F469880

General Info

Members Datasets Scaffolds Average Seq Length
620 376 566 266

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10004808|JGI25151J46595_100048086
Length 312
Sequence MTCGWPLARFCVPLFRCSVVLLASPSRFPLFLMQNPSPDSSRRRAPDALSVAVPVTPPKAGTQSSFSFKVLTVXIHKGFTFFNRKFILPELREAVRSVGADVVFLQEVTGNHVKHADKFDNYPETPHYEFLADTIWPQFAYGRNAVYTNGHHGNAVLSKFPIVRFENRDVSISGPERRGLLHCELQIPGRSVNVHAICVHLGLMEAHREQQMDMLCDLVRKDIPAHAPVVVAGDFNDWRHRAHARLEKGAELHEVFVQANGKAARTFPARLPLLRLDRIYVRNAIGHAPVVLPLRPWSHLSDHAPLAAEIEL

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
4 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
5 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
11 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
12 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
13 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221660 Methylibium sp. Root1272 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2643221683 Variovorax sp. Root473 Isolate Unclassified
18 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
19 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
20 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
23 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
24 2818991446 Variovorax sp. 1180 Isolate Unclassified
25 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
26 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
27 2842677519 Variovorax sp. R-72495 Isolate Unclassified
28 2842733646 Variovorax sp. R-72446 Isolate Unclassified
29 2842747753 Variovorax sp. R-72060 Isolate Unclassified
30 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
31 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
32 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
33 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
34 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
35 2899924645 Variovorax sp. 369 Isolate Unclassified
36 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
37 2904456579 Variovorax sp. 2002 Isolate Unclassified
38 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
39 2928037797 Variovorax sp. 1126 Isolate Unclassified
40 2928044640 Variovorax sp. 1128 Isolate Unclassified
41 2928051484 Variovorax sp. 1133 Isolate Unclassified
42 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
43 2928070936 Variovorax gossypii 1167 Isolate Unclassified
44 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
45 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
46 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
47 2929520902 Variovorax beijingensis 502 Isolate Unclassified
48 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
49 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
50 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
51 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
52 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
53 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
54 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
55 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
56 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
57 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
58 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
59 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
60 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
61 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
62 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
63 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
64 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
65 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
66 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
67 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
68 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
69 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
70 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
71 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
72 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
73 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
74 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
75 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
76 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
77 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
78 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
79 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
82 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
83 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
84 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
85 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
86 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
87 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
88 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
89 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
90 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
91 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
92 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
93 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
94 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
95 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
96 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
97 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
98 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
99 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
100 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
103 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
104 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
105 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
106 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
107 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
108 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
109 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
112 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
113 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
116 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
117 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
118 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
121 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
122 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
123 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
124 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
129 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
130 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
131 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
132 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
133 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
150 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
151 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
154 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
217 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
224 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
225 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
226 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
227 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
228 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
229 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
230 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
231 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
232 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
233 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
236 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
250 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
251 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
252 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
253 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
254 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
255 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
256 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
257 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
258 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
259 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
262 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
263 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
264 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
265 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
266 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
267 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
268 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
269 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
270 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
271 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
272 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
273 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
274 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
275 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
276 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
279 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
280 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
286 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
290 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
308 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
338 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
339 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
340 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
341 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
342 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
345 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
346 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
347 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
348 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
349 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
350 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
351 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
352 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
353 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
354 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
355 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
356 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
357 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
358 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
359 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
360 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
361 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
362 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
363 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
364 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
365 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
366 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
367 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
368 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
369 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
370 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
371 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
372 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
373 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
374 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
375 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
376 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.97
Metatranscriptomes 0.32
Isolates 8.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.61
Nodule 0.81
Rhizoplane 4.03
Rhizosphere 48.23
Stem 0
Stem Tuber 0
Unclassified 15.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1006156 3300001915 Bacteria 2440
2 JGI25155J39150_1000009 3300002704 Bacteria 224358
3 JGI25156J39149_1000009 3300002705 Bacteria 224379
4 JGI25154J39366_1000864 3300002738 Bacteria 13101
5 JGI25154J39366_1002691 3300002738 Bacteria 4339
6 JGI25157J39369_1000007 3300002741 Bacteria 224377
7 JGI25159J45721_1000314 3300002987 Bacteria 22609
8 JGI25159J45721_1004735 3300002987 Bacteria 4418
9 JGI25151J46595_10001596 3300003187 Bacteria 15058
10 JGI25151J46595_10004808 3300003187 Bacteria 7072
11 JGI25151J46595_10006401 3300003187 Bacteria 5919
12 JGI25153J46596_10005472 3300003215 Bacteria 6650
13 rootH1_10067063 3300003316 Bacteria 4038
14 rootH2_10009627 3300003320 Bacteria 1475
15 rootH2_10034396 3300003320 Bacteria 3241
16 rootL2_10008715 3300003322 Bacteria 8273
17 rootH1_10081743 3300003323 Bacteria 3489
18 JGI25160J50197_1000131 3300003354 Bacteria 67778
19 JGI25161J50226_1000009 3300003374 Bacteria 224699
20 Ga0006562J51391_1034746 3300003578 Bacteria 2998
21 Ga0055538_1000042 3300003751 Bacteria 164754
22 Ga0055539_1000055 3300003752 Bacteria 164754
23 Ga0055533_1000067 3300003756 Bacteria 164754
24 Ga0055532_1000053 3300003758 Bacteria 164751
25 Ga0055525_1000103 3300003759 Bacteria 134778
26 Ga0055527_1007239 3300003760 Bacteria 1363
27 Ga0055535_1000133 3300003761 Bacteria 79386
28 Ga0055542_1000003 3300003762 Bacteria 582721
29 Ga0055537_1000531 3300003773 Bacteria 22155
30 Ga0055537_1003327 3300003773 Bacteria 4972
31 Ga0055524_1000745 3300003775 Bacteria 22155
32 Ga0055524_1000767 3300003775 Bacteria 21616
33 Ga0055536_1000720 3300003781 Bacteria 22157
34 Ga0055536_1001424 3300003781 Bacteria 14415
35 Ga0055536_1002250 3300003781 Bacteria 10986
36 Ga0055536_1002738 3300003781 Bacteria 9757
37 Ga0055534_1000945 3300003784 Bacteria 12950
38 Ga0055534_1003354 3300003784 Bacteria 5066
39 Ga0055534_1010245 3300003784 Bacteria 1977
40 Ga0055528_1000781 3300003790 Bacteria 22139
41 Ga0055528_1007163 3300003790 Bacteria 4969
42 Ga0055530_10000155 3300003791 Bacteria 61666
43 Ga0055530_10001037 3300003791 Bacteria 22148
44 Ga0055530_10003752 3300003791 Bacteria 8390
45 Ga0055530_10005730 3300003791 Bacteria 5779
46 Ga0055530_10038202 3300003791 Bacteria 1195
47 Ga0055540_1000093 3300003792 Bacteria 98452
48 Ga0055540_1000741 3300003792 Bacteria 22148
49 Ga0055540_1001063 3300003792 Bacteria 17504
50 Ga0055540_1025407 3300003792 Bacteria 1452
51 Ga0055531_10001021 3300003794 Bacteria 22148
52 Ga0055531_10001290 3300003794 Bacteria 18878
53 Ga0055531_10001334 3300003794 Bacteria 18432
54 Ga0055541_1000042 3300003841 Bacteria 164754
55 Ga0055543_1000122 3300004625 Bacteria 65110
56 Ga0065165_1017299 3300005262 Bacteria 2661
57 Ga0065714_10065214 3300005288 Bacteria 11813
58 Ga0065707_10245734 3300005295 Bacteria 1141
59 Ga0070676_10002485 3300005328 Bacteria 9459
60 Ga0070676_10135645 3300005328 Bacteria 1561
61 Ga0070670_100000686 3300005331 Bacteria 26278
62 Ga0070670_100001050 3300005331 Bacteria 21921
63 Ga0070670_100011859 3300005331 Bacteria 7453
64 Ga0070670_100102973 3300005331 Bacteria 2459
65 Ga0070670_100252756 3300005331 Bacteria 1536
66 Ga0068869_100008447 3300005334 Bacteria 6640
67 Ga0070680_100015910 3300005336 Bacteria 5907
68 Ga0068868_100010456 3300005338 Bacteria 6720
69 Ga0070660_100031508 3300005339 Bacteria 3983
70 Ga0070661_100019013 3300005344 Bacteria 4891
71 Ga0070661_100234577 3300005344 Bacteria 1411
72 Ga0070668_100579186 3300005347 Bacteria 980
73 Ga0070668_100623216 3300005347 Bacteria 946
74 Ga0070669_100022173 3300005353 Bacteria 4542
75 Ga0070675_100026636 3300005354 Bacteria 4641
76 Ga0070675_100269434 3300005354 Bacteria 1494
77 Ga0070675_100276520 3300005354 Bacteria 1475
78 Ga0070675_100352101 3300005354 Bacteria 1306
79 Ga0070671_100007238 3300005355 Bacteria 8873
80 Ga0070674_100035958 3300005356 Bacteria 3321
81 Ga0070674_100262997 3300005356 Bacteria 1360
82 Ga0070674_100265225 3300005356 Bacteria 1355
83 Ga0070673_100009194 3300005364 Bacteria 6624
84 Ga0070659_100019633 3300005366 Bacteria 5126
85 Ga0070659_100027253 3300005366 Bacteria 4401
86 Ga0070667_100054862 3300005367 Bacteria 3365
87 Ga0070708_100582211 3300005445 Bacteria 1055
88 Ga0070663_100424534 3300005455 Bacteria 1091
89 Ga0070662_100040555 3300005457 Bacteria 3316
90 Ga0070662_100192164 3300005457 Bacteria 1615
91 Ga0070681_10088594 3300005458 Bacteria 3046
92 Ga0068867_100000004 3300005459 Bacteria 180739
93 Ga0068867_100005860 3300005459 Bacteria 8715
94 Ga0068867_100179878 3300005459 Bacteria 1681
95 Ga0070706_100004228 3300005467 Bacteria 13936
96 Ga0070707_100025621 3300005468 Bacteria 5598
97 Ga0070698_100136261 3300005471 Bacteria 2409
98 Ga0070679_100023066 3300005530 Bacteria 6088
99 Ga0068853_100020374 3300005539 Bacteria 5515
100 Ga0068853_100075499 3300005539 Bacteria 2942
101 Ga0070672_100026650 3300005543 Bacteria 4305
102 Ga0070665_100265496 3300005548 Bacteria 1718
103 Ga0068855_100010486 3300005563 Bacteria 11177
104 Ga0070664_100021980 3300005564 Bacteria 5261
105 Ga0070664_100031420 3300005564 Bacteria 4437
106 Ga0070664_100282323 3300005564 Bacteria 1497
107 Ga0068857_100038098 3300005577 Bacteria 4258
108 Ga0068854_100036610 3300005578 Bacteria 3442
109 Ga0068854_100246120 3300005578 Bacteria 1426
110 Ga0068852_100020079 3300005616 Bacteria 5306
111 Ga0068852_100202585 3300005616 Bacteria 1878
112 Ga0068851_10001057 3300005834 Bacteria 11919
113 Ga0068870_10019671 3300005840 Bacteria 3278
114 Ga0068862_100009180 3300005844 Bacteria 8192
115 Ga0075365_10077346 3300006038 Bacteria 2248
116 Ga0075365_10177479 3300006038 Bacteria 1488
117 Ga0075364_10028970 3300006051 Bacteria 3548
118 Ga0075364_10131360 3300006051 Bacteria 1681
119 Ga0075362_10111929 3300006177 Bacteria 1285
120 Ga0075362_10206263 3300006177 Bacteria 958
121 Ga0075367_10027470 3300006178 Bacteria 3238
122 Ga0075366_10001013 3300006195 Bacteria 13759
123 Ga0075366_10007139 3300006195 Bacteria 6152
124 Ga0075366_10073824 3300006195 Bacteria 2033
125 Ga0075366_10196083 3300006195 Bacteria 1228
126 Ga0075370_10001864 3300006353 Bacteria 9447
127 Ga0075370_10002054 3300006353 Bacteria 9152
128 Ga0075370_10005780 3300006353 Bacteria 6182
129 Ga0075370_10017703 3300006353 Bacteria 3853
130 Ga0075370_10026714 3300006353 Bacteria 3199
131 Ga0075370_10117912 3300006353 Bacteria 1544
132 Ga0075370_10377238 3300006353 Bacteria 849
133 Ga0068871_100299153 3300006358 Bacteria 1412
134 Ga0079104_1000138 3300006946 Bacteria 103200
135 Ga0099826_10000602 3300006948 Bacteria 18299
136 Ga0105244_10003334 3300009036 Bacteria 11540
137 Ga0105244_10007210 3300009036 Bacteria 7091
138 Ga0105250_10000691 3300009092 Bacteria 21018
139 Ga0105243_10000660 3300009148 Bacteria 34104
140 Ga0105243_10001333 3300009148 Bacteria 22028
141 Ga0105243_10008019 3300009148 Bacteria 8108
142 Ga0105243_10097697 3300009148 Bacteria 2431
143 Ga0105243_10100672 3300009148 Bacteria 2398
144 Ga0105243_10207870 3300009148 Bacteria 1721
145 Ga0105243_10445404 3300009148 Bacteria 1214
146 Ga0105248_10455718 3300009177 Bacteria 1441
147 Ga0105248_10829719 3300009177 Bacteria 1043
148 Ga0105237_10141555 3300009545 Bacteria 2399
149 Ga0105239_10049077 3300010375 Bacteria 4628
150 Ga0157347_1000943 3300012502 Bacteria 2120
151 Ga0157373_10002871 3300013100 Bacteria 13035
152 Ga0157373_10012279 3300013100 Bacteria 6296
153 Ga0157373_10035762 3300013100 Bacteria 3564
154 Ga0157371_10013100 3300013102 Bacteria 6312
155 Ga0157370_10001888 3300013104 Bacteria 25792
156 Ga0157370_10066395 3300013104 Bacteria 3412
157 Ga0157370_10209073 3300013104 Bacteria 1809
158 Ga0157369_10015740 3300013105 Bacteria 8522
159 Ga0163162_10013289 3300013306 Bacteria 8042
160 Ga0163162_10233665 3300013306 Bacteria 1969
161 Ga0163162_10488083 3300013306 Bacteria 1363
162 Ga0157375_10018063 3300013308 Bacteria 6388
163 Ga0163163_10200859 3300014325 Bacteria 2042
164 Ga0157380_10012507 3300014326 Bacteria 6159
165 Ga0182008_10000576 3300014497 Bacteria 27046
166 Ga0182008_10001595 3300014497 Bacteria 15083
167 Ga0182008_10003516 3300014497 Bacteria 9433
168 Ga0182008_10004502 3300014497 Bacteria 8137
169 Ga0182008_10027924 3300014497 Bacteria 2855
170 Ga0157377_10000010 3300014745 Bacteria 380929
171 Ga0157377_10154473 3300014745 Bacteria 1422
172 Ga0182006_1001381 3300015261 Bacteria 14767
173 Ga0182006_1010480 3300015261 Bacteria 4120
174 Ga0182007_10000214 3300015262 Bacteria 38835
175 Ga0182007_10003951 3300015262 Bacteria 6849
176 Ga0183362_10004 3300015683 Bacteria 569303
177 Ga0163161_10146045 3300017792 Bacteria 1794
178 Ga0163161_10270748 3300017792 Bacteria 1329
179 Ga0209435_100008 3300025206 Bacteria 503644
180 Ga0209435_100313 3300025206 Bacteria 11630
181 Ga0209784_100060 3300025224 Bacteria 164838
182 Ga0209566_100075 3300025225 Bacteria 164838
183 Ga0209674_100100 3300025226 Bacteria 164838
184 Ga0209672_100719 3300025228 Bacteria 16353
185 Ga0209147_100096 3300025229 Bacteria 164838
186 Ga0209563_100118 3300025230 Bacteria 131627
187 Ga0209437_108097 3300025233 Bacteria 1689
188 Ga0209258_100015 3300025242 Bacteria 706310
189 Ga0209258_100387 3300025242 Bacteria 56263
190 Ga0207425_1001469 3300025245 Bacteria 9819
191 Ga0207425_1011362 3300025245 Bacteria 2128
192 Ga0209646_1000029 3300025246 Bacteria 386414
193 Ga0209646_1000276 3300025246 Bacteria 45523
194 Ga0209026_1000016 3300025250 Bacteria 386457
195 Ga0209677_100057 3300025253 Bacteria 164838
196 Ga0209148_1000028 3300025254 Bacteria 582773
197 Ga0209759_1000016 3300025256 Bacteria 386414
198 Ga0209759_1034851 3300025256 Bacteria 935
199 Ga0209129_1000297 3300025258 Bacteria 46564
200 Ga0209129_1003087 3300025258 Bacteria 7504
201 Ga0209565_1000061 3300025263 Bacteria 185308
202 Ga0209565_1000144 3300025263 Bacteria 99074
203 Ga0209565_1001048 3300025263 Bacteria 13960
204 Ga0209565_1001227 3300025263 Bacteria 12058
205 Ga0209565_1002757 3300025263 Bacteria 6093
206 Ga0209565_1011667 3300025263 Bacteria 2127
207 Ga0209673_1000136 3300025273 Bacteria 159975
208 Ga0209673_1000396 3300025273 Bacteria 77797
209 Ga0209673_1000491 3300025273 Bacteria 65636
210 Ga0209673_1004732 3300025273 Bacteria 7164
211 Ga0209673_1042389 3300025273 Bacteria 1280
212 Ga0209130_1000014 3300025284 Bacteria 412039
213 Ga0209130_1000392 3300025284 Bacteria 47896
214 Ga0209130_1000986 3300025284 Bacteria 22204
215 Ga0209130_1007351 3300025284 Bacteria 3412
216 Ga0209675_1000071 3300025291 Bacteria 168382
217 Ga0209675_1000105 3300025291 Bacteria 121013
218 Ga0209675_1000703 3300025291 Bacteria 23088
219 Ga0209675_1003680 3300025291 Bacteria 7164
220 Ga0209675_1008294 3300025291 Bacteria 3841
221 Ga0209675_1017091 3300025291 Bacteria 2084
222 Ga0209676_1000013 3300025292 Bacteria 816080
223 Ga0209676_1000153 3300025292 Bacteria 166393
224 Ga0209676_1000167 3300025292 Bacteria 156470
225 Ga0209676_1000241 3300025292 Bacteria 117623
226 Ga0209676_1000496 3300025292 Bacteria 63126
227 Ga0209676_1005991 3300025292 Bacteria 6142
228 Ga0209676_1012832 3300025292 Bacteria 3258
229 Ga0209025_1000410 3300025294 Bacteria 86076
230 Ga0209025_1000627 3300025294 Bacteria 62581
231 Ga0209025_1000661 3300025294 Bacteria 59706
232 Ga0209025_1009005 3300025294 Bacteria 7050
233 Ga0209025_1009876 3300025294 Bacteria 6568
234 Ga0209025_1025198 3300025294 Bacteria 3036
235 Ga0209025_1037213 3300025294 Bacteria 2163
236 Ga0209025_1056584 3300025294 Bacteria 1506
237 Ga0209564_1000110 3300025295 Bacteria 212842
238 Ga0209564_1000123 3300025295 Bacteria 202487
239 Ga0209564_1000181 3300025295 Bacteria 151002
240 Ga0209564_1000247 3300025295 Bacteria 116628
241 Ga0209564_1007727 3300025295 Bacteria 5473
242 Ga0209758_1000039 3300025297 Bacteria 428951
243 Ga0209758_1002335 3300025297 Bacteria 19579
244 Ga0209758_1010275 3300025297 Bacteria 5632
245 Ga0209050_1000008 3300025298 Bacteria 1144179
246 Ga0209050_1000015 3300025298 Bacteria 759102
247 Ga0209050_1000285 3300025298 Bacteria 106573
248 Ga0209050_1000484 3300025298 Bacteria 69688
249 Ga0209050_1000665 3300025298 Bacteria 52282
250 Ga0209050_1008965 3300025298 Bacteria 5217
251 Ga0209050_1011384 3300025298 Bacteria 4226
252 Ga0209256_1000039 3300025299 Bacteria 372337
253 Ga0209256_1000074 3300025299 Bacteria 236893
254 Ga0209256_1000082 3300025299 Bacteria 221491
255 Ga0209256_1000627 3300025299 Bacteria 48553
256 Ga0207426_1000112 3300025302 Bacteria 231436
257 Ga0207426_1000121 3300025302 Bacteria 219007
258 Ga0207426_1000242 3300025302 Bacteria 122839
259 Ga0207426_1001759 3300025302 Bacteria 16401
260 Ga0209051_1000004 3300025303 Bacteria 1155596
261 Ga0209051_1000005 3300025303 Bacteria 1142353
262 Ga0209051_1000010 3300025303 Bacteria 641298
263 Ga0209051_1000081 3300025303 Bacteria 195619
264 Ga0209051_1000180 3300025303 Bacteria 113724
265 Ga0209051_1024635 3300025303 Bacteria 2468
266 Ga0209257_1000026 3300025304 Bacteria 723225
267 Ga0209257_1000031 3300025304 Bacteria 688770
268 Ga0209257_1000038 3300025304 Bacteria 609032
269 Ga0209257_1000565 3300025304 Bacteria 62766
270 Ga0209257_1004562 3300025304 Bacteria 10605
271 Ga0209257_1010064 3300025304 Bacteria 4891
272 Ga0209257_1011998 3300025304 Bacteria 4077
273 Ga0207656_10005408 3300025321 Bacteria 4511
274 Ga0207696_1000339 3300025711 Bacteria 48686
275 Ga0207655_1001161 3300025728 Bacteria 25626
276 Ga0207682_10024007 3300025893 Bacteria 2411
277 Ga0207682_10113368 3300025893 Bacteria 1196
278 Ga0207645_10001047 3300025907 Bacteria 22890
279 Ga0207643_10015932 3300025908 Bacteria 4094
280 Ga0207684_10108260 3300025910 Bacteria 2378
281 Ga0207660_10240404 3300025917 Bacteria 1426
282 Ga0207649_10016734 3300025920 Bacteria 4143
283 Ga0207646_10054700 3300025922 Bacteria 3569
284 Ga0207681_10053677 3300025923 Bacteria 2737
285 Ga0207694_10017236 3300025924 Bacteria 5458
286 Ga0207650_10000278 3300025925 Bacteria 53364
287 Ga0207650_10000324 3300025925 Bacteria 46570
288 Ga0207650_10053364 3300025925 Bacteria 2996
289 Ga0207650_10098789 3300025925 Bacteria 2243
290 Ga0207650_10213585 3300025925 Bacteria 1550
291 Ga0207659_10096189 3300025926 Bacteria 2222
292 Ga0207659_10097561 3300025926 Bacteria 2208
293 Ga0207659_10246542 3300025926 Bacteria 1447
294 Ga0207687_10011653 3300025927 Bacteria 5747
295 Ga0207644_10008031 3300025931 Bacteria 6903
296 Ga0207690_10000831 3300025932 Bacteria 19793
297 Ga0207690_10069140 3300025932 Bacteria 2429
298 Ga0207706_10034320 3300025933 Bacteria 4514
299 Ga0207706_10049084 3300025933 Bacteria 3731
300 Ga0207706_10301278 3300025933 Bacteria 1397
301 Ga0207709_10000438 3300025935 Bacteria 39257
302 Ga0207709_10000895 3300025935 Bacteria 22511
303 Ga0207709_10001037 3300025935 Bacteria 20521
304 Ga0207709_10001829 3300025935 Bacteria 14203
305 Ga0207709_10044923 3300025935 Bacteria 2672
306 Ga0207709_10275202 3300025935 Bacteria 1241
307 Ga0207669_10042004 3300025937 Bacteria 2666
308 Ga0207691_10037655 3300025940 Bacteria 4478
309 Ga0207691_10561316 3300025940 Bacteria 968
310 Ga0207711_10740164 3300025941 Bacteria 917
311 Ga0207661_10052866 3300025944 Bacteria 3248
312 Ga0207661_10054497 3300025944 Bacteria 3204
313 Ga0207679_10000629 3300025945 Bacteria 23458
314 Ga0207679_10028463 3300025945 Bacteria 3878
315 Ga0207679_10036045 3300025945 Bacteria 3505
316 Ga0207679_10128960 3300025945 Bacteria 2026
317 Ga0207667_10030913 3300025949 Bacteria 5787
318 Ga0207651_10020643 3300025960 Bacteria 3982
319 Ga0207640_10070623 3300025981 Bacteria 2349
320 Ga0207640_10267229 3300025981 Bacteria 1336
321 Ga0207658_10067427 3300025986 Bacteria 2695
322 Ga0207677_10038114 3300026023 Bacteria 3148
323 Ga0207639_10045961 3300026041 Bacteria 3292
324 Ga0207639_10105551 3300026041 Bacteria 2286
325 Ga0207639_10578020 3300026041 Bacteria 1034
326 Ga0207678_10351296 3300026067 Bacteria 1272
327 Ga0207648_10000002 3300026089 Bacteria 307909
328 Ga0207648_10010248 3300026089 Bacteria 8901
329 Ga0207674_10017241 3300026116 Bacteria 7879
330 Ga0207674_10064682 3300026116 Bacteria 3689
331 Ga0207674_10552416 3300026116 Bacteria 1112
332 Ga0207683_10347641 3300026121 Unclassified 1361
333 Ga0209281_1000023 3300027111 Bacteria 519955
334 Ga0209282_1001014 3300027666 Bacteria 14766
335 Ga0209974_10046757 3300027876 Bacteria 1448
336 Ga0268266_10052801 3300028379 Bacteria 3491
337 Ga0268266_10687648 3300028379 Bacteria 986
338 Ga0268265_10013608 3300028380 Bacteria 5532
339 Ga0307517_10009384 3300028786 Bacteria 13860
340 Ga0307517_10061150 3300028786 Bacteria 3569
341 Ga0307515_10000374 3300028794 Bacteria 109304
342 Ga0307515_10000585 3300028794 Bacteria 85580
343 Ga0307515_10004409 3300028794 Bacteria 29143
344 Ga0307515_10086104 3300028794 Bacteria 4010
345 Ga0307515_10101239 3300028794 Bacteria 3480
346 Ga0307515_10169879 3300028794 Bacteria 2179
347 Ga0307515_10249837 3300028794 Bacteria 1528
348 Ga0307511_10126332 3300030521 Bacteria 1559
349 Ga0307512_10042144 3300030522 Bacteria 3784
350 Ga0316177_1125066 3300030731 Bacteria 4050
351 Ga0316176_1125671 3300030732 Bacteria 3639
352 Ga0314311_1145075 3300030733 Bacteria 7382
353 Ga0316178_1137182 3300030735 Bacteria 4608
354 Ga0316180_1140543 3300030736 Bacteria 10132
355 Ga0316183_1031124 3300030742 Bacteria 6967
356 Ga0316181_1056362 3300030744 Bacteria 4614
357 Ga0307513_10000363 3300031456 Bacteria 66311
358 Ga0307513_10002839 3300031456 Bacteria 23740
359 Ga0307513_10020161 3300031456 Bacteria 7911
360 Ga0307513_10022805 3300031456 Bacteria 7346
361 Ga0307513_10034853 3300031456 Bacteria 5640
362 Ga0307513_10177769 3300031456 Bacteria 1996
363 Ga0307509_10218832 3300031507 Bacteria 1720
364 Ga0307408_100006099 3300031548 Bacteria 8014
365 Ga0307508_10001752 3300031616 Bacteria 24086
366 Ga0307508_10001778 3300031616 Bacteria 23959
367 Ga0307514_10003197 3300031649 Bacteria 15995
368 Ga0307514_10034102 3300031649 Bacteria 4057
369 Ga0307514_10088115 3300031649 Bacteria 2272
370 Ga0265342_10104260 3300031712 Bacteria 1612
371 Ga0307516_10000432 3300031730 Bacteria 55006
372 Ga0307516_10007238 3300031730 Bacteria 12786
373 Ga0307516_10007622 3300031730 Bacteria 12398
374 Ga0307516_10174133 3300031730 Bacteria 1890
375 Ga0307516_10187650 3300031730 Bacteria 1796
376 Ga0307516_10195243 3300031730 Bacteria 1747
377 Ga0307405_10192694 3300031731 Bacteria 1473
378 Ga0307405_10654448 3300031731 Bacteria 864
379 Ga0307410_10393811 3300031852 Bacteria 1117
380 Ga0307406_10043596 3300031901 Bacteria 2807
381 Ga0307406_10321785 3300031901 Bacteria 1197
382 Ga0307412_10030876 3300031911 Bacteria 3378
383 Ga0307416_100165913 3300032002 Bacteria 2048
384 Ga0307414_10307651 3300032004 Bacteria 1344
385 Ga0307414_10398417 3300032004 Bacteria 1195
386 Ga0307411_10093870 3300032005 Bacteria 2102
387 Ga0307415_100216161 3300032126 Bacteria 1533
388 Ga0395898_0085604 3300037466 Bacteria 3038
389 Ga0395905_0030319 3300037471 Bacteria 5097
390 Ga0395905_0721785 3300037471 Bacteria 899
391 Ga0439436_0000577 3300041404 Bacteria 9708
392 Ga0439461_0058005 3300041410 Bacteria 874
393 Ga0439466_0005485 3300041411 Bacteria 4844
394 Ga0439466_0043234 3300041411 Bacteria 1497
395 Ga0439465_0004086 3300041413 Bacteria 4745
396 Ga0451797_1402468 3300041453 Bacteria 2799
397 Ga0451795_1609977 3300041456 Bacteria 1867
398 Ga0451798_0974092 3300041458 Bacteria 1197
399 Ga0451802_1291151 3300041460 Bacteria 1754
400 Ga0451807_0945747 3300041486 Bacteria 1052
401 Ga0451833_1449534 3300041491 Bacteria 1008
402 Ga0451851_0502449 3300041507 Bacteria 1955
403 Ga0451853_0849379 3300041512 Bacteria 1095
404 Ga0439431_0009932 3300041997 Bacteria 2155
405 Ga0439431_0022070 3300041997 Bacteria 1532
406 Ga0439445_0010557 3300042004 Bacteria 2189
407 Ga0439449_0013756 3300042007 Bacteria 3045
408 Ga0450911_000269 3300042115 Bacteria 19395
409 Ga0450919_000255 3300042121 Bacteria 6111
410 Ga0450920_023133 3300042122 Bacteria 1204
411 Ga0450921_000010 3300042123 Bacteria 4774
412 Ga0450922_002601 3300042124 Bacteria 1686
413 Ga0450923_009380 3300042125 Bacteria 1710
414 Ga0450890_005365 3300042127 Bacteria 1650
415 Ga0450891_004231 3300042129 Bacteria 1350
416 Ga0450896_007953 3300042133 Bacteria 1466
417 Ga0450906_000177 3300042145 Bacteria 11915
418 Ga0450910_001389 3300042147 Bacteria 3039
419 Ga0450908_000284 3300042184 Bacteria 10029
420 Ga0450909_004267 3300042185 Bacteria 2039
421 Ga0439434_0001778 3300042435 Bacteria 6265
422 Ga0439434_0055081 3300042435 Bacteria 1238
423 Ga0450893_0002079 3300042532 Bacteria 3117
424 Ga0495627_004467 3300046453 Bacteria 5851
425 Ga0495590_0011562 3300046457 Bacteria 3296
426 Ga0495638_0008100 3300046460 Bacteria 7473
427 Ga0495638_0156897 3300046460 Bacteria 1316
428 Ga0495639_0003270 3300046475 Bacteria 7037
429 Ga0495583_0001282 3300046506 Bacteria 26263
430 Ga0495610_0004885 3300046512 Bacteria 9745
431 Ga0495610_0066383 3300046512 Bacteria 1699
432 Ga0495616_0001568 3300046513 Bacteria 15754
433 Ga0495620_0003841 3300046515 Bacteria 8563
434 Ga0495631_0000004 3300046518 Bacteria 159706
435 Ga0495632_0001652 3300046519 Bacteria 18276
436 Ga0495632_0104152 3300046519 Bacteria 1336
437 Ga0495632_0105328 3300046519 Bacteria 1327
438 Ga0495637_0012316 3300046520 Bacteria 4095
439 Ga0495654_0003251 3300046530 Bacteria 10025
440 Ga0495654_0003266 3300046530 Bacteria 9999
441 Ga0495654_0003434 3300046530 Bacteria 9712
442 Ga0495586_0256543 3300046535 Bacteria 998
443 Ga0495609_0104177 3300046538 Bacteria 1228
444 Ga0495621_0002367 3300046539 Bacteria 5067
445 Ga0495621_0003922 3300046539 Bacteria 4135
446 Ga0495621_0014308 3300046539 Bacteria 2509
447 Ga0495621_0022691 3300046539 Bacteria 2083
448 Ga0495656_0007178 3300046615 Bacteria 3932
449 Ga0495668_0036801 3300046616 Bacteria 2741
450 Ga0495668_0086498 3300046616 Bacteria 1719
451 Ga0495625_0001405 3300046660 Bacteria 29481
452 Ga0495588_0003846 3300046674 Bacteria 6580
453 Ga0495588_0016176 3300046674 Bacteria 3602
454 Ga0495588_0034944 3300046674 Bacteria 2545
455 Ga0495658_0018269 3300046683 Bacteria 3642
456 Ga0495624_0024245 3300046690 Bacteria 3994
457 Ga0495670_0058771 3300046691 Bacteria 1930
458 Ga0495671_0001138 3300046692 Bacteria 18320
459 Ga0495649_0005163 3300046694 Bacteria 8372
460 Ga0495660_0035915 3300046810 Bacteria 2766
461 Ga0495660_0044478 3300046810 Bacteria 2442
462 Ga0495660_0076794 3300046810 Bacteria 1759
463 Ga0495604_0422391 3300047317 Bacteria 875
464 Ga0495676_0077602 3300047321 Bacteria 2532
465 Ga0495687_001439 3300047443 Bacteria 21864
466 Ga0495677_0072579 3300047445 Bacteria 1284
467 Ga0495681_0040262 3300047470 Bacteria 2277
468 Ga0495686_0001324 3300047472 Bacteria 27731
469 Ga0495686_0115323 3300047472 Bacteria 1607
470 Ga0495593_0000598 3300047673 Bacteria 20528
471 Ga0495614_0049802 3300048089 Bacteria 1795
472 Ga0495614_0086853 3300048089 Bacteria 1358
473 Ga0495615_0008575 3300048090 Bacteria 1982
474 Ga0496100_0004722 3300048903 Bacteria 7264
475 Ga0496101_0040256 3300048904 Bacteria 3328
476 Ga0496102_0000706 3300048905 Bacteria 33087
477 Ga0496102_0003775 3300048905 Bacteria 12805
478 Ga0496102_0012945 3300048905 Bacteria 7224
479 Ga0496103_0015323 3300048906 Bacteria 4560
480 Ga0496103_0099165 3300048906 Bacteria 1843
481 Ga0496104_0004468 3300048907 Bacteria 12184
482 Ga0496105_0016042 3300048908 Bacteria 5975
483 Ga0496107_0041542 3300048910 Bacteria 3302
484 Ga0496109_0202561 3300048912 Bacteria 1866
485 Ga0496114_0101262 3300048917 Bacteria 2459
486 Ga0496114_0171631 3300048917 Bacteria 1890
487 Ga0496114_0233896 3300048917 Bacteria 1615
488 Ga0496117_0004392 3300048920 Bacteria 15622
489 Ga0496118_0008367 3300048921 Bacteria 10701
490 Ga0496118_0023238 3300048921 Bacteria 5390
491 Ga0496118_0045244 3300048921 Bacteria 3438
492 Ga0496119_0053573 3300048922 Bacteria 2463
493 Ga0496121_0006359 3300048924 Bacteria 14720
494 Ga0496121_0030332 3300048924 Bacteria 4967
495 Ga0496122_0035479 3300048925 Bacteria 4056
496 Ga0496122_0072657 3300048925 Bacteria 2444
497 Ga0496122_0090371 3300048925 Bacteria 2090
498 Ga0496123_0048696 3300048926 Bacteria 2848
499 Ga0496123_0099622 3300048926 Bacteria 1696
500 Ga0496124_0010062 3300048927 Bacteria 9648
501 Ga0496124_0010612 3300048927 Bacteria 9309
502 Ga0496125_0013523 3300048928 Bacteria 8019
503 Ga0496125_0019514 3300048928 Bacteria 6391
504 Ga0496125_0026306 3300048928 Bacteria 5306
505 Ga0496126_0012012 3300048929 Bacteria 8899
506 Ga0496126_0098644 3300048929 Bacteria 2559
507 Ga0501308_007473 3300049128 Bacteria 1145
508 Ga0495678_063637 3300049459 Bacteria 1377
509 Ga0501043_0000071 3300049579 Bacteria 89105
510 Ga0501046_0000311 3300049580 Bacteria 48905
511 Ga0501047_0000087 3300049581 Bacteria 117516
512 Ga0501048_0000226 3300049582 Bacteria 37156
513 Ga0501248_005014 3300049678 Bacteria 1025
514 Ga0501249_001626 3300049679 Bacteria 4593
515 Ga0501225_0001971 3300049705 Bacteria 6413
516 Ga0501241_022096 3300049758 Bacteria 1174
517 Ga0501262_003655 3300049759 Bacteria 1771
518 Ga0501265_011992 3300049762 Bacteria 1076
519 Ga0501045_0009015 3300049824 Bacteria 6969
520 nmdc:mga03683_169068_c1 3300050489 Bacteria 993
521 nmdc:mga03683_21935_c1 3300050489 Bacteria 2469
522 nmdc:mga03683_3922_c1 3300050489 Bacteria 4866
523 nmdc:mga03n38_193078_c1 3300050490 Bacteria 1050
524 nmdc:mga03n38_70880_c1 3300050490 Bacteria 1613
525 nmdc:mga0k408_52510_c1 3300050493 Bacteria 2362
526 nmdc:mga0k408_76349_c1 3300050493 Bacteria 1958
527 nmdc:mga06z11_113638_c1 3300050494 Bacteria 1502
528 nmdc:mga07m45_1068_c1 3300050496 Bacteria 12200
529 nmdc:mga07m45_127127_c1 3300050496 Bacteria 1474
530 nmdc:mga07m45_1331_c1 3300050496 Bacteria 11255
531 nmdc:mga07m45_13831_c1 3300050496 Bacteria 4288
532 nmdc:mga07m45_51509_c1 3300050496 Bacteria 2322
533 nmdc:mga07m45_59709_c1 3300050496 Bacteria 2158
534 nmdc:mga0sz30_19810_c1 3300050516 Bacteria 2707
535 Ga0500610_0000623 3300053079 Bacteria 10848
536 Ga0500610_0022859 3300053079 Bacteria 3088
537 Ga0500644_0015506 3300053088 Bacteria 2175
538 Ga0500651_0000079 3300053093 Bacteria 62532
539 Ga0500651_0004907 3300053093 Bacteria 7566
540 Ga0500566_0002061 3300053094 Bacteria 11875
541 Ga0500562_032310 3300053108 Bacteria 1381
542 Ga0500569_035346 3300053109 Bacteria 1432
543 Ga0500571_000018 3300053110 Bacteria 61068
544 Ga0500593_000059 3300053117 Bacteria 40547
545 Ga0500593_012853 3300053117 Bacteria 3560
546 Ga0500594_0004945 3300053118 Bacteria 2946
547 Ga0500597_021070 3300053120 Bacteria 2569
548 Ga0500655_000774 3300053133 Bacteria 6296
549 Ga0500658_0000057 3300053134 Bacteria 55697
550 Ga0500658_0000456 3300053134 Bacteria 17434
551 Ga0500559_0006069 3300053136 Bacteria 5478
552 Ga0500559_0015915 3300053136 Bacteria 3175
553 Ga0500568_0035770 3300053139 Bacteria 2024
554 Ga0500568_0101380 3300053139 Bacteria 1080
555 Ga0500574_031600 3300053141 Bacteria 1427
556 Ga0500586_057179 3300053145 Bacteria 1353
557 Ga0500616_0020477 3300053153 Bacteria 3715
558 Ga0500619_000101 3300053154 Bacteria 22906
559 Ga0500627_0006385 3300053158 Bacteria 4012
560 Ga0500634_0060278 3300053161 Bacteria 2015
561 Ga0500634_0113864 3300053161 Bacteria 1329
562 Ga0500638_004202 3300053162 Bacteria 5498
563 Ga0500645_000346 3300053730 Bacteria 33036
564 Ga0500645_005051 3300053730 Bacteria 4932
565 Ga0500661_011135 3300055283 Bacteria 1630
566 Ga0590075_019775 3300059424 Bacteria 1673

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10009627 rootH2_100096272 204
2 3300005459 Ga0068867_100179878 Ga0068867_1001798782 234
3 3300032004 Ga0307414_10398417 Ga0307414_103984171 234
4 3300049128 Ga0501308_007473 Ga0501308_007473_396_1121 237
5 3300026121 Ga0207683_10347641 Ga0207683_103476412 238
6 3300042127 Ga0450890_005365 Ga0450890_005365_232_1038 240
7 3300006353 Ga0075370_10002054 Ga0075370_100020543 244
8 3300028794 Ga0307515_10101239 Ga0307515_101012392 244
9 3300031456 Ga0307513_10002839 Ga0307513_100028392 244
10 3300025944 Ga0207661_10052866 Ga0207661_100528662 245
11 3300005336 Ga0070680_100015910 Ga0070680_1000159103 246
12 3300005458 Ga0070681_10088594 Ga0070681_100885942 246
13 3300005530 Ga0070679_100023066 Ga0070679_1000230665 246
14 3300037466 Ga0395898_0085604 Ga0395898_0085604_926_1762 246
15 3300005295 Ga0065707_10245734 Ga0065707_102457341 247
16 3300005347 Ga0070668_100579186 Ga0070668_1005791861 247
17 3300017792 Ga0163161_10270748 Ga0163161_102707482 247
18 3300025940 Ga0207691_10561316 Ga0207691_105613162 247
19 3300005563 Ga0068855_100010486 Ga0068855_1000104863 248
20 3300005577 Ga0068857_100038098 Ga0068857_1000380982 248
21 3300005616 Ga0068852_100202585 Ga0068852_1002025852 248
22 3300006038 Ga0075365_10077346 Ga0075365_100773461 248
23 3300009545 Ga0105237_10141555 Ga0105237_101415552 248
24 3300010375 Ga0105239_10049077 Ga0105239_100490775 248
25 3300013100 Ga0157373_10012279 Ga0157373_100122797 248
26 3300013104 Ga0157370_10066395 Ga0157370_100663952 248
27 3300013105 Ga0157369_10015740 Ga0157369_100157406 248
28 3300025949 Ga0207667_10030913 Ga0207667_100309133 248
29 3300025981 Ga0207640_10267229 Ga0207640_102672292 248
30 3300026041 Ga0207639_10105551 Ga0207639_101055511 248
31 3300028794 Ga0307515_10169879 Ga0307515_101698792 248
32 3300031712 Ga0265342_10104260 Ga0265342_101042601 248
33 3300031730 Ga0307516_10000432 Ga0307516_1000043248 248
34 3300037471 Ga0395905_0721785 Ga0395905_0721785_50_817 248
35 3300042435 Ga0439434_0055081 Ga0439434_0055081_459_1223 248
36 3300049678 Ga0501248_005014 Ga0501248_005014_129_890 248
37 iso_pu_bacteria 2643221660 2644339564 248
38 3300002704 JGI25155J39150_1000009 JGI25155J39150_10000097 249
39 3300002705 JGI25156J39149_1000009 JGI25156J39149_1000009213 249
40 3300002738 JGI25154J39366_1000864 JGI25154J39366_10008647 249
41 3300002741 JGI25157J39369_1000007 JGI25157J39369_1000007213 249
42 3300003784 Ga0055534_1010245 Ga0055534_10102452 249
43 3300003791 Ga0055530_10000155 Ga0055530_1000015510 249
44 3300006038 Ga0075365_10177479 Ga0075365_101774792 249
45 3300006195 Ga0075366_10196083 Ga0075366_101960832 249
46 3300013104 Ga0157370_10001888 Ga0157370_1000188820 249
47 3300014497 Ga0182008_10001595 Ga0182008_100015955 249
48 3300025206 Ga0209435_100008 Ga0209435_100008120 249
49 3300025246 Ga0209646_1000029 Ga0209646_1000029158 249
50 3300025250 Ga0209026_1000016 Ga0209026_1000016158 249
51 3300025256 Ga0209759_1000016 Ga0209759_1000016158 249
52 3300028794 Ga0307515_10000374 Ga0307515_1000037427 249
53 3300028794 Ga0307515_10000585 Ga0307515_1000058517 249
54 3300030522 Ga0307512_10042144 Ga0307512_100421443 249
55 3300031507 Ga0307509_10218832 Ga0307509_102188322 249
56 3300031616 Ga0307508_10001778 Ga0307508_1000177812 249
57 3300031649 Ga0307514_10003197 Ga0307514_1000319711 249
58 3300041512 Ga0451853_0849379 Ga0451853_0849379_141_917 249
59 3300048905 Ga0496102_0003775 Ga0496102_0003775_9600_10361 249
60 3300053136 Ga0500559_0015915 Ga0500559_0015915_1405_2175 249
61 3300059424 Ga0590075_019775 Ga0590075_019775_545_1357 249
62 iso_pu_bacteria 2842677519 2842682554 249
63 iso_pu_bacteria 2842733646 2842737192 249
64 iso_pu_bacteria 2842747753 2842750432 249
65 iso_pu_bacteria 2904449895 2904451346 249
66 iso_pu_bacteria 2904456579 2904458208 249
67 iso_pu_bacteria 2919462493 2919466667 249
68 iso_pu_bacteria 2929520902 2929526177 249
69 iso_pu_bacteria 2945945610 2945950731 249
70 iso_pu_bacteria 2945972063 2945974643 249
71 3300002987 JGI25159J45721_1000314 JGI25159J45721_100031417 250
72 3300003354 JGI25160J50197_1000131 JGI25160J50197_100013162 250
73 3300003374 JGI25161J50226_1000009 JGI25161J50226_100000910 250
74 3300004625 Ga0055543_1000122 Ga0055543_100012233 250
75 3300005328 Ga0070676_10135645 Ga0070676_101356452 250
76 3300005331 Ga0070670_100102973 Ga0070670_1001029732 250
77 3300005331 Ga0070670_100252756 Ga0070670_1002527562 250
78 3300005347 Ga0070668_100623216 Ga0070668_1006232161 250
79 3300005353 Ga0070669_100022173 Ga0070669_1000221732 250
80 3300005354 Ga0070675_100269434 Ga0070675_1002694342 250
81 3300005356 Ga0070674_100035958 Ga0070674_1000359583 250
82 3300005356 Ga0070674_100262997 Ga0070674_1002629972 250
83 3300005356 Ga0070674_100265225 Ga0070674_1002652251 250
84 3300005457 Ga0070662_100192164 Ga0070662_1001921641 250
85 3300005459 Ga0068867_100000004 Ga0068867_100000004106 250
86 3300005616 Ga0068852_100020079 Ga0068852_1000200794 250
87 3300006177 Ga0075362_10206263 Ga0075362_102062631 250
88 3300006353 Ga0075370_10377238 Ga0075370_103772381 250
89 3300009148 Ga0105243_10000660 Ga0105243_100006607 250
90 3300009148 Ga0105243_10207870 Ga0105243_102078702 250
91 3300009177 Ga0105248_10829719 Ga0105248_108297192 250
92 3300014326 Ga0157380_10012507 Ga0157380_100125074 250
93 3300014745 Ga0157377_10000010 Ga0157377_10000010167 250
94 3300025284 Ga0209130_1000014 Ga0209130_1000014217 250
95 3300025302 Ga0207426_1000242 Ga0207426_1000242104 250
96 3300025893 Ga0207682_10024007 Ga0207682_100240072 250
97 3300025917 Ga0207660_10240404 Ga0207660_102404042 250
98 3300025923 Ga0207681_10053677 Ga0207681_100536772 250
99 3300025925 Ga0207650_10098789 Ga0207650_100987892 250
100 3300025925 Ga0207650_10213585 Ga0207650_102135852 250
101 3300025926 Ga0207659_10246542 Ga0207659_102465422 250
102 3300025933 Ga0207706_10301278 Ga0207706_103012782 250
103 3300025935 Ga0207709_10000895 Ga0207709_100008957 250
104 3300025937 Ga0207669_10042004 Ga0207669_100420043 250
105 3300025941 Ga0207711_10740164 Ga0207711_107401641 250
106 3300025944 Ga0207661_10054497 Ga0207661_100544972 250
107 3300026089 Ga0207648_10000002 Ga0207648_10000002104 250
108 3300026116 Ga0207674_10552416 Ga0207674_105524161 250
109 3300028786 Ga0307517_10009384 Ga0307517_1000938413 250
110 3300028794 Ga0307515_10004409 Ga0307515_1000440929 250
111 3300028794 Ga0307515_10249837 Ga0307515_102498371 250
112 3300031456 Ga0307513_10022805 Ga0307513_100228055 250
113 3300031456 Ga0307513_10034853 Ga0307513_100348534 250
114 3300031456 Ga0307513_10177769 Ga0307513_101777692 250
115 3300031616 Ga0307508_10001752 Ga0307508_1000175224 250
116 3300031649 Ga0307514_10088115 Ga0307514_100881152 250
117 3300031730 Ga0307516_10007622 Ga0307516_100076222 250
118 3300031730 Ga0307516_10174133 Ga0307516_101741332 250
119 3300031730 Ga0307516_10187650 Ga0307516_101876501 250
120 3300031730 Ga0307516_10195243 Ga0307516_101952432 250
121 3300031901 Ga0307406_10321785 Ga0307406_103217851 250
122 3300037471 Ga0395905_0030319 Ga0395905_0030319_1064_1834 250
123 3300041453 Ga0451797_1402468 Ga0451797_1402468_1047_1811 250
124 3300041456 Ga0451795_1609977 Ga0451795_1609977_965_1729 250
125 3300041460 Ga0451802_1291151 Ga0451802_1291151_671_1435 250
126 3300041486 Ga0451807_0945747 Ga0451807_0945747_14_778 250
127 3300041491 Ga0451833_1449534 Ga0451833_1449534_93_857 250
128 3300041507 Ga0451851_0502449 Ga0451851_0502449_751_1515 250
129 3300042115 Ga0450911_000269 Ga0450911_000269_6434_7207 250
130 3300042129 Ga0450891_004231 Ga0450891_004231_163_936 250
131 3300046519 Ga0495632_0105328 Ga0495632_0105328_61_825 250
132 3300046539 Ga0495621_0002367 Ga0495621_0002367_2319_3083 250
133 3300046539 Ga0495621_0022691 Ga0495621_0022691_1224_1988 250
134 3300047472 Ga0495686_0115323 Ga0495686_0115323_483_1247 250
135 3300048905 Ga0496102_0000706 Ga0496102_0000706_31574_32338 250
136 3300048924 Ga0496121_0006359 Ga0496121_0006359_8533_9306 250
137 3300048927 Ga0496124_0010062 Ga0496124_0010062_4002_4775 250
138 3300048928 Ga0496125_0019514 Ga0496125_0019514_5258_6031 250
139 3300048928 Ga0496125_0026306 Ga0496125_0026306_3655_4428 250
140 3300048929 Ga0496126_0098644 Ga0496126_0098644_1144_1917 250
141 3300049762 Ga0501265_011992 Ga0501265_011992_147_926 250
142 3300050489 nmdc:mga03683_21935_c1 nmdc:mga03683_21935_c1_40_942 250
143 3300050490 nmdc:mga03n38_70880_c1 nmdc:mga03n38_70880_c1_440_1204 250
144 3300050496 nmdc:mga07m45_51509_c1 nmdc:mga07m45_51509_c1_498_1262 250
145 3300053117 Ga0500593_012853 Ga0500593_012853_903_1937 250
146 3300053139 Ga0500568_0101380 Ga0500568_0101380_265_1038 250
147 3300053153 Ga0500616_0020477 Ga0500616_0020477_1248_2021 250
148 3300053154 Ga0500619_000101 Ga0500619_000101_19501_20265 250
149 iso_pu_bacteria 2643221644 2644244966 250
150 3300005262 Ga0065165_1017299 Ga0065165_10172992 251
151 3300005339 Ga0070660_100031508 Ga0070660_1000315083 251
152 3300005344 Ga0070661_100019013 Ga0070661_1000190135 251
153 3300005366 Ga0070659_100019633 Ga0070659_1000196333 251
154 3300005564 Ga0070664_100021980 Ga0070664_1000219805 251
155 3300005564 Ga0070664_100031420 Ga0070664_1000314202 251
156 3300006177 Ga0075362_10111929 Ga0075362_101119291 251
157 3300006353 Ga0075370_10005780 Ga0075370_100057802 251
158 3300006948 Ga0099826_10000602 Ga0099826_100006029 251
159 3300009148 Ga0105243_10097697 Ga0105243_100976973 251
160 3300009148 Ga0105243_10100672 Ga0105243_101006722 251
161 3300013100 Ga0157373_10002871 Ga0157373_1000287110 251
162 3300014497 Ga0182008_10000576 Ga0182008_1000057623 251
163 3300014497 Ga0182008_10027924 Ga0182008_100279242 251
164 3300014745 Ga0157377_10154473 Ga0157377_101544731 251
165 3300025263 Ga0209565_1000144 Ga0209565_100014429 251
166 3300025273 Ga0209673_1000136 Ga0209673_100013680 251
167 3300025291 Ga0209675_1000071 Ga0209675_100007180 251
168 3300025294 Ga0209025_1025198 Ga0209025_10251983 251
169 3300025920 Ga0207649_10016734 Ga0207649_100167345 251
170 3300025932 Ga0207690_10000831 Ga0207690_100008314 251
171 3300025935 Ga0207709_10275202 Ga0207709_102752022 251
172 3300025945 Ga0207679_10000629 Ga0207679_1000062916 251
173 3300025945 Ga0207679_10128960 Ga0207679_101289602 251
174 3300027666 Ga0209282_1001014 Ga0209282_100101415 251
175 3300027876 Ga0209974_10046757 Ga0209974_100467572 251
176 3300028379 Ga0268266_10687648 Ga0268266_106876481 251
177 3300028794 Ga0307515_10086104 Ga0307515_100861042 251
178 3300031456 Ga0307513_10000363 Ga0307513_1000036310 251
179 3300031456 Ga0307513_10020161 Ga0307513_100201615 251
180 3300031852 Ga0307410_10393811 Ga0307410_103938111 251
181 3300032004 Ga0307414_10307651 Ga0307414_103076512 251
182 3300041404 Ga0439436_0000577 Ga0439436_0000577_8328_9110 251
183 3300041410 Ga0439461_0058005 Ga0439461_0058005_37_819 251
184 3300041411 Ga0439466_0005485 Ga0439466_0005485_1117_1899 251
185 3300041411 Ga0439466_0043234 Ga0439466_0043234_472_1254 251
186 3300041413 Ga0439465_0004086 Ga0439465_0004086_718_1500 251
187 3300041997 Ga0439431_0009932 Ga0439431_0009932_814_1596 251
188 3300042004 Ga0439445_0010557 Ga0439445_0010557_1379_2161 251
189 3300042007 Ga0439449_0013756 Ga0439449_0013756_993_1775 251
190 3300042121 Ga0450919_000255 Ga0450919_000255_2716_3504 251
191 3300042122 Ga0450920_023133 Ga0450920_023133_331_1113 251
192 3300042123 Ga0450921_000010 Ga0450921_000010_375_1157 251
193 3300042124 Ga0450922_002601 Ga0450922_002601_429_1217 251
194 3300042125 Ga0450923_009380 Ga0450923_009380_362_1144 251
195 3300042133 Ga0450896_007953 Ga0450896_007953_613_1395 251
196 3300042145 Ga0450906_000177 Ga0450906_000177_7078_7860 251
197 3300042147 Ga0450910_001389 Ga0450910_001389_212_994 251
198 3300042184 Ga0450908_000284 Ga0450908_000284_4742_5524 251
199 3300042185 Ga0450909_004267 Ga0450909_004267_170_952 251
200 3300042435 Ga0439434_0001778 Ga0439434_0001778_476_1258 251
201 3300042532 Ga0450893_0002079 Ga0450893_0002079_338_1120 251
202 3300046460 Ga0495638_0156897 Ga0495638_0156897_217_990 251
203 3300046519 Ga0495632_0104152 Ga0495632_0104152_493_1266 251
204 3300046674 Ga0495588_0034944 Ga0495588_0034944_1592_2374 251
205 3300047472 Ga0495686_0001324 Ga0495686_0001324_7050_7817 251
206 3300049679 Ga0501249_001626 Ga0501249_001626_106_888 251
207 3300049705 Ga0501225_0001971 Ga0501225_0001971_3768_4550 251
208 3300049758 Ga0501241_022096 Ga0501241_022096_130_912 251
209 3300049759 Ga0501262_003655 Ga0501262_003655_333_1115 251
210 3300050489 nmdc:mga03683_169068_c1 nmdc:mga03683_169068_c1_190_972 251
211 3300050494 nmdc:mga06z11_113638_c1 nmdc:mga06z11_113638_c1_570_1352 251
212 3300050496 nmdc:mga07m45_1068_c1 nmdc:mga07m45_1068_c1_7900_8682 251
213 3300050516 nmdc:mga0sz30_19810_c1 nmdc:mga0sz30_19810_c1_935_1717 251
214 3300053145 Ga0500586_057179 Ga0500586_057179_301_1083 251
215 3300055283 Ga0500661_011135 Ga0500661_011135_479_1405 251
216 iso_pu_bacteria 2643221683 2644465713 251
217 3300002987 JGI25159J45721_1004735 JGI25159J45721_10047353 252
218 3300003187 JGI25151J46595_10001596 JGI25151J46595_100015964 252
219 3300003187 JGI25151J46595_10006401 JGI25151J46595_100064012 252
220 3300003773 Ga0055537_1000531 Ga0055537_100053118 252
221 3300003775 Ga0055524_1000745 Ga0055524_100074518 252
222 3300003775 Ga0055524_1000767 Ga0055524_10007672 252
223 3300003781 Ga0055536_1000720 Ga0055536_100072018 252
224 3300003784 Ga0055534_1003354 Ga0055534_10033541 252
225 3300003790 Ga0055528_1000781 Ga0055528_10007814 252
226 3300003791 Ga0055530_10001037 Ga0055530_1000103718 252
227 3300003791 Ga0055530_10003752 Ga0055530_100037524 252
228 3300003791 Ga0055530_10038202 Ga0055530_100382022 252
229 3300003792 Ga0055540_1000093 Ga0055540_100009371 252
230 3300003792 Ga0055540_1000741 Ga0055540_100074118 252
231 3300003794 Ga0055531_10001021 Ga0055531_1000102118 252
232 3300003794 Ga0055531_10001290 Ga0055531_1000129012 252
233 3300005539 Ga0068853_100075499 Ga0068853_1000754994 252
234 3300005844 Ga0068862_100009180 Ga0068862_1000091803 252
235 3300006946 Ga0079104_1000138 Ga0079104_100013874 252
236 3300009148 Ga0105243_10008019 Ga0105243_100080193 252
237 3300009177 Ga0105248_10455718 Ga0105248_104557182 252
238 3300013306 Ga0163162_10013289 Ga0163162_100132897 252
239 3300013306 Ga0163162_10233665 Ga0163162_102336652 252
240 3300014325 Ga0163163_10200859 Ga0163163_102008592 252
241 3300025263 Ga0209565_1000061 Ga0209565_1000061108 252
242 3300025263 Ga0209565_1011667 Ga0209565_10116672 252
243 3300025273 Ga0209673_1000491 Ga0209673_100049110 252
244 3300025284 Ga0209130_1000986 Ga0209130_100098618 252
245 3300025291 Ga0209675_1000105 Ga0209675_100010578 252
246 3300025291 Ga0209675_1017091 Ga0209675_10170912 252
247 3300025292 Ga0209676_1000013 Ga0209676_1000013572 252
248 3300025292 Ga0209676_1000153 Ga0209676_1000153142 252
249 3300025294 Ga0209025_1009876 Ga0209025_10098762 252
250 3300025295 Ga0209564_1000181 Ga0209564_1000181124 252
251 3300025295 Ga0209564_1007727 Ga0209564_10077274 252
252 3300025297 Ga0209758_1010275 Ga0209758_10102755 252
253 3300025298 Ga0209050_1000008 Ga0209050_1000008572 252
254 3300025298 Ga0209050_1000665 Ga0209050_100066523 252
255 3300025298 Ga0209050_1008965 Ga0209050_10089654 252
256 3300025299 Ga0209256_1000039 Ga0209256_1000039171 252
257 3300025299 Ga0209256_1000627 Ga0209256_100062719 252
258 3300025302 Ga0207426_1001759 Ga0207426_10017599 252
259 3300025303 Ga0209051_1000004 Ga0209051_1000004426 252
260 3300025303 Ga0209051_1000005 Ga0209051_1000005572 252
261 3300025304 Ga0209257_1000031 Ga0209257_1000031162 252
262 3300025304 Ga0209257_1000038 Ga0209257_1000038560 252
263 3300025304 Ga0209257_1011998 Ga0209257_10119982 252
264 3300026041 Ga0207639_10045961 Ga0207639_100459611 252
265 3300027111 Ga0209281_1000023 Ga0209281_1000023458 252
266 3300028380 Ga0268265_10013608 Ga0268265_100136081 252
267 3300030731 Ga0316177_1125066 Ga0316177_11250664 252
268 3300030732 Ga0316176_1125671 Ga0316176_11256713 252
269 3300030733 Ga0314311_1145075 Ga0314311_11450753 252
270 3300030735 Ga0316178_1137182 Ga0316178_11371824 252
271 3300030736 Ga0316180_1140543 Ga0316180_11405437 252
272 3300030742 Ga0316183_1031124 Ga0316183_10311244 252
273 3300030744 Ga0316181_1056362 Ga0316181_10563622 252
274 3300031649 Ga0307514_10034102 Ga0307514_100341024 252
275 3300031731 Ga0307405_10192694 Ga0307405_101926942 252
276 3300031911 Ga0307412_10030876 Ga0307412_100308762 252
277 3300032002 Ga0307416_100165913 Ga0307416_1001659132 252
278 3300032126 Ga0307415_100216161 Ga0307415_1002161612 252
279 3300046453 Ga0495627_004467 Ga0495627_004467_2759_3544 252
280 3300046475 Ga0495639_0003270 Ga0495639_0003270_5339_6124 252
281 3300046512 Ga0495610_0066383 Ga0495610_0066383_670_1455 252
282 3300046515 Ga0495620_0003841 Ga0495620_0003841_3979_4764 252
283 3300046535 Ga0495586_0256543 Ga0495586_0256543_137_922 252
284 3300046539 Ga0495621_0014308 Ga0495621_0014308_1285_2070 252
285 3300046615 Ga0495656_0007178 Ga0495656_0007178_535_1320 252
286 3300046616 Ga0495668_0086498 Ga0495668_0086498_603_1388 252
287 3300046660 Ga0495625_0001405 Ga0495625_0001405_13971_14756 252
288 3300046674 Ga0495588_0003846 Ga0495588_0003846_4866_5651 252
289 3300046674 Ga0495588_0016176 Ga0495588_0016176_1323_2108 252
290 3300046692 Ga0495671_0001138 Ga0495671_0001138_8483_9268 252
291 3300046810 Ga0495660_0076794 Ga0495660_0076794_701_1486 252
292 3300047317 Ga0495604_0422391 Ga0495604_0422391_61_846 252
293 3300047445 Ga0495677_0072579 Ga0495677_0072579_288_1073 252
294 3300047470 Ga0495681_0040262 Ga0495681_0040262_1313_2098 252
295 3300048089 Ga0495614_0086853 Ga0495614_0086853_46_831 252
296 3300048090 Ga0495615_0008575 Ga0495615_0008575_581_1366 252
297 3300048903 Ga0496100_0004722 Ga0496100_0004722_2343_3128 252
298 3300048904 Ga0496101_0040256 Ga0496101_0040256_1496_2281 252
299 3300048905 Ga0496102_0012945 Ga0496102_0012945_5685_6470 252
300 3300048906 Ga0496103_0015323 Ga0496103_0015323_3665_4450 252
301 3300048907 Ga0496104_0004468 Ga0496104_0004468_7135_7920 252
302 3300048908 Ga0496105_0016042 Ga0496105_0016042_842_1627 252
303 3300048910 Ga0496107_0041542 Ga0496107_0041542_107_892 252
304 3300048912 Ga0496109_0202561 Ga0496109_0202561_235_1020 252
305 3300048917 Ga0496114_0101262 Ga0496114_0101262_686_1471 252
306 3300048917 Ga0496114_0171631 Ga0496114_0171631_849_1640 252
307 3300048917 Ga0496114_0233896 Ga0496114_0233896_333_1118 252
308 3300050489 nmdc:mga03683_3922_c1 nmdc:mga03683_3922_c1_1729_2514 252
309 3300050490 nmdc:mga03n38_193078_c1 nmdc:mga03n38_193078_c1_214_999 252
310 3300050496 nmdc:mga07m45_1331_c1 nmdc:mga07m45_1331_c1_8355_9140 252
311 3300053079 Ga0500610_0000623 Ga0500610_0000623_9095_9880 252
312 3300053079 Ga0500610_0022859 Ga0500610_0022859_667_1452 252
313 3300053088 Ga0500644_0015506 Ga0500644_0015506_1012_1998 252
314 3300053109 Ga0500569_035346 Ga0500569_035346_276_1061 252
315 3300053117 Ga0500593_000059 Ga0500593_000059_30653_31438 252
316 3300053158 Ga0500627_0006385 Ga0500627_0006385_2665_3450 252
317 3300053161 Ga0500634_0113864 Ga0500634_0113864_334_1119 252
318 3300053730 Ga0500645_005051 Ga0500645_005051_3239_4174 252
319 iso_pu_bacteria 2928115317 2928116691 252
320 3300003187 JGI25151J46595_10004808 JGI25151J46595_100048086 253
321 3300003322 rootL2_10008715 rootL2_100087153 253
322 3300003781 Ga0055536_1001424 Ga0055536_10014249 253
323 3300005578 Ga0068854_100246120 Ga0068854_1002461202 253
324 3300006051 Ga0075364_10131360 Ga0075364_101313602 253
325 3300009148 Ga0105243_10001333 Ga0105243_100013338 253
326 3300012502 Ga0157347_1000943 Ga0157347_10009432 253
327 3300025292 Ga0209676_1000241 Ga0209676_100024193 253
328 3300025294 Ga0209025_1000661 Ga0209025_100066118 253
329 3300025294 Ga0209025_1056584 Ga0209025_10565842 253
330 3300025298 Ga0209050_1011384 Ga0209050_10113842 253
331 3300025303 Ga0209051_1000180 Ga0209051_100018065 253
332 3300025935 Ga0207709_10000438 Ga0207709_100004389 253
333 3300025935 Ga0207709_10001829 Ga0207709_100018295 253
334 3300031731 Ga0307405_10654448 Ga0307405_106544481 253
335 3300032005 Ga0307411_10093870 Ga0307411_100938702 253
336 3300041458 Ga0451798_0974092 Ga0451798_0974092_382_1185 253
337 iso_pu_bacteria 2513020051 2513229861 253
338 iso_pu_bacteria 2643221658 2644327268 253
339 iso_pu_bacteria 2643221672 2644401872 253
340 iso_pu_bacteria 2928084124 2928085381 253
341 iso_pu_bacteria 2929160207 2929160217 253
342 3300005354 Ga0070675_100276520 Ga0070675_1002765202 254
343 3300005354 Ga0070675_100352101 Ga0070675_1003521012 254
344 3300005367 Ga0070667_100054862 Ga0070667_1000548624 254
345 3300005445 Ga0070708_100582211 Ga0070708_1005822111 254
346 3300005467 Ga0070706_100004228 Ga0070706_10000422816 254
347 3300005468 Ga0070707_100025621 Ga0070707_1000256214 254
348 3300005471 Ga0070698_100136261 Ga0070698_1001362612 254
349 3300005564 Ga0070664_100282323 Ga0070664_1002823232 254
350 3300006178 Ga0075367_10027470 Ga0075367_100274702 254
351 3300006195 Ga0075366_10007139 Ga0075366_100071399 254
352 3300006195 Ga0075366_10073824 Ga0075366_100738242 254
353 3300006353 Ga0075370_10001864 Ga0075370_100018642 254
354 3300006353 Ga0075370_10026714 Ga0075370_100267142 254
355 3300014497 Ga0182008_10004502 Ga0182008_100045026 254
356 3300015261 Ga0182006_1010480 Ga0182006_10104804 254
357 3300015262 Ga0182007_10003951 Ga0182007_100039512 254
358 3300015683 Ga0183362_10004 Ga0183362_10004269 254
359 3300025893 Ga0207682_10113368 Ga0207682_101133681 254
360 3300025910 Ga0207684_10108260 Ga0207684_101082602 254
361 3300025922 Ga0207646_10054700 Ga0207646_100547003 254
362 3300025986 Ga0207658_10067427 Ga0207658_100674272 254
363 3300026067 Ga0207678_10351296 Ga0207678_103512962 254
364 3300050493 nmdc:mga0k408_76349_c1 nmdc:mga0k408_76349_c1_1085_1876 254
365 3300050496 nmdc:mga07m45_59709_c1 nmdc:mga07m45_59709_c1_231_1022 254
366 iso_pu_bacteria 2597489888 2597866252 254
367 iso_pu_bacteria 2597489889 2597872087 254
368 iso_pu_bacteria 2599185189 2599509739 254
369 iso_pu_bacteria 2599185214 2599621515 254
370 iso_pu_bacteria 2599185226 2599670801 254
371 iso_pu_bacteria 2599185227 2599679291 254
372 iso_pu_bacteria 2599185229 2599691026 254
373 iso_pu_bacteria 2599185303 2599951889 254
374 iso_pu_bacteria 2600255296 2601693811 254
375 iso_pu_bacteria 2643221571 2643870802 254
376 iso_pu_bacteria 2643221713 2644621310 254
377 iso_pu_bacteria 2675903420 2677899051 254
378 iso_pu_bacteria 2721755607 2723250988 254
379 iso_pu_bacteria 2831265667 2831268673 254
380 iso_pu_bacteria 2838054893 2838058103 254
381 iso_pu_bacteria 2842826826 2842829022 254
382 iso_pu_bacteria 2842837860 2842840539 254
383 iso_pu_bacteria 2860867994 2860872649 254
384 iso_pu_bacteria 2928070936 2928072173 254
385 iso_pu_bacteria 2946027586 2946033253 254
386 iso_pu_bacteria 2947233263 2947234041 254
387 iso_pu_bacteria 8054347763 8054352897 254
388 iso_pu_bacteria 8056148874 8056151871 254
389 3300003781 Ga0055536_1002738 Ga0055536_100273811 255
390 3300003791 Ga0055530_10005730 Ga0055530_100057302 255
391 3300003792 Ga0055540_1001063 Ga0055540_100106310 255
392 3300003794 Ga0055531_10001334 Ga0055531_1000133410 255
393 3300005344 Ga0070661_100234577 Ga0070661_1002345772 255
394 3300005366 Ga0070659_100027253 Ga0070659_1000272534 255
395 3300005548 Ga0070665_100265496 Ga0070665_1002654962 255
396 3300005578 Ga0068854_100036610 Ga0068854_1000366103 255
397 3300006353 Ga0075370_10017703 Ga0075370_100177034 255
398 3300006353 Ga0075370_10117912 Ga0075370_101179122 255
399 3300006358 Ga0068871_100299153 Ga0068871_1002991531 255
400 3300009036 Ga0105244_10007210 Ga0105244_100072106 255
401 3300014497 Ga0182008_10003516 Ga0182008_100035165 255
402 3300015261 Ga0182006_1001381 Ga0182006_100138111 255
403 3300015262 Ga0182007_10000214 Ga0182007_1000021411 255
404 3300017792 Ga0163161_10146045 Ga0163161_101460452 255
405 3300025245 Ga0207425_1001469 Ga0207425_10014696 255
406 3300025258 Ga0209129_1000297 Ga0209129_100029742 255
407 3300025284 Ga0209130_1000392 Ga0209130_100039215 255
408 3300025292 Ga0209676_1000496 Ga0209676_100049614 255
409 3300025292 Ga0209676_1005991 Ga0209676_10059916 255
410 3300025294 Ga0209025_1000410 Ga0209025_100041022 255
411 3300025294 Ga0209025_1000627 Ga0209025_100062745 255
412 3300025295 Ga0209564_1000110 Ga0209564_1000110188 255
413 3300025297 Ga0209758_1000039 Ga0209758_1000039188 255
414 3300025298 Ga0209050_1000484 Ga0209050_100048452 255
415 3300025299 Ga0209256_1000074 Ga0209256_1000074188 255
416 3300025302 Ga0207426_1000121 Ga0207426_1000121187 255
417 3300025303 Ga0209051_1000081 Ga0209051_1000081180 255
418 3300025304 Ga0209257_1000565 Ga0209257_100056513 255
419 3300025304 Ga0209257_1004562 Ga0209257_10045628 255
420 3300025728 Ga0207655_1001161 Ga0207655_100116121 255
421 3300025924 Ga0207694_10017236 Ga0207694_100172364 255
422 3300025932 Ga0207690_10069140 Ga0207690_100691403 255
423 3300025935 Ga0207709_10001037 Ga0207709_1000103717 255
424 3300025945 Ga0207679_10028463 Ga0207679_100284632 255
425 3300025981 Ga0207640_10070623 Ga0207640_100706232 255
426 3300026041 Ga0207639_10578020 Ga0207639_105780202 255
427 3300026116 Ga0207674_10064682 Ga0207674_100646823 255
428 3300031548 Ga0307408_100006099 Ga0307408_1000060994 255
429 3300046460 Ga0495638_0008100 Ga0495638_0008100_3982_4776 255
430 3300046513 Ga0495616_0001568 Ga0495616_0001568_720_1514 255
431 3300046518 Ga0495631_0000004 Ga0495631_0000004_42486_43280 255
432 3300046520 Ga0495637_0012316 Ga0495637_0012316_991_1785 255
433 3300046530 Ga0495654_0003251 Ga0495654_0003251_7539_8333 255
434 3300046539 Ga0495621_0003922 Ga0495621_0003922_2055_2849 255
435 3300046616 Ga0495668_0036801 Ga0495668_0036801_405_1199 255
436 3300046691 Ga0495670_0058771 Ga0495670_0058771_1099_1893 255
437 3300048906 Ga0496103_0099165 Ga0496103_0099165_135_929 255
438 3300048921 Ga0496118_0023238 Ga0496118_0023238_2216_3010 255
439 3300048925 Ga0496122_0090371 Ga0496122_0090371_745_1539 255
440 3300048927 Ga0496124_0010612 Ga0496124_0010612_724_1518 255
441 3300048928 Ga0496125_0013523 Ga0496125_0013523_1213_2007 255
442 3300050496 nmdc:mga07m45_13831_c1 nmdc:mga07m45_13831_c1_304_1098 255
443 3300053108 Ga0500562_032310 Ga0500562_032310_384_1178 255
444 3300053118 Ga0500594_0004945 Ga0500594_0004945_376_1170 255
445 3300053134 Ga0500658_0000057 Ga0500658_0000057_53689_54483 255
446 3300053136 Ga0500559_0006069 Ga0500559_0006069_1817_2611 255
447 3300053139 Ga0500568_0035770 Ga0500568_0035770_1063_1857 255
448 3300053141 Ga0500574_031600 Ga0500574_031600_556_1350 255
449 iso_pu_bacteria 2738541307 2738883563 255
450 iso_pu_bacteria 2808606385 2808977468 255
451 iso_pu_bacteria 2808606388 2808992874 255
452 iso_pu_bacteria 2852612431 2852618030 255
453 iso_pu_bacteria 2852667396 2852673088 255
454 iso_pu_bacteria 8054503363 8054508536 255
455 3300003215 JGI25153J46596_10005472 JGI25153J46596_100054727 256
456 3300003773 Ga0055537_1003327 Ga0055537_10033275 256
457 3300003781 Ga0055536_1002250 Ga0055536_100225010 256
458 3300003790 Ga0055528_1007163 Ga0055528_10071635 256
459 3300005328 Ga0070676_10002485 Ga0070676_100024856 256
460 3300005331 Ga0070670_100011859 Ga0070670_1000118595 256
461 3300005334 Ga0068869_100008447 Ga0068869_1000084475 256
462 3300005338 Ga0068868_100010456 Ga0068868_1000104562 256
463 3300005354 Ga0070675_100026636 Ga0070675_1000266364 256
464 3300005355 Ga0070671_100007238 Ga0070671_1000072384 256
465 3300005364 Ga0070673_100009194 Ga0070673_1000091942 256
466 3300005455 Ga0070663_100424534 Ga0070663_1004245341 256
467 3300005457 Ga0070662_100040555 Ga0070662_1000405552 256
468 3300005459 Ga0068867_100005860 Ga0068867_1000058605 256
469 3300005543 Ga0070672_100026650 Ga0070672_1000266502 256
470 3300005840 Ga0068870_10019671 Ga0068870_100196713 256
471 3300025258 Ga0209129_1003087 Ga0209129_10030873 256
472 3300025263 Ga0209565_1001048 Ga0209565_10010486 256
473 3300025263 Ga0209565_1002757 Ga0209565_10027574 256
474 3300025273 Ga0209673_1000396 Ga0209673_100039615 256
475 3300025273 Ga0209673_1004732 Ga0209673_10047324 256
476 3300025291 Ga0209675_1003680 Ga0209675_10036804 256
477 3300025292 Ga0209676_1000167 Ga0209676_100016767 256
478 3300025294 Ga0209025_1009005 Ga0209025_10090054 256
479 3300025295 Ga0209564_1000123 Ga0209564_1000123155 256
480 3300025297 Ga0209758_1002335 Ga0209758_100233514 256
481 3300025298 Ga0209050_1000015 Ga0209050_1000015532 256
482 3300025298 Ga0209050_1000285 Ga0209050_100028540 256
483 3300025299 Ga0209256_1000082 Ga0209256_1000082173 256
484 3300025302 Ga0207426_1000112 Ga0207426_100011228 256
485 3300025303 Ga0209051_1000010 Ga0209051_1000010532 256
486 3300025304 Ga0209257_1000026 Ga0209257_1000026145 256
487 3300025907 Ga0207645_10001047 Ga0207645_1000104714 256
488 3300025908 Ga0207643_10015932 Ga0207643_100159324 256
489 3300025925 Ga0207650_10053364 Ga0207650_100533642 256
490 3300025926 Ga0207659_10096189 Ga0207659_100961891 256
491 3300025926 Ga0207659_10097561 Ga0207659_100975612 256
492 3300025927 Ga0207687_10011653 Ga0207687_100116532 256
493 3300025931 Ga0207644_10008031 Ga0207644_100080314 256
494 3300025933 Ga0207706_10034320 Ga0207706_100343203 256
495 3300025933 Ga0207706_10049084 Ga0207706_100490843 256
496 3300025935 Ga0207709_10044923 Ga0207709_100449232 256
497 3300025940 Ga0207691_10037655 Ga0207691_100376554 256
498 3300025945 Ga0207679_10036045 Ga0207679_100360453 256
499 3300025960 Ga0207651_10020643 Ga0207651_100206434 256
500 3300026023 Ga0207677_10038114 Ga0207677_100381142 256
501 3300026089 Ga0207648_10010248 Ga0207648_100102485 256
502 3300026116 Ga0207674_10017241 Ga0207674_100172416 256
503 3300031901 Ga0307406_10043596 Ga0307406_100435962 256
504 3300046683 Ga0495658_0018269 Ga0495658_0018269_389_1189 256
505 3300046690 Ga0495624_0024245 Ga0495624_0024245_2506_3306 256
506 3300047321 Ga0495676_0077602 Ga0495676_0077602_694_1494 256
507 3300047673 Ga0495593_0000598 Ga0495593_0000598_16420_17220 256
508 3300048089 Ga0495614_0049802 Ga0495614_0049802_476_1276 256
509 3300048922 Ga0496119_0053573 Ga0496119_0053573_375_1151 256
510 3300050493 nmdc:mga0k408_52510_c1 nmdc:mga0k408_52510_c1_257_1105 256
511 3300050496 nmdc:mga07m45_127127_c1 nmdc:mga07m45_127127_c1_523_1323 256
512 3300053093 Ga0500651_0000079 Ga0500651_0000079_5371_6171 256
513 3300053094 Ga0500566_0002061 Ga0500566_0002061_10875_11675 256
514 3300053110 Ga0500571_000018 Ga0500571_000018_22507_23307 256
515 3300053120 Ga0500597_021070 Ga0500597_021070_1017_1817 256
516 3300053133 Ga0500655_000774 Ga0500655_000774_4864_5664 256
517 3300053134 Ga0500658_0000456 Ga0500658_0000456_1238_2038 256
518 3300053161 Ga0500634_0060278 Ga0500634_0060278_297_1097 256
519 3300053162 Ga0500638_004202 Ga0500638_004202_4647_5447 256
520 iso_pu_bacteria 2511231002 2511242693 256
521 iso_pu_bacteria 2818991446 2819597681 256
522 iso_pu_bacteria 2899924645 2899929100 256
523 iso_pu_bacteria 2928037797 2928040465 256
524 iso_pu_bacteria 2928044640 2928046786 256
525 iso_pu_bacteria 2928051484 2928058025 256
526 iso_pu_bacteria 2928064002 2928067634 256
527 3300003578 Ga0006562J51391_1034746 Ga0006562J51391_10347464 257
528 3300005539 Ga0068853_100020374 Ga0068853_1000203742 257
529 3300013104 Ga0157370_10209073 Ga0157370_102090732 257
530 3300013306 Ga0163162_10488083 Ga0163162_104880832 257
531 3300041997 Ga0439431_0022070 Ga0439431_0022070_248_1039 257
532 3300048921 Ga0496118_0008367 Ga0496118_0008367_5742_6587 257
533 3300048925 Ga0496122_0035479 Ga0496122_0035479_734_1570 257
534 3300048926 Ga0496123_0099622 Ga0496123_0099622_833_1678 257
535 3300049459 Ga0495678_063637 Ga0495678_063637_183_1019 257
536 3300049579 Ga0501043_0000071 Ga0501043_0000071_17302_18096 257
537 3300049580 Ga0501046_0000311 Ga0501046_0000311_17300_18094 257
538 3300049581 Ga0501047_0000087 Ga0501047_0000087_99242_100036 257
539 3300049582 Ga0501048_0000226 Ga0501048_0000226_34999_35793 257
540 3300049824 Ga0501045_0009015 Ga0501045_0009015_81_875 257
541 3300002738 JGI25154J39366_1002691 JGI25154J39366_10026912 258
542 3300003316 rootH1_10067063 rootH1_100670634 258
543 3300003320 rootH2_10034396 rootH2_100343964 258
544 3300003323 rootH1_10081743 rootH1_100817435 258
545 3300003751 Ga0055538_1000042 Ga0055538_1000042117 258
546 3300003752 Ga0055539_1000055 Ga0055539_1000055117 258
547 3300003756 Ga0055533_1000067 Ga0055533_1000067117 258
548 3300003758 Ga0055532_1000053 Ga0055532_1000053117 258
549 3300003759 Ga0055525_1000103 Ga0055525_100010319 258
550 3300003760 Ga0055527_1007239 Ga0055527_10072391 258
551 3300003761 Ga0055535_1000133 Ga0055535_100013378 258
552 3300003762 Ga0055542_1000003 Ga0055542_1000003370 258
553 3300003784 Ga0055534_1000945 Ga0055534_10009452 258
554 3300003792 Ga0055540_1025407 Ga0055540_10254071 258
555 3300003841 Ga0055541_1000042 Ga0055541_100004260 258
556 3300005331 Ga0070670_100000686 Ga0070670_10000068611 258
557 3300005834 Ga0068851_10001057 Ga0068851_100010575 258
558 3300006195 Ga0075366_10001013 Ga0075366_100010133 258
559 3300009092 Ga0105250_10000691 Ga0105250_100006915 258
560 3300009148 Ga0105243_10445404 Ga0105243_104454041 258
561 3300013100 Ga0157373_10035762 Ga0157373_100357623 258
562 3300013102 Ga0157371_10013100 Ga0157371_100131006 258
563 3300025206 Ga0209435_100313 Ga0209435_1003135 258
564 3300025224 Ga0209784_100060 Ga0209784_10006061 258
565 3300025225 Ga0209566_100075 Ga0209566_10007561 258
566 3300025226 Ga0209674_100100 Ga0209674_10010061 258
567 3300025228 Ga0209672_100719 Ga0209672_1007199 258
568 3300025229 Ga0209147_100096 Ga0209147_10009661 258
569 3300025230 Ga0209563_100118 Ga0209563_100118114 258
570 3300025233 Ga0209437_108097 Ga0209437_1080972 258
571 3300025242 Ga0209258_100015 Ga0209258_100015489 258
572 3300025242 Ga0209258_100387 Ga0209258_10038761 258
573 3300025245 Ga0207425_1011362 Ga0207425_10113622 258
574 3300025246 Ga0209646_1000276 Ga0209646_100027646 258
575 3300025253 Ga0209677_100057 Ga0209677_10005761 258
576 3300025254 Ga0209148_1000028 Ga0209148_1000028180 258
577 3300025256 Ga0209759_1034851 Ga0209759_10348511 258
578 3300025263 Ga0209565_1001227 Ga0209565_10012276 258
579 3300025273 Ga0209673_1042389 Ga0209673_10423892 258
580 3300025284 Ga0209130_1007351 Ga0209130_10073511 258
581 3300025291 Ga0209675_1000703 Ga0209675_100070311 258
582 3300025291 Ga0209675_1008294 Ga0209675_10082944 258
583 3300025292 Ga0209676_1012832 Ga0209676_10128321 258
584 3300025294 Ga0209025_1037213 Ga0209025_10372133 258
585 3300025295 Ga0209564_1000247 Ga0209564_100024717 258
586 3300025303 Ga0209051_1024635 Ga0209051_10246351 258
587 3300025304 Ga0209257_1010064 Ga0209257_10100644 258
588 3300025321 Ga0207656_10005408 Ga0207656_100054084 258
589 3300025711 Ga0207696_1000339 Ga0207696_100033914 258
590 3300025925 Ga0207650_10000324 Ga0207650_1000032430 258
591 3300028379 Ga0268266_10052801 Ga0268266_100528013 258
592 3300031730 Ga0307516_10007238 Ga0307516_100072388 258
593 3300046457 Ga0495590_0011562 Ga0495590_0011562_2283_3161 258
594 3300046506 Ga0495583_0001282 Ga0495583_0001282_7986_8762 258
595 3300046519 Ga0495632_0001652 Ga0495632_0001652_4707_5585 258
596 3300046530 Ga0495654_0003266 Ga0495654_0003266_1223_1999 258
597 3300046538 Ga0495609_0104177 Ga0495609_0104177_129_1007 258
598 3300046694 Ga0495649_0005163 Ga0495649_0005163_3169_4047 258
599 3300046810 Ga0495660_0035915 Ga0495660_0035915_1459_2337 258
600 3300046810 Ga0495660_0044478 Ga0495660_0044478_583_1359 258
601 3300047443 Ga0495687_001439 Ga0495687_001439_18355_19233 258
602 3300048920 Ga0496117_0004392 Ga0496117_0004392_7795_8571 258
603 3300048921 Ga0496118_0045244 Ga0496118_0045244_423_1199 258
604 3300048924 Ga0496121_0030332 Ga0496121_0030332_2524_3300 258
605 3300048925 Ga0496122_0072657 Ga0496122_0072657_391_1167 258
606 3300048926 Ga0496123_0048696 Ga0496123_0048696_1682_2458 258
607 3300048929 Ga0496126_0012012 Ga0496126_0012012_373_1149 258
608 3300053093 Ga0500651_0004907 Ga0500651_0004907_2363_3226 258
609 3300053730 Ga0500645_000346 Ga0500645_000346_18590_19501 258
610 3300001915 JGI24741J21665_1006156 JGI24741J21665_10061562 259
611 3300005288 Ga0065714_10065214 Ga0065714_100652144 259
612 3300005331 Ga0070670_100001050 Ga0070670_10000105010 259
613 3300006051 Ga0075364_10028970 Ga0075364_100289703 259
614 3300009036 Ga0105244_10003334 Ga0105244_1000333410 259
615 3300013308 Ga0157375_10018063 Ga0157375_100180634 259
616 3300025925 Ga0207650_10000278 Ga0207650_1000027815 259
617 3300028786 Ga0307517_10061150 Ga0307517_100611502 259
618 3300030521 Ga0307511_10126332 Ga0307511_101263322 259
619 3300046512 Ga0495610_0004885 Ga0495610_0004885_7898_8677 259
620 3300046530 Ga0495654_0003434 Ga0495654_0003434_7900_8679 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

87

303

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.7981 113 150
5inn-assembly3.cif.gz_C mouse tdp2 d358n protein, apo state with increased disorder amongst variable dna-binding grasp conformations 0.7818 17 259
5inn-assembly3.cif.gz_C mouse tdp2 d358n protein, apo state with increased disorder amongst variable dna-binding grasp conformations 0.7756 17 259
7di7-assembly1.cif.gz_A falcilysin in complex with chloroquine 0.7738 111 151
5inm-assembly3.cif.gz_C mouse tdp2 protein, apo state with variable dna-binding grasp conformations 0.7696 19 259
ID Description Score Start End Superfamily
af_P0AAW1_9_253_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8685 19 259 3.60.10.10
af_P0AAW1_9_253_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8521 19 259 3.60.10.10
af_Q9HDZ2_710_875_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8361 24 183 3.60.10.10
af_P09151_393_501_3.30.160.270 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Alpha-isopropylmalate synthase LeuA, regulatory domain 0.8294 112 148 3.30.160.270
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8032 111 150 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A455UAP1-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.9714 131 259 GO:0003824
AF-A0A379ULU1-F1-model_v4 Endonuclease/Exonuclease/ phosphatase family protein 0.9708 145 259 GO:0004519
GO:0004527
AF-W7W7M8-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.9559 109 259 GO:0003824
GO:0006506
GO:0016020
AF-A0A7H4LWV3-F1-model_v4 Endonuclease/Exonuclease/phosphatase family protein 0.9539 115 259 GO:0004519
GO:0004527
AF-A9MIT9-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.9538 166 259 GO:0003824

Feature Viewer

pLDDT pTM Quality
83.81 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map