983 Ga0207652_10012958
984 Ga0207652_10013892
985 Ga0207652_10016698
986 Ga0207652_10018078
987 Ga0207652_10039039
988 Ga0207652_10326780
989 Ga0207652_10369708
990 Ga0207652_10476406
991 Ga0207646_10002990
992 Ga0207646_10003863
993 Ga0207646_10040255
994 Ga0207646_10047926
995 Ga0207646_10101568
996 Ga0207646_10228220
997 Ga0207681_10020497
998 Ga0207694_10080965
999 Ga0207659_10065964
1000 Ga0207659_10074077
1001 Ga0207687_10105252
1002 Ga0207700_10036865
1003 Ga0207664_10019612
1004 Ga0207664_10020727
1005 Ga0207664_10072632
1006 Ga0207664_10330036
1007 Ga0207706_10000154
1008 Ga0207706_10104949
1009 Ga0207686_10000088
1010 Ga0207686_10112833
1011 Ga0207709_10165921
1012 Ga0207669_10008031
1013 Ga0207669_10262790
1014 Ga0207704_10001360
1015 Ga0207704_10031974
1016 Ga0207665_10007084
1017 Ga0207665_10035323
1018 Ga0207691_10006396
1019 Ga0207691_10018122
1020 Ga0207711_10009831
1021 Ga0207711_10134811
1022 Ga0207711_10830330
1023 Ga0207689_10001413
1024 Ga0207661_10011046
1025 Ga0207661_10049449
1026 Ga0207661_10080494
1027 Ga0207661_10391820
1028 Ga0207661_10433715
1029 Ga0207679_10037324
1030 Ga0207679_10047211
1031 Ga0207679_10092895
1032 Ga0207679_10106608
1033 Ga0207667_10022677
1034 Ga0207667_10144566
1035 Ga0207667_10145918
1036 Ga0207667_10279137
1037 Ga0207712_10000356
1038 Ga0207712_10008853
1039 Ga0207712_10012348
1040 Ga0207668_10154006
1041 Ga0207668_10497588
1042 Ga0207640_10002551
1043 Ga0207640_10354096
1044 Ga0207658_10063438
1045 Ga0207658_10091440
1046 Ga0207703_10043632
1047 Ga0207703_10053802
1048 Ga0207639_10054719
1049 Ga0207639_10204154
1050 Ga0207639_10293337
1051 Ga0207678_10068427
1052 Ga0207678_10168624
1053 Ga0207708_10063350
1054 Ga0207702_10542991
1055 Ga0207641_11199321
1056 Ga0207648_10000096
1057 Ga0207648_10126436
1058 Ga0207648_10201131
1059 Ga0207676_10290560
1060 Ga0207674_10002460
1061 Ga0207674_10018169
1062 Ga0207674_10030161
1063 Ga0207675_100024896
1064 Ga0207675_100223188
1065 Ga0207683_10317813
1066 Ga0207698_10056972
1067 Ga0207698_10234738
1068 Ga0209995_1029023
1069 Ga0209999_1027388
1070 Ga0209983_1003738
1071 Ga0209588_1000540
1072 Ga0209588_1001174
1073 Ga0209971_1023924
1074 Ga0209998_10024911
1075 Ga0209974_10020883
1076 Ga0207428_10132186
1077 Ga0268265_10214979
1078 Ga0268264_10035412
1079 Ga0268264_10294066
1080 Ga0307408_100004972
1081 Ga0307408_100261348
1082 Ga0316579_10023509
1083 Ga0316579_10101587
1084 Ga0316576_10006944
1085 Ga0316576_10011562
1086 Ga0316576_10035823
1087 Ga0316576_10050538
1088 Ga0316576_10090557
1089 Ga0316578_10000017
1090 Ga0316578_10010647
1091 Ga0316578_10050500
1092 Ga0307405_10036774
1093 Ga0316577_10000003
1094 Ga0316577_10002118
1095 Ga0316577_10007440
1096 Ga0316577_10115223
1097 Ga0307413_10000716
1098 Ga0307410_10318197
1099 Ga0307410_10412419
1100 Ga0307406_10318643
1101 Ga0307407_10001612
1102 Ga0307407_10229320
1103 Ga0307412_10003480
1104 Ga0307412_10299146
1105 Ga0307409_100065289
1106 Ga0307409_100066947
1107 Ga0307409_100071862
1108 Ga0307409_100260284
1109 Ga0307409_100554881
1110 Ga0307416_100005279
1111 Ga0307416_100327212
1112 Ga0307416_100850149
1113 Ga0307414_10026858
1114 Ga0307415_100005888
1115 Ga0307415_100097715
1116 Ga0307415_100192106
1117 Ga0307415_100450912
1118 Ga0316585_10041677
1119 Ga0316580_10011701
1120 Ga0316574_0085049
1121 Ga0316574_0120155
1122 Ga0316574_0249837
1123 Ga0373933_0252966
1124 Ga0316582_0140976
1125 Ga0316584_0003557
1126 Ga0316584_0023670
1127 Ga0316584_0051195
1128 Ga0316584_0138522
1129 Ga0395900_0445845
1130 Ga0395898_0465239
1131 Ga0395905_0031961
1132 Ga0395905_0482487
1133 Ga0316581_0013628
1134 Ga0395901_0011475
1135 Ga0451577_0034290
1136 Ga0451577_0101913
1137 Ga0451577_0237001
1138 Ga0453683_0011832
1139 Ga0453683_0112178
1140 Ga0453683_0164915
1141 Ga0466960_0319725
1142 Ga0466959_0229853
1143 Ga0451576_0011334
1144 Ga0451576_0021045
1145 Ga0451576_0053070
1146 Ga0451576_0073539
1147 Ga0451576_0122102
1148 Ga0451576_0126880
1149 Ga0451576_0198850
1150 Ga0466958_0035235
1151 Ga0466967_0543934
1152 Ga0495603_0024133
1153 Ga0495580_0203060
1154 Ga0495584_0206830
1155 Ga0495585_0092537
1156 Ga0495630_0433502
1157 Ga0495663_0023024
1158 Ga0495586_0162757
1159 Ga0495587_0038177
1160 Ga0495621_0004402
1161 Ga0495621_0021287
1162 Ga0495667_0166574
1163 Ga0495613_0029234
1164 Ga0495636_0028078
1165 Ga0495675_0250367
1166 Ga0496101_0032869
1167 Ga0496101_0033534
1168 Ga0496102_0160200
1169 Ga0496104_0106956
1170 Ga0496106_0015472
1171 Ga0496106_0094864
1172 Ga0496108_0119449
1173 Ga0496112_0222015
1174 Ga0496115_0250319
1175 Ga0501031_0064595
1176 Ga0501033_0103581
1177 Ga0501036_0312140
1178 Ga0501037_0072283
1179 Ga0501037_0083922
1180 Ga0501038_0686457
1181 Ga0501039_0152596
1182 Ga0501040_0102821
1183 Ga0501040_0120362
1184 Ga0501041_0044520
1185 Ga0501042_0101395
1186 Ga0501043_0090869
1187 Ga0501043_0129735
1188 Ga0501043_0229013
1189 Ga0501046_0054132
1190 Ga0501047_0000971
1191 Ga0501047_0118595
1192 Ga0501048_0085704
1193 Ga0501069_0143207
1194 Ga0501069_0245922
1195 Ga0501070_0016688
1196 Ga0501070_0105531
1197 Ga0501070_0108119
1198 Ga0501074_0075289
1199 Ga0501075_0155350
1200 Ga0501076_0002889
1201 Ga0501077_0082045
1202 Ga0501079_0020590
1203 Ga0501080_0237283
1204 Ga0501080_0707769
1205 Ga0501035_0002277
1206 Ga0501035_0328858
1207 Ga0501044_0002874
1208 Ga0501045_0265365
1209 nmdc:mga05p37_244460_c1
1210 nmdc:mga09592_166252_c1
1211 nmdc:mga0qj67_156076_c1
1212 nmdc:mga0qj67_906396_c1
1213 nmdc:mga06r32_82049_c1
1214 nmdc:mga08y16_252235_c1
1215 nmdc:mga0n895_110829_c1
1216 nmdc:mga0n895_30262_c1
1217 nmdc:mga0n895_30987_c1
1218 nmdc:mga0n895_36775_c1
1219 nmdc:mga0n895_487602_c1
1220 nmdc:mga0n895_7446_c1
1221 nmdc:mga0rr50_15553_c1
1222 nmdc:mga0rr50_372292_c1
1223 nmdc:mga0rr50_46648_c1
1224 nmdc:mga0rr50_62684_c1
1225 nmdc:mga08x19_100600_c1
1226 nmdc:mga08x19_132629_c1
1227 nmdc:mga08x19_15884_c1
1228 nmdc:mga08x19_167508_c1
1229 nmdc:mga08x19_226879_c1
1230 nmdc:mga08x19_33154_c1
1231 nmdc:mga08x19_57611_c2
1232 nmdc:mga08x19_73578_c1
1233 nmdc:mga08x19_87842_c1
1234 nmdc:mga0a205_118517_c1
1235 nmdc:mga0a205_15947_c1
1236 nmdc:mga0a205_27789_c1
1237 nmdc:mga0a205_55360_c1
1238 nmdc:mga0a205_6175_c1
1239 Ga0501084_0028554
1240 Ga0501084_0270746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19293

CdaA_N

CdaA N-terminal transmembrane domain

11

90

0.95

PF02457

DAC

DisA bacterial checkpoint controller nucleotide-binding

119

239

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7olh-assembly3.cif.gz_L bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) 0.9764 102 222
6gyw-assembly1.cif.gz_A crystal structure of daca from staphylococcus aureus 0.9657 102 224
6gyx-assembly1.cif.gz_A crystal structure of daca from staphylococcus aureus in complex with apcpp 0.9228 92 224
6gyw-assembly1.cif.gz_B crystal structure of daca from staphylococcus aureus 0.9193 92 224
8ofo-assembly1.cif.gz_AAA structure of enterococcus faecium cdaa 0.9191 92 223
ID Description Score Start End Superfamily
af_Q2FW92_97_269_3.40.1700.10 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.9242 102 230 3.40.1700.10
6gyxA00 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.9228 92 224 3.40.1700.10
2fb5C02 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.846 83 213 3.40.1700.10
2fb5C02 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.8277 83 213 3.40.1700.10
6gyxA00 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.8161 92 224 3.40.1700.10
ID Description Score Start End GO Terms
AF-A0A1V6E563-F1-model_v4 DisA bacterial checkpoint controller nucleotide-binding protein 0.9784 102 221 GO:0004016
GO:0005524
GO:0106408
AF-T0CUF3-F1-model_v4 deleted 0.978 102 223
AF-A0A358DFQ8-F1-model_v4 TIGR00159 family protein 0.9778 103 221 GO:0004016
GO:0005524
GO:0106408
AF-J9GHU5-F1-model_v4 Protein containing DNA integrity scanning protein, DisA 0.9778 102 208 GO:0004016
GO:0005524
GO:0106408
AF-R6XTC0-F1-model_v4 deleted 0.9752 102 221

Map