F469880
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 620 | 376 | 566 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300003187|JGI25151J46595_10004808|JGI25151J46595_100048086 |
| Length | 312 |
| Sequence | MTCGWPLARFCVPLFRCSVVLLASPSRFPLFLMQNPSPDSSRRRAPDALSVAVPVTPPKAGTQSSFSFKVLTVXIHKGFTFFNRKFILPELREAVRSVGADVVFLQEVTGNHVKHADKFDNYPETPHYEFLADTIWPQFAYGRNAVYTNGHHGNAVLSKFPIVRFENRDVSISGPERRGLLHCELQIPGRSVNVHAICVHLGLMEAHREQQMDMLCDLVRKDIPAHAPVVVAGDFNDWRHRAHARLEKGAELHEVFVQANGKAARTFPARLPLLRLDRIYVRNAIGHAPVVLPLRPWSHLSDHAPLAAEIEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 4 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 5 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 6 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 7 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 8 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 9 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 10 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 11 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 12 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 13 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 14 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 15 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 16 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 17 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 18 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 19 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 20 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 21 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 22 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 23 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 24 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 25 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 26 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 27 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 28 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 29 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 30 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 31 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 32 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 33 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 34 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 35 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 36 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 37 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 38 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 39 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 40 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 41 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 42 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 43 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 44 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 45 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 46 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 47 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 48 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 49 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 50 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 51 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 52 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 53 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 54 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 55 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 56 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 57 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 58 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 59 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 60 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 61 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 62 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 63 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 64 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 65 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 66 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 67 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 73 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 74 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 75 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 77 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 79 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 80 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 84 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 85 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 86 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 87 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 88 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 91 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 93 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 108 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 113 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 116 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 118 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 119 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 120 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 121 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 122 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 123 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 124 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 125 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 126 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 127 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 128 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 129 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 130 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 131 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 132 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 151 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 168 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 224 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 225 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 226 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 227 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 228 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 229 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 230 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 231 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 232 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 233 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 236 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 237 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 239 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 250 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 251 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 252 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 253 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 259 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 262 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 263 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 264 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 265 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 266 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 267 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 268 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 269 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 270 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 271 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 272 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 273 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 274 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 275 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 276 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 277 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 278 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 279 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 327 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 338 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 339 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 341 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 342 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 343 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 347 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 353 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 355 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 356 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 358 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 359 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 361 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 363 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 364 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 365 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 366 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 367 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 370 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 371 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 372 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 373 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 374 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 375 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 376 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.97 |
| Metatranscriptomes | 0.32 |
| Isolates | 8.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 31.61 |
| Nodule | 0.81 |
| Rhizoplane | 4.03 |
| Rhizosphere | 48.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1006156 | 3300001915 | Bacteria | 2440 |
| 2 | JGI25155J39150_1000009 | 3300002704 | Bacteria | 224358 |
| 3 | JGI25156J39149_1000009 | 3300002705 | Bacteria | 224379 |
| 4 | JGI25154J39366_1000864 | 3300002738 | Bacteria | 13101 |
| 5 | JGI25154J39366_1002691 | 3300002738 | Bacteria | 4339 |
| 6 | JGI25157J39369_1000007 | 3300002741 | Bacteria | 224377 |
| 7 | JGI25159J45721_1000314 | 3300002987 | Bacteria | 22609 |
| 8 | JGI25159J45721_1004735 | 3300002987 | Bacteria | 4418 |
| 9 | JGI25151J46595_10001596 | 3300003187 | Bacteria | 15058 |
| 10 | JGI25151J46595_10004808 | 3300003187 | Bacteria | 7072 |
| 11 | JGI25151J46595_10006401 | 3300003187 | Bacteria | 5919 |
| 12 | JGI25153J46596_10005472 | 3300003215 | Bacteria | 6650 |
| 13 | rootH1_10067063 | 3300003316 | Bacteria | 4038 |
| 14 | rootH2_10009627 | 3300003320 | Bacteria | 1475 |
| 15 | rootH2_10034396 | 3300003320 | Bacteria | 3241 |
| 16 | rootL2_10008715 | 3300003322 | Bacteria | 8273 |
| 17 | rootH1_10081743 | 3300003323 | Bacteria | 3489 |
| 18 | JGI25160J50197_1000131 | 3300003354 | Bacteria | 67778 |
| 19 | JGI25161J50226_1000009 | 3300003374 | Bacteria | 224699 |
| 20 | Ga0006562J51391_1034746 | 3300003578 | Bacteria | 2998 |
| 21 | Ga0055538_1000042 | 3300003751 | Bacteria | 164754 |
| 22 | Ga0055539_1000055 | 3300003752 | Bacteria | 164754 |
| 23 | Ga0055533_1000067 | 3300003756 | Bacteria | 164754 |
| 24 | Ga0055532_1000053 | 3300003758 | Bacteria | 164751 |
| 25 | Ga0055525_1000103 | 3300003759 | Bacteria | 134778 |
| 26 | Ga0055527_1007239 | 3300003760 | Bacteria | 1363 |
| 27 | Ga0055535_1000133 | 3300003761 | Bacteria | 79386 |
| 28 | Ga0055542_1000003 | 3300003762 | Bacteria | 582721 |
| 29 | Ga0055537_1000531 | 3300003773 | Bacteria | 22155 |
| 30 | Ga0055537_1003327 | 3300003773 | Bacteria | 4972 |
| 31 | Ga0055524_1000745 | 3300003775 | Bacteria | 22155 |
| 32 | Ga0055524_1000767 | 3300003775 | Bacteria | 21616 |
| 33 | Ga0055536_1000720 | 3300003781 | Bacteria | 22157 |
| 34 | Ga0055536_1001424 | 3300003781 | Bacteria | 14415 |
| 35 | Ga0055536_1002250 | 3300003781 | Bacteria | 10986 |
| 36 | Ga0055536_1002738 | 3300003781 | Bacteria | 9757 |
| 37 | Ga0055534_1000945 | 3300003784 | Bacteria | 12950 |
| 38 | Ga0055534_1003354 | 3300003784 | Bacteria | 5066 |
| 39 | Ga0055534_1010245 | 3300003784 | Bacteria | 1977 |
| 40 | Ga0055528_1000781 | 3300003790 | Bacteria | 22139 |
| 41 | Ga0055528_1007163 | 3300003790 | Bacteria | 4969 |
| 42 | Ga0055530_10000155 | 3300003791 | Bacteria | 61666 |
| 43 | Ga0055530_10001037 | 3300003791 | Bacteria | 22148 |
| 44 | Ga0055530_10003752 | 3300003791 | Bacteria | 8390 |
| 45 | Ga0055530_10005730 | 3300003791 | Bacteria | 5779 |
| 46 | Ga0055530_10038202 | 3300003791 | Bacteria | 1195 |
| 47 | Ga0055540_1000093 | 3300003792 | Bacteria | 98452 |
| 48 | Ga0055540_1000741 | 3300003792 | Bacteria | 22148 |
| 49 | Ga0055540_1001063 | 3300003792 | Bacteria | 17504 |
| 50 | Ga0055540_1025407 | 3300003792 | Bacteria | 1452 |
| 51 | Ga0055531_10001021 | 3300003794 | Bacteria | 22148 |
| 52 | Ga0055531_10001290 | 3300003794 | Bacteria | 18878 |
| 53 | Ga0055531_10001334 | 3300003794 | Bacteria | 18432 |
| 54 | Ga0055541_1000042 | 3300003841 | Bacteria | 164754 |
| 55 | Ga0055543_1000122 | 3300004625 | Bacteria | 65110 |
| 56 | Ga0065165_1017299 | 3300005262 | Bacteria | 2661 |
| 57 | Ga0065714_10065214 | 3300005288 | Bacteria | 11813 |
| 58 | Ga0065707_10245734 | 3300005295 | Bacteria | 1141 |
| 59 | Ga0070676_10002485 | 3300005328 | Bacteria | 9459 |
| 60 | Ga0070676_10135645 | 3300005328 | Bacteria | 1561 |
| 61 | Ga0070670_100000686 | 3300005331 | Bacteria | 26278 |
| 62 | Ga0070670_100001050 | 3300005331 | Bacteria | 21921 |
| 63 | Ga0070670_100011859 | 3300005331 | Bacteria | 7453 |
| 64 | Ga0070670_100102973 | 3300005331 | Bacteria | 2459 |
| 65 | Ga0070670_100252756 | 3300005331 | Bacteria | 1536 |
| 66 | Ga0068869_100008447 | 3300005334 | Bacteria | 6640 |
| 67 | Ga0070680_100015910 | 3300005336 | Bacteria | 5907 |
| 68 | Ga0068868_100010456 | 3300005338 | Bacteria | 6720 |
| 69 | Ga0070660_100031508 | 3300005339 | Bacteria | 3983 |
| 70 | Ga0070661_100019013 | 3300005344 | Bacteria | 4891 |
| 71 | Ga0070661_100234577 | 3300005344 | Bacteria | 1411 |
| 72 | Ga0070668_100579186 | 3300005347 | Bacteria | 980 |
| 73 | Ga0070668_100623216 | 3300005347 | Bacteria | 946 |
| 74 | Ga0070669_100022173 | 3300005353 | Bacteria | 4542 |
| 75 | Ga0070675_100026636 | 3300005354 | Bacteria | 4641 |
| 76 | Ga0070675_100269434 | 3300005354 | Bacteria | 1494 |
| 77 | Ga0070675_100276520 | 3300005354 | Bacteria | 1475 |
| 78 | Ga0070675_100352101 | 3300005354 | Bacteria | 1306 |
| 79 | Ga0070671_100007238 | 3300005355 | Bacteria | 8873 |
| 80 | Ga0070674_100035958 | 3300005356 | Bacteria | 3321 |
| 81 | Ga0070674_100262997 | 3300005356 | Bacteria | 1360 |
| 82 | Ga0070674_100265225 | 3300005356 | Bacteria | 1355 |
| 83 | Ga0070673_100009194 | 3300005364 | Bacteria | 6624 |
| 84 | Ga0070659_100019633 | 3300005366 | Bacteria | 5126 |
| 85 | Ga0070659_100027253 | 3300005366 | Bacteria | 4401 |
| 86 | Ga0070667_100054862 | 3300005367 | Bacteria | 3365 |
| 87 | Ga0070708_100582211 | 3300005445 | Bacteria | 1055 |
| 88 | Ga0070663_100424534 | 3300005455 | Bacteria | 1091 |
| 89 | Ga0070662_100040555 | 3300005457 | Bacteria | 3316 |
| 90 | Ga0070662_100192164 | 3300005457 | Bacteria | 1615 |
| 91 | Ga0070681_10088594 | 3300005458 | Bacteria | 3046 |
| 92 | Ga0068867_100000004 | 3300005459 | Bacteria | 180739 |
| 93 | Ga0068867_100005860 | 3300005459 | Bacteria | 8715 |
| 94 | Ga0068867_100179878 | 3300005459 | Bacteria | 1681 |
| 95 | Ga0070706_100004228 | 3300005467 | Bacteria | 13936 |
| 96 | Ga0070707_100025621 | 3300005468 | Bacteria | 5598 |
| 97 | Ga0070698_100136261 | 3300005471 | Bacteria | 2409 |
| 98 | Ga0070679_100023066 | 3300005530 | Bacteria | 6088 |
| 99 | Ga0068853_100020374 | 3300005539 | Bacteria | 5515 |
| 100 | Ga0068853_100075499 | 3300005539 | Bacteria | 2942 |
| 101 | Ga0070672_100026650 | 3300005543 | Bacteria | 4305 |
| 102 | Ga0070665_100265496 | 3300005548 | Bacteria | 1718 |
| 103 | Ga0068855_100010486 | 3300005563 | Bacteria | 11177 |
| 104 | Ga0070664_100021980 | 3300005564 | Bacteria | 5261 |
| 105 | Ga0070664_100031420 | 3300005564 | Bacteria | 4437 |
| 106 | Ga0070664_100282323 | 3300005564 | Bacteria | 1497 |
| 107 | Ga0068857_100038098 | 3300005577 | Bacteria | 4258 |
| 108 | Ga0068854_100036610 | 3300005578 | Bacteria | 3442 |
| 109 | Ga0068854_100246120 | 3300005578 | Bacteria | 1426 |
| 110 | Ga0068852_100020079 | 3300005616 | Bacteria | 5306 |
| 111 | Ga0068852_100202585 | 3300005616 | Bacteria | 1878 |
| 112 | Ga0068851_10001057 | 3300005834 | Bacteria | 11919 |
| 113 | Ga0068870_10019671 | 3300005840 | Bacteria | 3278 |
| 114 | Ga0068862_100009180 | 3300005844 | Bacteria | 8192 |
| 115 | Ga0075365_10077346 | 3300006038 | Bacteria | 2248 |
| 116 | Ga0075365_10177479 | 3300006038 | Bacteria | 1488 |
| 117 | Ga0075364_10028970 | 3300006051 | Bacteria | 3548 |
| 118 | Ga0075364_10131360 | 3300006051 | Bacteria | 1681 |
| 119 | Ga0075362_10111929 | 3300006177 | Bacteria | 1285 |
| 120 | Ga0075362_10206263 | 3300006177 | Bacteria | 958 |
| 121 | Ga0075367_10027470 | 3300006178 | Bacteria | 3238 |
| 122 | Ga0075366_10001013 | 3300006195 | Bacteria | 13759 |
| 123 | Ga0075366_10007139 | 3300006195 | Bacteria | 6152 |
| 124 | Ga0075366_10073824 | 3300006195 | Bacteria | 2033 |
| 125 | Ga0075366_10196083 | 3300006195 | Bacteria | 1228 |
| 126 | Ga0075370_10001864 | 3300006353 | Bacteria | 9447 |
| 127 | Ga0075370_10002054 | 3300006353 | Bacteria | 9152 |
| 128 | Ga0075370_10005780 | 3300006353 | Bacteria | 6182 |
| 129 | Ga0075370_10017703 | 3300006353 | Bacteria | 3853 |
| 130 | Ga0075370_10026714 | 3300006353 | Bacteria | 3199 |
| 131 | Ga0075370_10117912 | 3300006353 | Bacteria | 1544 |
| 132 | Ga0075370_10377238 | 3300006353 | Bacteria | 849 |
| 133 | Ga0068871_100299153 | 3300006358 | Bacteria | 1412 |
| 134 | Ga0079104_1000138 | 3300006946 | Bacteria | 103200 |
| 135 | Ga0099826_10000602 | 3300006948 | Bacteria | 18299 |
| 136 | Ga0105244_10003334 | 3300009036 | Bacteria | 11540 |
| 137 | Ga0105244_10007210 | 3300009036 | Bacteria | 7091 |
| 138 | Ga0105250_10000691 | 3300009092 | Bacteria | 21018 |
| 139 | Ga0105243_10000660 | 3300009148 | Bacteria | 34104 |
| 140 | Ga0105243_10001333 | 3300009148 | Bacteria | 22028 |
| 141 | Ga0105243_10008019 | 3300009148 | Bacteria | 8108 |
| 142 | Ga0105243_10097697 | 3300009148 | Bacteria | 2431 |
| 143 | Ga0105243_10100672 | 3300009148 | Bacteria | 2398 |
| 144 | Ga0105243_10207870 | 3300009148 | Bacteria | 1721 |
| 145 | Ga0105243_10445404 | 3300009148 | Bacteria | 1214 |
| 146 | Ga0105248_10455718 | 3300009177 | Bacteria | 1441 |
| 147 | Ga0105248_10829719 | 3300009177 | Bacteria | 1043 |
| 148 | Ga0105237_10141555 | 3300009545 | Bacteria | 2399 |
| 149 | Ga0105239_10049077 | 3300010375 | Bacteria | 4628 |
| 150 | Ga0157347_1000943 | 3300012502 | Bacteria | 2120 |
| 151 | Ga0157373_10002871 | 3300013100 | Bacteria | 13035 |
| 152 | Ga0157373_10012279 | 3300013100 | Bacteria | 6296 |
| 153 | Ga0157373_10035762 | 3300013100 | Bacteria | 3564 |
| 154 | Ga0157371_10013100 | 3300013102 | Bacteria | 6312 |
| 155 | Ga0157370_10001888 | 3300013104 | Bacteria | 25792 |
| 156 | Ga0157370_10066395 | 3300013104 | Bacteria | 3412 |
| 157 | Ga0157370_10209073 | 3300013104 | Bacteria | 1809 |
| 158 | Ga0157369_10015740 | 3300013105 | Bacteria | 8522 |
| 159 | Ga0163162_10013289 | 3300013306 | Bacteria | 8042 |
| 160 | Ga0163162_10233665 | 3300013306 | Bacteria | 1969 |
| 161 | Ga0163162_10488083 | 3300013306 | Bacteria | 1363 |
| 162 | Ga0157375_10018063 | 3300013308 | Bacteria | 6388 |
| 163 | Ga0163163_10200859 | 3300014325 | Bacteria | 2042 |
| 164 | Ga0157380_10012507 | 3300014326 | Bacteria | 6159 |
| 165 | Ga0182008_10000576 | 3300014497 | Bacteria | 27046 |
| 166 | Ga0182008_10001595 | 3300014497 | Bacteria | 15083 |
| 167 | Ga0182008_10003516 | 3300014497 | Bacteria | 9433 |
| 168 | Ga0182008_10004502 | 3300014497 | Bacteria | 8137 |
| 169 | Ga0182008_10027924 | 3300014497 | Bacteria | 2855 |
| 170 | Ga0157377_10000010 | 3300014745 | Bacteria | 380929 |
| 171 | Ga0157377_10154473 | 3300014745 | Bacteria | 1422 |
| 172 | Ga0182006_1001381 | 3300015261 | Bacteria | 14767 |
| 173 | Ga0182006_1010480 | 3300015261 | Bacteria | 4120 |
| 174 | Ga0182007_10000214 | 3300015262 | Bacteria | 38835 |
| 175 | Ga0182007_10003951 | 3300015262 | Bacteria | 6849 |
| 176 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 177 | Ga0163161_10146045 | 3300017792 | Bacteria | 1794 |
| 178 | Ga0163161_10270748 | 3300017792 | Bacteria | 1329 |
| 179 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 180 | Ga0209435_100313 | 3300025206 | Bacteria | 11630 |
| 181 | Ga0209784_100060 | 3300025224 | Bacteria | 164838 |
| 182 | Ga0209566_100075 | 3300025225 | Bacteria | 164838 |
| 183 | Ga0209674_100100 | 3300025226 | Bacteria | 164838 |
| 184 | Ga0209672_100719 | 3300025228 | Bacteria | 16353 |
| 185 | Ga0209147_100096 | 3300025229 | Bacteria | 164838 |
| 186 | Ga0209563_100118 | 3300025230 | Bacteria | 131627 |
| 187 | Ga0209437_108097 | 3300025233 | Bacteria | 1689 |
| 188 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 189 | Ga0209258_100387 | 3300025242 | Bacteria | 56263 |
| 190 | Ga0207425_1001469 | 3300025245 | Bacteria | 9819 |
| 191 | Ga0207425_1011362 | 3300025245 | Bacteria | 2128 |
| 192 | Ga0209646_1000029 | 3300025246 | Bacteria | 386414 |
| 193 | Ga0209646_1000276 | 3300025246 | Bacteria | 45523 |
| 194 | Ga0209026_1000016 | 3300025250 | Bacteria | 386457 |
| 195 | Ga0209677_100057 | 3300025253 | Bacteria | 164838 |
| 196 | Ga0209148_1000028 | 3300025254 | Bacteria | 582773 |
| 197 | Ga0209759_1000016 | 3300025256 | Bacteria | 386414 |
| 198 | Ga0209759_1034851 | 3300025256 | Bacteria | 935 |
| 199 | Ga0209129_1000297 | 3300025258 | Bacteria | 46564 |
| 200 | Ga0209129_1003087 | 3300025258 | Bacteria | 7504 |
| 201 | Ga0209565_1000061 | 3300025263 | Bacteria | 185308 |
| 202 | Ga0209565_1000144 | 3300025263 | Bacteria | 99074 |
| 203 | Ga0209565_1001048 | 3300025263 | Bacteria | 13960 |
| 204 | Ga0209565_1001227 | 3300025263 | Bacteria | 12058 |
| 205 | Ga0209565_1002757 | 3300025263 | Bacteria | 6093 |
| 206 | Ga0209565_1011667 | 3300025263 | Bacteria | 2127 |
| 207 | Ga0209673_1000136 | 3300025273 | Bacteria | 159975 |
| 208 | Ga0209673_1000396 | 3300025273 | Bacteria | 77797 |
| 209 | Ga0209673_1000491 | 3300025273 | Bacteria | 65636 |
| 210 | Ga0209673_1004732 | 3300025273 | Bacteria | 7164 |
| 211 | Ga0209673_1042389 | 3300025273 | Bacteria | 1280 |
| 212 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 213 | Ga0209130_1000392 | 3300025284 | Bacteria | 47896 |
| 214 | Ga0209130_1000986 | 3300025284 | Bacteria | 22204 |
| 215 | Ga0209130_1007351 | 3300025284 | Bacteria | 3412 |
| 216 | Ga0209675_1000071 | 3300025291 | Bacteria | 168382 |
| 217 | Ga0209675_1000105 | 3300025291 | Bacteria | 121013 |
| 218 | Ga0209675_1000703 | 3300025291 | Bacteria | 23088 |
| 219 | Ga0209675_1003680 | 3300025291 | Bacteria | 7164 |
| 220 | Ga0209675_1008294 | 3300025291 | Bacteria | 3841 |
| 221 | Ga0209675_1017091 | 3300025291 | Bacteria | 2084 |
| 222 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 223 | Ga0209676_1000153 | 3300025292 | Bacteria | 166393 |
| 224 | Ga0209676_1000167 | 3300025292 | Bacteria | 156470 |
| 225 | Ga0209676_1000241 | 3300025292 | Bacteria | 117623 |
| 226 | Ga0209676_1000496 | 3300025292 | Bacteria | 63126 |
| 227 | Ga0209676_1005991 | 3300025292 | Bacteria | 6142 |
| 228 | Ga0209676_1012832 | 3300025292 | Bacteria | 3258 |
| 229 | Ga0209025_1000410 | 3300025294 | Bacteria | 86076 |
| 230 | Ga0209025_1000627 | 3300025294 | Bacteria | 62581 |
| 231 | Ga0209025_1000661 | 3300025294 | Bacteria | 59706 |
| 232 | Ga0209025_1009005 | 3300025294 | Bacteria | 7050 |
| 233 | Ga0209025_1009876 | 3300025294 | Bacteria | 6568 |
| 234 | Ga0209025_1025198 | 3300025294 | Bacteria | 3036 |
| 235 | Ga0209025_1037213 | 3300025294 | Bacteria | 2163 |
| 236 | Ga0209025_1056584 | 3300025294 | Bacteria | 1506 |
| 237 | Ga0209564_1000110 | 3300025295 | Bacteria | 212842 |
| 238 | Ga0209564_1000123 | 3300025295 | Bacteria | 202487 |
| 239 | Ga0209564_1000181 | 3300025295 | Bacteria | 151002 |
| 240 | Ga0209564_1000247 | 3300025295 | Bacteria | 116628 |
| 241 | Ga0209564_1007727 | 3300025295 | Bacteria | 5473 |
| 242 | Ga0209758_1000039 | 3300025297 | Bacteria | 428951 |
| 243 | Ga0209758_1002335 | 3300025297 | Bacteria | 19579 |
| 244 | Ga0209758_1010275 | 3300025297 | Bacteria | 5632 |
| 245 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 246 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 247 | Ga0209050_1000285 | 3300025298 | Bacteria | 106573 |
| 248 | Ga0209050_1000484 | 3300025298 | Bacteria | 69688 |
| 249 | Ga0209050_1000665 | 3300025298 | Bacteria | 52282 |
| 250 | Ga0209050_1008965 | 3300025298 | Bacteria | 5217 |
| 251 | Ga0209050_1011384 | 3300025298 | Bacteria | 4226 |
| 252 | Ga0209256_1000039 | 3300025299 | Bacteria | 372337 |
| 253 | Ga0209256_1000074 | 3300025299 | Bacteria | 236893 |
| 254 | Ga0209256_1000082 | 3300025299 | Bacteria | 221491 |
| 255 | Ga0209256_1000627 | 3300025299 | Bacteria | 48553 |
| 256 | Ga0207426_1000112 | 3300025302 | Bacteria | 231436 |
| 257 | Ga0207426_1000121 | 3300025302 | Bacteria | 219007 |
| 258 | Ga0207426_1000242 | 3300025302 | Bacteria | 122839 |
| 259 | Ga0207426_1001759 | 3300025302 | Bacteria | 16401 |
| 260 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 261 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 262 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 263 | Ga0209051_1000081 | 3300025303 | Bacteria | 195619 |
| 264 | Ga0209051_1000180 | 3300025303 | Bacteria | 113724 |
| 265 | Ga0209051_1024635 | 3300025303 | Bacteria | 2468 |
| 266 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 267 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 268 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 269 | Ga0209257_1000565 | 3300025304 | Bacteria | 62766 |
| 270 | Ga0209257_1004562 | 3300025304 | Bacteria | 10605 |
| 271 | Ga0209257_1010064 | 3300025304 | Bacteria | 4891 |
| 272 | Ga0209257_1011998 | 3300025304 | Bacteria | 4077 |
| 273 | Ga0207656_10005408 | 3300025321 | Bacteria | 4511 |
| 274 | Ga0207696_1000339 | 3300025711 | Bacteria | 48686 |
| 275 | Ga0207655_1001161 | 3300025728 | Bacteria | 25626 |
| 276 | Ga0207682_10024007 | 3300025893 | Bacteria | 2411 |
| 277 | Ga0207682_10113368 | 3300025893 | Bacteria | 1196 |
| 278 | Ga0207645_10001047 | 3300025907 | Bacteria | 22890 |
| 279 | Ga0207643_10015932 | 3300025908 | Bacteria | 4094 |
| 280 | Ga0207684_10108260 | 3300025910 | Bacteria | 2378 |
| 281 | Ga0207660_10240404 | 3300025917 | Bacteria | 1426 |
| 282 | Ga0207649_10016734 | 3300025920 | Bacteria | 4143 |
| 283 | Ga0207646_10054700 | 3300025922 | Bacteria | 3569 |
| 284 | Ga0207681_10053677 | 3300025923 | Bacteria | 2737 |
| 285 | Ga0207694_10017236 | 3300025924 | Bacteria | 5458 |
| 286 | Ga0207650_10000278 | 3300025925 | Bacteria | 53364 |
| 287 | Ga0207650_10000324 | 3300025925 | Bacteria | 46570 |
| 288 | Ga0207650_10053364 | 3300025925 | Bacteria | 2996 |
| 289 | Ga0207650_10098789 | 3300025925 | Bacteria | 2243 |
| 290 | Ga0207650_10213585 | 3300025925 | Bacteria | 1550 |
| 291 | Ga0207659_10096189 | 3300025926 | Bacteria | 2222 |
| 292 | Ga0207659_10097561 | 3300025926 | Bacteria | 2208 |
| 293 | Ga0207659_10246542 | 3300025926 | Bacteria | 1447 |
| 294 | Ga0207687_10011653 | 3300025927 | Bacteria | 5747 |
| 295 | Ga0207644_10008031 | 3300025931 | Bacteria | 6903 |
| 296 | Ga0207690_10000831 | 3300025932 | Bacteria | 19793 |
| 297 | Ga0207690_10069140 | 3300025932 | Bacteria | 2429 |
| 298 | Ga0207706_10034320 | 3300025933 | Bacteria | 4514 |
| 299 | Ga0207706_10049084 | 3300025933 | Bacteria | 3731 |
| 300 | Ga0207706_10301278 | 3300025933 | Bacteria | 1397 |
| 301 | Ga0207709_10000438 | 3300025935 | Bacteria | 39257 |
| 302 | Ga0207709_10000895 | 3300025935 | Bacteria | 22511 |
| 303 | Ga0207709_10001037 | 3300025935 | Bacteria | 20521 |
| 304 | Ga0207709_10001829 | 3300025935 | Bacteria | 14203 |
| 305 | Ga0207709_10044923 | 3300025935 | Bacteria | 2672 |
| 306 | Ga0207709_10275202 | 3300025935 | Bacteria | 1241 |
| 307 | Ga0207669_10042004 | 3300025937 | Bacteria | 2666 |
| 308 | Ga0207691_10037655 | 3300025940 | Bacteria | 4478 |
| 309 | Ga0207691_10561316 | 3300025940 | Bacteria | 968 |
| 310 | Ga0207711_10740164 | 3300025941 | Bacteria | 917 |
| 311 | Ga0207661_10052866 | 3300025944 | Bacteria | 3248 |
| 312 | Ga0207661_10054497 | 3300025944 | Bacteria | 3204 |
| 313 | Ga0207679_10000629 | 3300025945 | Bacteria | 23458 |
| 314 | Ga0207679_10028463 | 3300025945 | Bacteria | 3878 |
| 315 | Ga0207679_10036045 | 3300025945 | Bacteria | 3505 |
| 316 | Ga0207679_10128960 | 3300025945 | Bacteria | 2026 |
| 317 | Ga0207667_10030913 | 3300025949 | Bacteria | 5787 |
| 318 | Ga0207651_10020643 | 3300025960 | Bacteria | 3982 |
| 319 | Ga0207640_10070623 | 3300025981 | Bacteria | 2349 |
| 320 | Ga0207640_10267229 | 3300025981 | Bacteria | 1336 |
| 321 | Ga0207658_10067427 | 3300025986 | Bacteria | 2695 |
| 322 | Ga0207677_10038114 | 3300026023 | Bacteria | 3148 |
| 323 | Ga0207639_10045961 | 3300026041 | Bacteria | 3292 |
| 324 | Ga0207639_10105551 | 3300026041 | Bacteria | 2286 |
| 325 | Ga0207639_10578020 | 3300026041 | Bacteria | 1034 |
| 326 | Ga0207678_10351296 | 3300026067 | Bacteria | 1272 |
| 327 | Ga0207648_10000002 | 3300026089 | Bacteria | 307909 |
| 328 | Ga0207648_10010248 | 3300026089 | Bacteria | 8901 |
| 329 | Ga0207674_10017241 | 3300026116 | Bacteria | 7879 |
| 330 | Ga0207674_10064682 | 3300026116 | Bacteria | 3689 |
| 331 | Ga0207674_10552416 | 3300026116 | Bacteria | 1112 |
| 332 | Ga0207683_10347641 | 3300026121 | Unclassified | 1361 |
| 333 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 334 | Ga0209282_1001014 | 3300027666 | Bacteria | 14766 |
| 335 | Ga0209974_10046757 | 3300027876 | Bacteria | 1448 |
| 336 | Ga0268266_10052801 | 3300028379 | Bacteria | 3491 |
| 337 | Ga0268266_10687648 | 3300028379 | Bacteria | 986 |
| 338 | Ga0268265_10013608 | 3300028380 | Bacteria | 5532 |
| 339 | Ga0307517_10009384 | 3300028786 | Bacteria | 13860 |
| 340 | Ga0307517_10061150 | 3300028786 | Bacteria | 3569 |
| 341 | Ga0307515_10000374 | 3300028794 | Bacteria | 109304 |
| 342 | Ga0307515_10000585 | 3300028794 | Bacteria | 85580 |
| 343 | Ga0307515_10004409 | 3300028794 | Bacteria | 29143 |
| 344 | Ga0307515_10086104 | 3300028794 | Bacteria | 4010 |
| 345 | Ga0307515_10101239 | 3300028794 | Bacteria | 3480 |
| 346 | Ga0307515_10169879 | 3300028794 | Bacteria | 2179 |
| 347 | Ga0307515_10249837 | 3300028794 | Bacteria | 1528 |
| 348 | Ga0307511_10126332 | 3300030521 | Bacteria | 1559 |
| 349 | Ga0307512_10042144 | 3300030522 | Bacteria | 3784 |
| 350 | Ga0316177_1125066 | 3300030731 | Bacteria | 4050 |
| 351 | Ga0316176_1125671 | 3300030732 | Bacteria | 3639 |
| 352 | Ga0314311_1145075 | 3300030733 | Bacteria | 7382 |
| 353 | Ga0316178_1137182 | 3300030735 | Bacteria | 4608 |
| 354 | Ga0316180_1140543 | 3300030736 | Bacteria | 10132 |
| 355 | Ga0316183_1031124 | 3300030742 | Bacteria | 6967 |
| 356 | Ga0316181_1056362 | 3300030744 | Bacteria | 4614 |
| 357 | Ga0307513_10000363 | 3300031456 | Bacteria | 66311 |
| 358 | Ga0307513_10002839 | 3300031456 | Bacteria | 23740 |
| 359 | Ga0307513_10020161 | 3300031456 | Bacteria | 7911 |
| 360 | Ga0307513_10022805 | 3300031456 | Bacteria | 7346 |
| 361 | Ga0307513_10034853 | 3300031456 | Bacteria | 5640 |
| 362 | Ga0307513_10177769 | 3300031456 | Bacteria | 1996 |
| 363 | Ga0307509_10218832 | 3300031507 | Bacteria | 1720 |
| 364 | Ga0307408_100006099 | 3300031548 | Bacteria | 8014 |
| 365 | Ga0307508_10001752 | 3300031616 | Bacteria | 24086 |
| 366 | Ga0307508_10001778 | 3300031616 | Bacteria | 23959 |
| 367 | Ga0307514_10003197 | 3300031649 | Bacteria | 15995 |
| 368 | Ga0307514_10034102 | 3300031649 | Bacteria | 4057 |
| 369 | Ga0307514_10088115 | 3300031649 | Bacteria | 2272 |
| 370 | Ga0265342_10104260 | 3300031712 | Bacteria | 1612 |
| 371 | Ga0307516_10000432 | 3300031730 | Bacteria | 55006 |
| 372 | Ga0307516_10007238 | 3300031730 | Bacteria | 12786 |
| 373 | Ga0307516_10007622 | 3300031730 | Bacteria | 12398 |
| 374 | Ga0307516_10174133 | 3300031730 | Bacteria | 1890 |
| 375 | Ga0307516_10187650 | 3300031730 | Bacteria | 1796 |
| 376 | Ga0307516_10195243 | 3300031730 | Bacteria | 1747 |
| 377 | Ga0307405_10192694 | 3300031731 | Bacteria | 1473 |
| 378 | Ga0307405_10654448 | 3300031731 | Bacteria | 864 |
| 379 | Ga0307410_10393811 | 3300031852 | Bacteria | 1117 |
| 380 | Ga0307406_10043596 | 3300031901 | Bacteria | 2807 |
| 381 | Ga0307406_10321785 | 3300031901 | Bacteria | 1197 |
| 382 | Ga0307412_10030876 | 3300031911 | Bacteria | 3378 |
| 383 | Ga0307416_100165913 | 3300032002 | Bacteria | 2048 |
| 384 | Ga0307414_10307651 | 3300032004 | Bacteria | 1344 |
| 385 | Ga0307414_10398417 | 3300032004 | Bacteria | 1195 |
| 386 | Ga0307411_10093870 | 3300032005 | Bacteria | 2102 |
| 387 | Ga0307415_100216161 | 3300032126 | Bacteria | 1533 |
| 388 | Ga0395898_0085604 | 3300037466 | Bacteria | 3038 |
| 389 | Ga0395905_0030319 | 3300037471 | Bacteria | 5097 |
| 390 | Ga0395905_0721785 | 3300037471 | Bacteria | 899 |
| 391 | Ga0439436_0000577 | 3300041404 | Bacteria | 9708 |
| 392 | Ga0439461_0058005 | 3300041410 | Bacteria | 874 |
| 393 | Ga0439466_0005485 | 3300041411 | Bacteria | 4844 |
| 394 | Ga0439466_0043234 | 3300041411 | Bacteria | 1497 |
| 395 | Ga0439465_0004086 | 3300041413 | Bacteria | 4745 |
| 396 | Ga0451797_1402468 | 3300041453 | Bacteria | 2799 |
| 397 | Ga0451795_1609977 | 3300041456 | Bacteria | 1867 |
| 398 | Ga0451798_0974092 | 3300041458 | Bacteria | 1197 |
| 399 | Ga0451802_1291151 | 3300041460 | Bacteria | 1754 |
| 400 | Ga0451807_0945747 | 3300041486 | Bacteria | 1052 |
| 401 | Ga0451833_1449534 | 3300041491 | Bacteria | 1008 |
| 402 | Ga0451851_0502449 | 3300041507 | Bacteria | 1955 |
| 403 | Ga0451853_0849379 | 3300041512 | Bacteria | 1095 |
| 404 | Ga0439431_0009932 | 3300041997 | Bacteria | 2155 |
| 405 | Ga0439431_0022070 | 3300041997 | Bacteria | 1532 |
| 406 | Ga0439445_0010557 | 3300042004 | Bacteria | 2189 |
| 407 | Ga0439449_0013756 | 3300042007 | Bacteria | 3045 |
| 408 | Ga0450911_000269 | 3300042115 | Bacteria | 19395 |
| 409 | Ga0450919_000255 | 3300042121 | Bacteria | 6111 |
| 410 | Ga0450920_023133 | 3300042122 | Bacteria | 1204 |
| 411 | Ga0450921_000010 | 3300042123 | Bacteria | 4774 |
| 412 | Ga0450922_002601 | 3300042124 | Bacteria | 1686 |
| 413 | Ga0450923_009380 | 3300042125 | Bacteria | 1710 |
| 414 | Ga0450890_005365 | 3300042127 | Bacteria | 1650 |
| 415 | Ga0450891_004231 | 3300042129 | Bacteria | 1350 |
| 416 | Ga0450896_007953 | 3300042133 | Bacteria | 1466 |
| 417 | Ga0450906_000177 | 3300042145 | Bacteria | 11915 |
| 418 | Ga0450910_001389 | 3300042147 | Bacteria | 3039 |
| 419 | Ga0450908_000284 | 3300042184 | Bacteria | 10029 |
| 420 | Ga0450909_004267 | 3300042185 | Bacteria | 2039 |
| 421 | Ga0439434_0001778 | 3300042435 | Bacteria | 6265 |
| 422 | Ga0439434_0055081 | 3300042435 | Bacteria | 1238 |
| 423 | Ga0450893_0002079 | 3300042532 | Bacteria | 3117 |
| 424 | Ga0495627_004467 | 3300046453 | Bacteria | 5851 |
| 425 | Ga0495590_0011562 | 3300046457 | Bacteria | 3296 |
| 426 | Ga0495638_0008100 | 3300046460 | Bacteria | 7473 |
| 427 | Ga0495638_0156897 | 3300046460 | Bacteria | 1316 |
| 428 | Ga0495639_0003270 | 3300046475 | Bacteria | 7037 |
| 429 | Ga0495583_0001282 | 3300046506 | Bacteria | 26263 |
| 430 | Ga0495610_0004885 | 3300046512 | Bacteria | 9745 |
| 431 | Ga0495610_0066383 | 3300046512 | Bacteria | 1699 |
| 432 | Ga0495616_0001568 | 3300046513 | Bacteria | 15754 |
| 433 | Ga0495620_0003841 | 3300046515 | Bacteria | 8563 |
| 434 | Ga0495631_0000004 | 3300046518 | Bacteria | 159706 |
| 435 | Ga0495632_0001652 | 3300046519 | Bacteria | 18276 |
| 436 | Ga0495632_0104152 | 3300046519 | Bacteria | 1336 |
| 437 | Ga0495632_0105328 | 3300046519 | Bacteria | 1327 |
| 438 | Ga0495637_0012316 | 3300046520 | Bacteria | 4095 |
| 439 | Ga0495654_0003251 | 3300046530 | Bacteria | 10025 |
| 440 | Ga0495654_0003266 | 3300046530 | Bacteria | 9999 |
| 441 | Ga0495654_0003434 | 3300046530 | Bacteria | 9712 |
| 442 | Ga0495586_0256543 | 3300046535 | Bacteria | 998 |
| 443 | Ga0495609_0104177 | 3300046538 | Bacteria | 1228 |
| 444 | Ga0495621_0002367 | 3300046539 | Bacteria | 5067 |
| 445 | Ga0495621_0003922 | 3300046539 | Bacteria | 4135 |
| 446 | Ga0495621_0014308 | 3300046539 | Bacteria | 2509 |
| 447 | Ga0495621_0022691 | 3300046539 | Bacteria | 2083 |
| 448 | Ga0495656_0007178 | 3300046615 | Bacteria | 3932 |
| 449 | Ga0495668_0036801 | 3300046616 | Bacteria | 2741 |
| 450 | Ga0495668_0086498 | 3300046616 | Bacteria | 1719 |
| 451 | Ga0495625_0001405 | 3300046660 | Bacteria | 29481 |
| 452 | Ga0495588_0003846 | 3300046674 | Bacteria | 6580 |
| 453 | Ga0495588_0016176 | 3300046674 | Bacteria | 3602 |
| 454 | Ga0495588_0034944 | 3300046674 | Bacteria | 2545 |
| 455 | Ga0495658_0018269 | 3300046683 | Bacteria | 3642 |
| 456 | Ga0495624_0024245 | 3300046690 | Bacteria | 3994 |
| 457 | Ga0495670_0058771 | 3300046691 | Bacteria | 1930 |
| 458 | Ga0495671_0001138 | 3300046692 | Bacteria | 18320 |
| 459 | Ga0495649_0005163 | 3300046694 | Bacteria | 8372 |
| 460 | Ga0495660_0035915 | 3300046810 | Bacteria | 2766 |
| 461 | Ga0495660_0044478 | 3300046810 | Bacteria | 2442 |
| 462 | Ga0495660_0076794 | 3300046810 | Bacteria | 1759 |
| 463 | Ga0495604_0422391 | 3300047317 | Bacteria | 875 |
| 464 | Ga0495676_0077602 | 3300047321 | Bacteria | 2532 |
| 465 | Ga0495687_001439 | 3300047443 | Bacteria | 21864 |
| 466 | Ga0495677_0072579 | 3300047445 | Bacteria | 1284 |
| 467 | Ga0495681_0040262 | 3300047470 | Bacteria | 2277 |
| 468 | Ga0495686_0001324 | 3300047472 | Bacteria | 27731 |
| 469 | Ga0495686_0115323 | 3300047472 | Bacteria | 1607 |
| 470 | Ga0495593_0000598 | 3300047673 | Bacteria | 20528 |
| 471 | Ga0495614_0049802 | 3300048089 | Bacteria | 1795 |
| 472 | Ga0495614_0086853 | 3300048089 | Bacteria | 1358 |
| 473 | Ga0495615_0008575 | 3300048090 | Bacteria | 1982 |
| 474 | Ga0496100_0004722 | 3300048903 | Bacteria | 7264 |
| 475 | Ga0496101_0040256 | 3300048904 | Bacteria | 3328 |
| 476 | Ga0496102_0000706 | 3300048905 | Bacteria | 33087 |
| 477 | Ga0496102_0003775 | 3300048905 | Bacteria | 12805 |
| 478 | Ga0496102_0012945 | 3300048905 | Bacteria | 7224 |
| 479 | Ga0496103_0015323 | 3300048906 | Bacteria | 4560 |
| 480 | Ga0496103_0099165 | 3300048906 | Bacteria | 1843 |
| 481 | Ga0496104_0004468 | 3300048907 | Bacteria | 12184 |
| 482 | Ga0496105_0016042 | 3300048908 | Bacteria | 5975 |
| 483 | Ga0496107_0041542 | 3300048910 | Bacteria | 3302 |
| 484 | Ga0496109_0202561 | 3300048912 | Bacteria | 1866 |
| 485 | Ga0496114_0101262 | 3300048917 | Bacteria | 2459 |
| 486 | Ga0496114_0171631 | 3300048917 | Bacteria | 1890 |
| 487 | Ga0496114_0233896 | 3300048917 | Bacteria | 1615 |
| 488 | Ga0496117_0004392 | 3300048920 | Bacteria | 15622 |
| 489 | Ga0496118_0008367 | 3300048921 | Bacteria | 10701 |
| 490 | Ga0496118_0023238 | 3300048921 | Bacteria | 5390 |
| 491 | Ga0496118_0045244 | 3300048921 | Bacteria | 3438 |
| 492 | Ga0496119_0053573 | 3300048922 | Bacteria | 2463 |
| 493 | Ga0496121_0006359 | 3300048924 | Bacteria | 14720 |
| 494 | Ga0496121_0030332 | 3300048924 | Bacteria | 4967 |
| 495 | Ga0496122_0035479 | 3300048925 | Bacteria | 4056 |
| 496 | Ga0496122_0072657 | 3300048925 | Bacteria | 2444 |
| 497 | Ga0496122_0090371 | 3300048925 | Bacteria | 2090 |
| 498 | Ga0496123_0048696 | 3300048926 | Bacteria | 2848 |
| 499 | Ga0496123_0099622 | 3300048926 | Bacteria | 1696 |
| 500 | Ga0496124_0010062 | 3300048927 | Bacteria | 9648 |
| 501 | Ga0496124_0010612 | 3300048927 | Bacteria | 9309 |
| 502 | Ga0496125_0013523 | 3300048928 | Bacteria | 8019 |
| 503 | Ga0496125_0019514 | 3300048928 | Bacteria | 6391 |
| 504 | Ga0496125_0026306 | 3300048928 | Bacteria | 5306 |
| 505 | Ga0496126_0012012 | 3300048929 | Bacteria | 8899 |
| 506 | Ga0496126_0098644 | 3300048929 | Bacteria | 2559 |
| 507 | Ga0501308_007473 | 3300049128 | Bacteria | 1145 |
| 508 | Ga0495678_063637 | 3300049459 | Bacteria | 1377 |
| 509 | Ga0501043_0000071 | 3300049579 | Bacteria | 89105 |
| 510 | Ga0501046_0000311 | 3300049580 | Bacteria | 48905 |
| 511 | Ga0501047_0000087 | 3300049581 | Bacteria | 117516 |
| 512 | Ga0501048_0000226 | 3300049582 | Bacteria | 37156 |
| 513 | Ga0501248_005014 | 3300049678 | Bacteria | 1025 |
| 514 | Ga0501249_001626 | 3300049679 | Bacteria | 4593 |
| 515 | Ga0501225_0001971 | 3300049705 | Bacteria | 6413 |
| 516 | Ga0501241_022096 | 3300049758 | Bacteria | 1174 |
| 517 | Ga0501262_003655 | 3300049759 | Bacteria | 1771 |
| 518 | Ga0501265_011992 | 3300049762 | Bacteria | 1076 |
| 519 | Ga0501045_0009015 | 3300049824 | Bacteria | 6969 |
| 520 | nmdc:mga03683_169068_c1 | 3300050489 | Bacteria | 993 |
| 521 | nmdc:mga03683_21935_c1 | 3300050489 | Bacteria | 2469 |
| 522 | nmdc:mga03683_3922_c1 | 3300050489 | Bacteria | 4866 |
| 523 | nmdc:mga03n38_193078_c1 | 3300050490 | Bacteria | 1050 |
| 524 | nmdc:mga03n38_70880_c1 | 3300050490 | Bacteria | 1613 |
| 525 | nmdc:mga0k408_52510_c1 | 3300050493 | Bacteria | 2362 |
| 526 | nmdc:mga0k408_76349_c1 | 3300050493 | Bacteria | 1958 |
| 527 | nmdc:mga06z11_113638_c1 | 3300050494 | Bacteria | 1502 |
| 528 | nmdc:mga07m45_1068_c1 | 3300050496 | Bacteria | 12200 |
| 529 | nmdc:mga07m45_127127_c1 | 3300050496 | Bacteria | 1474 |
| 530 | nmdc:mga07m45_1331_c1 | 3300050496 | Bacteria | 11255 |
| 531 | nmdc:mga07m45_13831_c1 | 3300050496 | Bacteria | 4288 |
| 532 | nmdc:mga07m45_51509_c1 | 3300050496 | Bacteria | 2322 |
| 533 | nmdc:mga07m45_59709_c1 | 3300050496 | Bacteria | 2158 |
| 534 | nmdc:mga0sz30_19810_c1 | 3300050516 | Bacteria | 2707 |
| 535 | Ga0500610_0000623 | 3300053079 | Bacteria | 10848 |
| 536 | Ga0500610_0022859 | 3300053079 | Bacteria | 3088 |
| 537 | Ga0500644_0015506 | 3300053088 | Bacteria | 2175 |
| 538 | Ga0500651_0000079 | 3300053093 | Bacteria | 62532 |
| 539 | Ga0500651_0004907 | 3300053093 | Bacteria | 7566 |
| 540 | Ga0500566_0002061 | 3300053094 | Bacteria | 11875 |
| 541 | Ga0500562_032310 | 3300053108 | Bacteria | 1381 |
| 542 | Ga0500569_035346 | 3300053109 | Bacteria | 1432 |
| 543 | Ga0500571_000018 | 3300053110 | Bacteria | 61068 |
| 544 | Ga0500593_000059 | 3300053117 | Bacteria | 40547 |
| 545 | Ga0500593_012853 | 3300053117 | Bacteria | 3560 |
| 546 | Ga0500594_0004945 | 3300053118 | Bacteria | 2946 |
| 547 | Ga0500597_021070 | 3300053120 | Bacteria | 2569 |
| 548 | Ga0500655_000774 | 3300053133 | Bacteria | 6296 |
| 549 | Ga0500658_0000057 | 3300053134 | Bacteria | 55697 |
| 550 | Ga0500658_0000456 | 3300053134 | Bacteria | 17434 |
| 551 | Ga0500559_0006069 | 3300053136 | Bacteria | 5478 |
| 552 | Ga0500559_0015915 | 3300053136 | Bacteria | 3175 |
| 553 | Ga0500568_0035770 | 3300053139 | Bacteria | 2024 |
| 554 | Ga0500568_0101380 | 3300053139 | Bacteria | 1080 |
| 555 | Ga0500574_031600 | 3300053141 | Bacteria | 1427 |
| 556 | Ga0500586_057179 | 3300053145 | Bacteria | 1353 |
| 557 | Ga0500616_0020477 | 3300053153 | Bacteria | 3715 |
| 558 | Ga0500619_000101 | 3300053154 | Bacteria | 22906 |
| 559 | Ga0500627_0006385 | 3300053158 | Bacteria | 4012 |
| 560 | Ga0500634_0060278 | 3300053161 | Bacteria | 2015 |
| 561 | Ga0500634_0113864 | 3300053161 | Bacteria | 1329 |
| 562 | Ga0500638_004202 | 3300053162 | Bacteria | 5498 |
| 563 | Ga0500645_000346 | 3300053730 | Bacteria | 33036 |
| 564 | Ga0500645_005051 | 3300053730 | Bacteria | 4932 |
| 565 | Ga0500661_011135 | 3300055283 | Bacteria | 1630 |
| 566 | Ga0590075_019775 | 3300059424 | Bacteria | 1673 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003320 | rootH2_10009627 | rootH2_100096272 | 204 |
| 2 | 3300005459 | Ga0068867_100179878 | Ga0068867_1001798782 | 234 |
| 3 | 3300032004 | Ga0307414_10398417 | Ga0307414_103984171 | 234 |
| 4 | 3300049128 | Ga0501308_007473 | Ga0501308_007473_396_1121 | 237 |
| 5 | 3300026121 | Ga0207683_10347641 | Ga0207683_103476412 | 238 |
| 6 | 3300042127 | Ga0450890_005365 | Ga0450890_005365_232_1038 | 240 |
| 7 | 3300006353 | Ga0075370_10002054 | Ga0075370_100020543 | 244 |
| 8 | 3300028794 | Ga0307515_10101239 | Ga0307515_101012392 | 244 |
| 9 | 3300031456 | Ga0307513_10002839 | Ga0307513_100028392 | 244 |
| 10 | 3300025944 | Ga0207661_10052866 | Ga0207661_100528662 | 245 |
| 11 | 3300005336 | Ga0070680_100015910 | Ga0070680_1000159103 | 246 |
| 12 | 3300005458 | Ga0070681_10088594 | Ga0070681_100885942 | 246 |
| 13 | 3300005530 | Ga0070679_100023066 | Ga0070679_1000230665 | 246 |
| 14 | 3300037466 | Ga0395898_0085604 | Ga0395898_0085604_926_1762 | 246 |
| 15 | 3300005295 | Ga0065707_10245734 | Ga0065707_102457341 | 247 |
| 16 | 3300005347 | Ga0070668_100579186 | Ga0070668_1005791861 | 247 |
| 17 | 3300017792 | Ga0163161_10270748 | Ga0163161_102707482 | 247 |
| 18 | 3300025940 | Ga0207691_10561316 | Ga0207691_105613162 | 247 |
| 19 | 3300005563 | Ga0068855_100010486 | Ga0068855_1000104863 | 248 |
| 20 | 3300005577 | Ga0068857_100038098 | Ga0068857_1000380982 | 248 |
| 21 | 3300005616 | Ga0068852_100202585 | Ga0068852_1002025852 | 248 |
| 22 | 3300006038 | Ga0075365_10077346 | Ga0075365_100773461 | 248 |
| 23 | 3300009545 | Ga0105237_10141555 | Ga0105237_101415552 | 248 |
| 24 | 3300010375 | Ga0105239_10049077 | Ga0105239_100490775 | 248 |
| 25 | 3300013100 | Ga0157373_10012279 | Ga0157373_100122797 | 248 |
| 26 | 3300013104 | Ga0157370_10066395 | Ga0157370_100663952 | 248 |
| 27 | 3300013105 | Ga0157369_10015740 | Ga0157369_100157406 | 248 |
| 28 | 3300025949 | Ga0207667_10030913 | Ga0207667_100309133 | 248 |
| 29 | 3300025981 | Ga0207640_10267229 | Ga0207640_102672292 | 248 |
| 30 | 3300026041 | Ga0207639_10105551 | Ga0207639_101055511 | 248 |
| 31 | 3300028794 | Ga0307515_10169879 | Ga0307515_101698792 | 248 |
| 32 | 3300031712 | Ga0265342_10104260 | Ga0265342_101042601 | 248 |
| 33 | 3300031730 | Ga0307516_10000432 | Ga0307516_1000043248 | 248 |
| 34 | 3300037471 | Ga0395905_0721785 | Ga0395905_0721785_50_817 | 248 |
| 35 | 3300042435 | Ga0439434_0055081 | Ga0439434_0055081_459_1223 | 248 |
| 36 | 3300049678 | Ga0501248_005014 | Ga0501248_005014_129_890 | 248 |
| 37 | iso_pu_bacteria | 2643221660 | 2644339564 | 248 |
| 38 | 3300002704 | JGI25155J39150_1000009 | JGI25155J39150_10000097 | 249 |
| 39 | 3300002705 | JGI25156J39149_1000009 | JGI25156J39149_1000009213 | 249 |
| 40 | 3300002738 | JGI25154J39366_1000864 | JGI25154J39366_10008647 | 249 |
| 41 | 3300002741 | JGI25157J39369_1000007 | JGI25157J39369_1000007213 | 249 |
| 42 | 3300003784 | Ga0055534_1010245 | Ga0055534_10102452 | 249 |
| 43 | 3300003791 | Ga0055530_10000155 | Ga0055530_1000015510 | 249 |
| 44 | 3300006038 | Ga0075365_10177479 | Ga0075365_101774792 | 249 |
| 45 | 3300006195 | Ga0075366_10196083 | Ga0075366_101960832 | 249 |
| 46 | 3300013104 | Ga0157370_10001888 | Ga0157370_1000188820 | 249 |
| 47 | 3300014497 | Ga0182008_10001595 | Ga0182008_100015955 | 249 |
| 48 | 3300025206 | Ga0209435_100008 | Ga0209435_100008120 | 249 |
| 49 | 3300025246 | Ga0209646_1000029 | Ga0209646_1000029158 | 249 |
| 50 | 3300025250 | Ga0209026_1000016 | Ga0209026_1000016158 | 249 |
| 51 | 3300025256 | Ga0209759_1000016 | Ga0209759_1000016158 | 249 |
| 52 | 3300028794 | Ga0307515_10000374 | Ga0307515_1000037427 | 249 |
| 53 | 3300028794 | Ga0307515_10000585 | Ga0307515_1000058517 | 249 |
| 54 | 3300030522 | Ga0307512_10042144 | Ga0307512_100421443 | 249 |
| 55 | 3300031507 | Ga0307509_10218832 | Ga0307509_102188322 | 249 |
| 56 | 3300031616 | Ga0307508_10001778 | Ga0307508_1000177812 | 249 |
| 57 | 3300031649 | Ga0307514_10003197 | Ga0307514_1000319711 | 249 |
| 58 | 3300041512 | Ga0451853_0849379 | Ga0451853_0849379_141_917 | 249 |
| 59 | 3300048905 | Ga0496102_0003775 | Ga0496102_0003775_9600_10361 | 249 |
| 60 | 3300053136 | Ga0500559_0015915 | Ga0500559_0015915_1405_2175 | 249 |
| 61 | 3300059424 | Ga0590075_019775 | Ga0590075_019775_545_1357 | 249 |
| 62 | iso_pu_bacteria | 2842677519 | 2842682554 | 249 |
| 63 | iso_pu_bacteria | 2842733646 | 2842737192 | 249 |
| 64 | iso_pu_bacteria | 2842747753 | 2842750432 | 249 |
| 65 | iso_pu_bacteria | 2904449895 | 2904451346 | 249 |
| 66 | iso_pu_bacteria | 2904456579 | 2904458208 | 249 |
| 67 | iso_pu_bacteria | 2919462493 | 2919466667 | 249 |
| 68 | iso_pu_bacteria | 2929520902 | 2929526177 | 249 |
| 69 | iso_pu_bacteria | 2945945610 | 2945950731 | 249 |
| 70 | iso_pu_bacteria | 2945972063 | 2945974643 | 249 |
| 71 | 3300002987 | JGI25159J45721_1000314 | JGI25159J45721_100031417 | 250 |
| 72 | 3300003354 | JGI25160J50197_1000131 | JGI25160J50197_100013162 | 250 |
| 73 | 3300003374 | JGI25161J50226_1000009 | JGI25161J50226_100000910 | 250 |
| 74 | 3300004625 | Ga0055543_1000122 | Ga0055543_100012233 | 250 |
| 75 | 3300005328 | Ga0070676_10135645 | Ga0070676_101356452 | 250 |
| 76 | 3300005331 | Ga0070670_100102973 | Ga0070670_1001029732 | 250 |
| 77 | 3300005331 | Ga0070670_100252756 | Ga0070670_1002527562 | 250 |
| 78 | 3300005347 | Ga0070668_100623216 | Ga0070668_1006232161 | 250 |
| 79 | 3300005353 | Ga0070669_100022173 | Ga0070669_1000221732 | 250 |
| 80 | 3300005354 | Ga0070675_100269434 | Ga0070675_1002694342 | 250 |
| 81 | 3300005356 | Ga0070674_100035958 | Ga0070674_1000359583 | 250 |
| 82 | 3300005356 | Ga0070674_100262997 | Ga0070674_1002629972 | 250 |
| 83 | 3300005356 | Ga0070674_100265225 | Ga0070674_1002652251 | 250 |
| 84 | 3300005457 | Ga0070662_100192164 | Ga0070662_1001921641 | 250 |
| 85 | 3300005459 | Ga0068867_100000004 | Ga0068867_100000004106 | 250 |
| 86 | 3300005616 | Ga0068852_100020079 | Ga0068852_1000200794 | 250 |
| 87 | 3300006177 | Ga0075362_10206263 | Ga0075362_102062631 | 250 |
| 88 | 3300006353 | Ga0075370_10377238 | Ga0075370_103772381 | 250 |
| 89 | 3300009148 | Ga0105243_10000660 | Ga0105243_100006607 | 250 |
| 90 | 3300009148 | Ga0105243_10207870 | Ga0105243_102078702 | 250 |
| 91 | 3300009177 | Ga0105248_10829719 | Ga0105248_108297192 | 250 |
| 92 | 3300014326 | Ga0157380_10012507 | Ga0157380_100125074 | 250 |
| 93 | 3300014745 | Ga0157377_10000010 | Ga0157377_10000010167 | 250 |
| 94 | 3300025284 | Ga0209130_1000014 | Ga0209130_1000014217 | 250 |
| 95 | 3300025302 | Ga0207426_1000242 | Ga0207426_1000242104 | 250 |
| 96 | 3300025893 | Ga0207682_10024007 | Ga0207682_100240072 | 250 |
| 97 | 3300025917 | Ga0207660_10240404 | Ga0207660_102404042 | 250 |
| 98 | 3300025923 | Ga0207681_10053677 | Ga0207681_100536772 | 250 |
| 99 | 3300025925 | Ga0207650_10098789 | Ga0207650_100987892 | 250 |
| 100 | 3300025925 | Ga0207650_10213585 | Ga0207650_102135852 | 250 |
| 101 | 3300025926 | Ga0207659_10246542 | Ga0207659_102465422 | 250 |
| 102 | 3300025933 | Ga0207706_10301278 | Ga0207706_103012782 | 250 |
| 103 | 3300025935 | Ga0207709_10000895 | Ga0207709_100008957 | 250 |
| 104 | 3300025937 | Ga0207669_10042004 | Ga0207669_100420043 | 250 |
| 105 | 3300025941 | Ga0207711_10740164 | Ga0207711_107401641 | 250 |
| 106 | 3300025944 | Ga0207661_10054497 | Ga0207661_100544972 | 250 |
| 107 | 3300026089 | Ga0207648_10000002 | Ga0207648_10000002104 | 250 |
| 108 | 3300026116 | Ga0207674_10552416 | Ga0207674_105524161 | 250 |
| 109 | 3300028786 | Ga0307517_10009384 | Ga0307517_1000938413 | 250 |
| 110 | 3300028794 | Ga0307515_10004409 | Ga0307515_1000440929 | 250 |
| 111 | 3300028794 | Ga0307515_10249837 | Ga0307515_102498371 | 250 |
| 112 | 3300031456 | Ga0307513_10022805 | Ga0307513_100228055 | 250 |
| 113 | 3300031456 | Ga0307513_10034853 | Ga0307513_100348534 | 250 |
| 114 | 3300031456 | Ga0307513_10177769 | Ga0307513_101777692 | 250 |
| 115 | 3300031616 | Ga0307508_10001752 | Ga0307508_1000175224 | 250 |
| 116 | 3300031649 | Ga0307514_10088115 | Ga0307514_100881152 | 250 |
| 117 | 3300031730 | Ga0307516_10007622 | Ga0307516_100076222 | 250 |
| 118 | 3300031730 | Ga0307516_10174133 | Ga0307516_101741332 | 250 |
| 119 | 3300031730 | Ga0307516_10187650 | Ga0307516_101876501 | 250 |
| 120 | 3300031730 | Ga0307516_10195243 | Ga0307516_101952432 | 250 |
| 121 | 3300031901 | Ga0307406_10321785 | Ga0307406_103217851 | 250 |
| 122 | 3300037471 | Ga0395905_0030319 | Ga0395905_0030319_1064_1834 | 250 |
| 123 | 3300041453 | Ga0451797_1402468 | Ga0451797_1402468_1047_1811 | 250 |
| 124 | 3300041456 | Ga0451795_1609977 | Ga0451795_1609977_965_1729 | 250 |
| 125 | 3300041460 | Ga0451802_1291151 | Ga0451802_1291151_671_1435 | 250 |
| 126 | 3300041486 | Ga0451807_0945747 | Ga0451807_0945747_14_778 | 250 |
| 127 | 3300041491 | Ga0451833_1449534 | Ga0451833_1449534_93_857 | 250 |
| 128 | 3300041507 | Ga0451851_0502449 | Ga0451851_0502449_751_1515 | 250 |
| 129 | 3300042115 | Ga0450911_000269 | Ga0450911_000269_6434_7207 | 250 |
| 130 | 3300042129 | Ga0450891_004231 | Ga0450891_004231_163_936 | 250 |
| 131 | 3300046519 | Ga0495632_0105328 | Ga0495632_0105328_61_825 | 250 |
| 132 | 3300046539 | Ga0495621_0002367 | Ga0495621_0002367_2319_3083 | 250 |
| 133 | 3300046539 | Ga0495621_0022691 | Ga0495621_0022691_1224_1988 | 250 |
| 134 | 3300047472 | Ga0495686_0115323 | Ga0495686_0115323_483_1247 | 250 |
| 135 | 3300048905 | Ga0496102_0000706 | Ga0496102_0000706_31574_32338 | 250 |
| 136 | 3300048924 | Ga0496121_0006359 | Ga0496121_0006359_8533_9306 | 250 |
| 137 | 3300048927 | Ga0496124_0010062 | Ga0496124_0010062_4002_4775 | 250 |
| 138 | 3300048928 | Ga0496125_0019514 | Ga0496125_0019514_5258_6031 | 250 |
| 139 | 3300048928 | Ga0496125_0026306 | Ga0496125_0026306_3655_4428 | 250 |
| 140 | 3300048929 | Ga0496126_0098644 | Ga0496126_0098644_1144_1917 | 250 |
| 141 | 3300049762 | Ga0501265_011992 | Ga0501265_011992_147_926 | 250 |
| 142 | 3300050489 | nmdc:mga03683_21935_c1 | nmdc:mga03683_21935_c1_40_942 | 250 |
| 143 | 3300050490 | nmdc:mga03n38_70880_c1 | nmdc:mga03n38_70880_c1_440_1204 | 250 |
| 144 | 3300050496 | nmdc:mga07m45_51509_c1 | nmdc:mga07m45_51509_c1_498_1262 | 250 |
| 145 | 3300053117 | Ga0500593_012853 | Ga0500593_012853_903_1937 | 250 |
| 146 | 3300053139 | Ga0500568_0101380 | Ga0500568_0101380_265_1038 | 250 |
| 147 | 3300053153 | Ga0500616_0020477 | Ga0500616_0020477_1248_2021 | 250 |
| 148 | 3300053154 | Ga0500619_000101 | Ga0500619_000101_19501_20265 | 250 |
| 149 | iso_pu_bacteria | 2643221644 | 2644244966 | 250 |
| 150 | 3300005262 | Ga0065165_1017299 | Ga0065165_10172992 | 251 |
| 151 | 3300005339 | Ga0070660_100031508 | Ga0070660_1000315083 | 251 |
| 152 | 3300005344 | Ga0070661_100019013 | Ga0070661_1000190135 | 251 |
| 153 | 3300005366 | Ga0070659_100019633 | Ga0070659_1000196333 | 251 |
| 154 | 3300005564 | Ga0070664_100021980 | Ga0070664_1000219805 | 251 |
| 155 | 3300005564 | Ga0070664_100031420 | Ga0070664_1000314202 | 251 |
| 156 | 3300006177 | Ga0075362_10111929 | Ga0075362_101119291 | 251 |
| 157 | 3300006353 | Ga0075370_10005780 | Ga0075370_100057802 | 251 |
| 158 | 3300006948 | Ga0099826_10000602 | Ga0099826_100006029 | 251 |
| 159 | 3300009148 | Ga0105243_10097697 | Ga0105243_100976973 | 251 |
| 160 | 3300009148 | Ga0105243_10100672 | Ga0105243_101006722 | 251 |
| 161 | 3300013100 | Ga0157373_10002871 | Ga0157373_1000287110 | 251 |
| 162 | 3300014497 | Ga0182008_10000576 | Ga0182008_1000057623 | 251 |
| 163 | 3300014497 | Ga0182008_10027924 | Ga0182008_100279242 | 251 |
| 164 | 3300014745 | Ga0157377_10154473 | Ga0157377_101544731 | 251 |
| 165 | 3300025263 | Ga0209565_1000144 | Ga0209565_100014429 | 251 |
| 166 | 3300025273 | Ga0209673_1000136 | Ga0209673_100013680 | 251 |
| 167 | 3300025291 | Ga0209675_1000071 | Ga0209675_100007180 | 251 |
| 168 | 3300025294 | Ga0209025_1025198 | Ga0209025_10251983 | 251 |
| 169 | 3300025920 | Ga0207649_10016734 | Ga0207649_100167345 | 251 |
| 170 | 3300025932 | Ga0207690_10000831 | Ga0207690_100008314 | 251 |
| 171 | 3300025935 | Ga0207709_10275202 | Ga0207709_102752022 | 251 |
| 172 | 3300025945 | Ga0207679_10000629 | Ga0207679_1000062916 | 251 |
| 173 | 3300025945 | Ga0207679_10128960 | Ga0207679_101289602 | 251 |
| 174 | 3300027666 | Ga0209282_1001014 | Ga0209282_100101415 | 251 |
| 175 | 3300027876 | Ga0209974_10046757 | Ga0209974_100467572 | 251 |
| 176 | 3300028379 | Ga0268266_10687648 | Ga0268266_106876481 | 251 |
| 177 | 3300028794 | Ga0307515_10086104 | Ga0307515_100861042 | 251 |
| 178 | 3300031456 | Ga0307513_10000363 | Ga0307513_1000036310 | 251 |
| 179 | 3300031456 | Ga0307513_10020161 | Ga0307513_100201615 | 251 |
| 180 | 3300031852 | Ga0307410_10393811 | Ga0307410_103938111 | 251 |
| 181 | 3300032004 | Ga0307414_10307651 | Ga0307414_103076512 | 251 |
| 182 | 3300041404 | Ga0439436_0000577 | Ga0439436_0000577_8328_9110 | 251 |
| 183 | 3300041410 | Ga0439461_0058005 | Ga0439461_0058005_37_819 | 251 |
| 184 | 3300041411 | Ga0439466_0005485 | Ga0439466_0005485_1117_1899 | 251 |
| 185 | 3300041411 | Ga0439466_0043234 | Ga0439466_0043234_472_1254 | 251 |
| 186 | 3300041413 | Ga0439465_0004086 | Ga0439465_0004086_718_1500 | 251 |
| 187 | 3300041997 | Ga0439431_0009932 | Ga0439431_0009932_814_1596 | 251 |
| 188 | 3300042004 | Ga0439445_0010557 | Ga0439445_0010557_1379_2161 | 251 |
| 189 | 3300042007 | Ga0439449_0013756 | Ga0439449_0013756_993_1775 | 251 |
| 190 | 3300042121 | Ga0450919_000255 | Ga0450919_000255_2716_3504 | 251 |
| 191 | 3300042122 | Ga0450920_023133 | Ga0450920_023133_331_1113 | 251 |
| 192 | 3300042123 | Ga0450921_000010 | Ga0450921_000010_375_1157 | 251 |
| 193 | 3300042124 | Ga0450922_002601 | Ga0450922_002601_429_1217 | 251 |
| 194 | 3300042125 | Ga0450923_009380 | Ga0450923_009380_362_1144 | 251 |
| 195 | 3300042133 | Ga0450896_007953 | Ga0450896_007953_613_1395 | 251 |
| 196 | 3300042145 | Ga0450906_000177 | Ga0450906_000177_7078_7860 | 251 |
| 197 | 3300042147 | Ga0450910_001389 | Ga0450910_001389_212_994 | 251 |
| 198 | 3300042184 | Ga0450908_000284 | Ga0450908_000284_4742_5524 | 251 |
| 199 | 3300042185 | Ga0450909_004267 | Ga0450909_004267_170_952 | 251 |
| 200 | 3300042435 | Ga0439434_0001778 | Ga0439434_0001778_476_1258 | 251 |
| 201 | 3300042532 | Ga0450893_0002079 | Ga0450893_0002079_338_1120 | 251 |
| 202 | 3300046460 | Ga0495638_0156897 | Ga0495638_0156897_217_990 | 251 |
| 203 | 3300046519 | Ga0495632_0104152 | Ga0495632_0104152_493_1266 | 251 |
| 204 | 3300046674 | Ga0495588_0034944 | Ga0495588_0034944_1592_2374 | 251 |
| 205 | 3300047472 | Ga0495686_0001324 | Ga0495686_0001324_7050_7817 | 251 |
| 206 | 3300049679 | Ga0501249_001626 | Ga0501249_001626_106_888 | 251 |
| 207 | 3300049705 | Ga0501225_0001971 | Ga0501225_0001971_3768_4550 | 251 |
| 208 | 3300049758 | Ga0501241_022096 | Ga0501241_022096_130_912 | 251 |
| 209 | 3300049759 | Ga0501262_003655 | Ga0501262_003655_333_1115 | 251 |
| 210 | 3300050489 | nmdc:mga03683_169068_c1 | nmdc:mga03683_169068_c1_190_972 | 251 |
| 211 | 3300050494 | nmdc:mga06z11_113638_c1 | nmdc:mga06z11_113638_c1_570_1352 | 251 |
| 212 | 3300050496 | nmdc:mga07m45_1068_c1 | nmdc:mga07m45_1068_c1_7900_8682 | 251 |
| 213 | 3300050516 | nmdc:mga0sz30_19810_c1 | nmdc:mga0sz30_19810_c1_935_1717 | 251 |
| 214 | 3300053145 | Ga0500586_057179 | Ga0500586_057179_301_1083 | 251 |
| 215 | 3300055283 | Ga0500661_011135 | Ga0500661_011135_479_1405 | 251 |
| 216 | iso_pu_bacteria | 2643221683 | 2644465713 | 251 |
| 217 | 3300002987 | JGI25159J45721_1004735 | JGI25159J45721_10047353 | 252 |
| 218 | 3300003187 | JGI25151J46595_10001596 | JGI25151J46595_100015964 | 252 |
| 219 | 3300003187 | JGI25151J46595_10006401 | JGI25151J46595_100064012 | 252 |
| 220 | 3300003773 | Ga0055537_1000531 | Ga0055537_100053118 | 252 |
| 221 | 3300003775 | Ga0055524_1000745 | Ga0055524_100074518 | 252 |
| 222 | 3300003775 | Ga0055524_1000767 | Ga0055524_10007672 | 252 |
| 223 | 3300003781 | Ga0055536_1000720 | Ga0055536_100072018 | 252 |
| 224 | 3300003784 | Ga0055534_1003354 | Ga0055534_10033541 | 252 |
| 225 | 3300003790 | Ga0055528_1000781 | Ga0055528_10007814 | 252 |
| 226 | 3300003791 | Ga0055530_10001037 | Ga0055530_1000103718 | 252 |
| 227 | 3300003791 | Ga0055530_10003752 | Ga0055530_100037524 | 252 |
| 228 | 3300003791 | Ga0055530_10038202 | Ga0055530_100382022 | 252 |
| 229 | 3300003792 | Ga0055540_1000093 | Ga0055540_100009371 | 252 |
| 230 | 3300003792 | Ga0055540_1000741 | Ga0055540_100074118 | 252 |
| 231 | 3300003794 | Ga0055531_10001021 | Ga0055531_1000102118 | 252 |
| 232 | 3300003794 | Ga0055531_10001290 | Ga0055531_1000129012 | 252 |
| 233 | 3300005539 | Ga0068853_100075499 | Ga0068853_1000754994 | 252 |
| 234 | 3300005844 | Ga0068862_100009180 | Ga0068862_1000091803 | 252 |
| 235 | 3300006946 | Ga0079104_1000138 | Ga0079104_100013874 | 252 |
| 236 | 3300009148 | Ga0105243_10008019 | Ga0105243_100080193 | 252 |
| 237 | 3300009177 | Ga0105248_10455718 | Ga0105248_104557182 | 252 |
| 238 | 3300013306 | Ga0163162_10013289 | Ga0163162_100132897 | 252 |
| 239 | 3300013306 | Ga0163162_10233665 | Ga0163162_102336652 | 252 |
| 240 | 3300014325 | Ga0163163_10200859 | Ga0163163_102008592 | 252 |
| 241 | 3300025263 | Ga0209565_1000061 | Ga0209565_1000061108 | 252 |
| 242 | 3300025263 | Ga0209565_1011667 | Ga0209565_10116672 | 252 |
| 243 | 3300025273 | Ga0209673_1000491 | Ga0209673_100049110 | 252 |
| 244 | 3300025284 | Ga0209130_1000986 | Ga0209130_100098618 | 252 |
| 245 | 3300025291 | Ga0209675_1000105 | Ga0209675_100010578 | 252 |
| 246 | 3300025291 | Ga0209675_1017091 | Ga0209675_10170912 | 252 |
| 247 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013572 | 252 |
| 248 | 3300025292 | Ga0209676_1000153 | Ga0209676_1000153142 | 252 |
| 249 | 3300025294 | Ga0209025_1009876 | Ga0209025_10098762 | 252 |
| 250 | 3300025295 | Ga0209564_1000181 | Ga0209564_1000181124 | 252 |
| 251 | 3300025295 | Ga0209564_1007727 | Ga0209564_10077274 | 252 |
| 252 | 3300025297 | Ga0209758_1010275 | Ga0209758_10102755 | 252 |
| 253 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008572 | 252 |
| 254 | 3300025298 | Ga0209050_1000665 | Ga0209050_100066523 | 252 |
| 255 | 3300025298 | Ga0209050_1008965 | Ga0209050_10089654 | 252 |
| 256 | 3300025299 | Ga0209256_1000039 | Ga0209256_1000039171 | 252 |
| 257 | 3300025299 | Ga0209256_1000627 | Ga0209256_100062719 | 252 |
| 258 | 3300025302 | Ga0207426_1001759 | Ga0207426_10017599 | 252 |
| 259 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004426 | 252 |
| 260 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005572 | 252 |
| 261 | 3300025304 | Ga0209257_1000031 | Ga0209257_1000031162 | 252 |
| 262 | 3300025304 | Ga0209257_1000038 | Ga0209257_1000038560 | 252 |
| 263 | 3300025304 | Ga0209257_1011998 | Ga0209257_10119982 | 252 |
| 264 | 3300026041 | Ga0207639_10045961 | Ga0207639_100459611 | 252 |
| 265 | 3300027111 | Ga0209281_1000023 | Ga0209281_1000023458 | 252 |
| 266 | 3300028380 | Ga0268265_10013608 | Ga0268265_100136081 | 252 |
| 267 | 3300030731 | Ga0316177_1125066 | Ga0316177_11250664 | 252 |
| 268 | 3300030732 | Ga0316176_1125671 | Ga0316176_11256713 | 252 |
| 269 | 3300030733 | Ga0314311_1145075 | Ga0314311_11450753 | 252 |
| 270 | 3300030735 | Ga0316178_1137182 | Ga0316178_11371824 | 252 |
| 271 | 3300030736 | Ga0316180_1140543 | Ga0316180_11405437 | 252 |
| 272 | 3300030742 | Ga0316183_1031124 | Ga0316183_10311244 | 252 |
| 273 | 3300030744 | Ga0316181_1056362 | Ga0316181_10563622 | 252 |
| 274 | 3300031649 | Ga0307514_10034102 | Ga0307514_100341024 | 252 |
| 275 | 3300031731 | Ga0307405_10192694 | Ga0307405_101926942 | 252 |
| 276 | 3300031911 | Ga0307412_10030876 | Ga0307412_100308762 | 252 |
| 277 | 3300032002 | Ga0307416_100165913 | Ga0307416_1001659132 | 252 |
| 278 | 3300032126 | Ga0307415_100216161 | Ga0307415_1002161612 | 252 |
| 279 | 3300046453 | Ga0495627_004467 | Ga0495627_004467_2759_3544 | 252 |
| 280 | 3300046475 | Ga0495639_0003270 | Ga0495639_0003270_5339_6124 | 252 |
| 281 | 3300046512 | Ga0495610_0066383 | Ga0495610_0066383_670_1455 | 252 |
| 282 | 3300046515 | Ga0495620_0003841 | Ga0495620_0003841_3979_4764 | 252 |
| 283 | 3300046535 | Ga0495586_0256543 | Ga0495586_0256543_137_922 | 252 |
| 284 | 3300046539 | Ga0495621_0014308 | Ga0495621_0014308_1285_2070 | 252 |
| 285 | 3300046615 | Ga0495656_0007178 | Ga0495656_0007178_535_1320 | 252 |
| 286 | 3300046616 | Ga0495668_0086498 | Ga0495668_0086498_603_1388 | 252 |
| 287 | 3300046660 | Ga0495625_0001405 | Ga0495625_0001405_13971_14756 | 252 |
| 288 | 3300046674 | Ga0495588_0003846 | Ga0495588_0003846_4866_5651 | 252 |
| 289 | 3300046674 | Ga0495588_0016176 | Ga0495588_0016176_1323_2108 | 252 |
| 290 | 3300046692 | Ga0495671_0001138 | Ga0495671_0001138_8483_9268 | 252 |
| 291 | 3300046810 | Ga0495660_0076794 | Ga0495660_0076794_701_1486 | 252 |
| 292 | 3300047317 | Ga0495604_0422391 | Ga0495604_0422391_61_846 | 252 |
| 293 | 3300047445 | Ga0495677_0072579 | Ga0495677_0072579_288_1073 | 252 |
| 294 | 3300047470 | Ga0495681_0040262 | Ga0495681_0040262_1313_2098 | 252 |
| 295 | 3300048089 | Ga0495614_0086853 | Ga0495614_0086853_46_831 | 252 |
| 296 | 3300048090 | Ga0495615_0008575 | Ga0495615_0008575_581_1366 | 252 |
| 297 | 3300048903 | Ga0496100_0004722 | Ga0496100_0004722_2343_3128 | 252 |
| 298 | 3300048904 | Ga0496101_0040256 | Ga0496101_0040256_1496_2281 | 252 |
| 299 | 3300048905 | Ga0496102_0012945 | Ga0496102_0012945_5685_6470 | 252 |
| 300 | 3300048906 | Ga0496103_0015323 | Ga0496103_0015323_3665_4450 | 252 |
| 301 | 3300048907 | Ga0496104_0004468 | Ga0496104_0004468_7135_7920 | 252 |
| 302 | 3300048908 | Ga0496105_0016042 | Ga0496105_0016042_842_1627 | 252 |
| 303 | 3300048910 | Ga0496107_0041542 | Ga0496107_0041542_107_892 | 252 |
| 304 | 3300048912 | Ga0496109_0202561 | Ga0496109_0202561_235_1020 | 252 |
| 305 | 3300048917 | Ga0496114_0101262 | Ga0496114_0101262_686_1471 | 252 |
| 306 | 3300048917 | Ga0496114_0171631 | Ga0496114_0171631_849_1640 | 252 |
| 307 | 3300048917 | Ga0496114_0233896 | Ga0496114_0233896_333_1118 | 252 |
| 308 | 3300050489 | nmdc:mga03683_3922_c1 | nmdc:mga03683_3922_c1_1729_2514 | 252 |
| 309 | 3300050490 | nmdc:mga03n38_193078_c1 | nmdc:mga03n38_193078_c1_214_999 | 252 |
| 310 | 3300050496 | nmdc:mga07m45_1331_c1 | nmdc:mga07m45_1331_c1_8355_9140 | 252 |
| 311 | 3300053079 | Ga0500610_0000623 | Ga0500610_0000623_9095_9880 | 252 |
| 312 | 3300053079 | Ga0500610_0022859 | Ga0500610_0022859_667_1452 | 252 |
| 313 | 3300053088 | Ga0500644_0015506 | Ga0500644_0015506_1012_1998 | 252 |
| 314 | 3300053109 | Ga0500569_035346 | Ga0500569_035346_276_1061 | 252 |
| 315 | 3300053117 | Ga0500593_000059 | Ga0500593_000059_30653_31438 | 252 |
| 316 | 3300053158 | Ga0500627_0006385 | Ga0500627_0006385_2665_3450 | 252 |
| 317 | 3300053161 | Ga0500634_0113864 | Ga0500634_0113864_334_1119 | 252 |
| 318 | 3300053730 | Ga0500645_005051 | Ga0500645_005051_3239_4174 | 252 |
| 319 | iso_pu_bacteria | 2928115317 | 2928116691 | 252 |
| 320 | 3300003187 | JGI25151J46595_10004808 | JGI25151J46595_100048086 | 253 |
| 321 | 3300003322 | rootL2_10008715 | rootL2_100087153 | 253 |
| 322 | 3300003781 | Ga0055536_1001424 | Ga0055536_10014249 | 253 |
| 323 | 3300005578 | Ga0068854_100246120 | Ga0068854_1002461202 | 253 |
| 324 | 3300006051 | Ga0075364_10131360 | Ga0075364_101313602 | 253 |
| 325 | 3300009148 | Ga0105243_10001333 | Ga0105243_100013338 | 253 |
| 326 | 3300012502 | Ga0157347_1000943 | Ga0157347_10009432 | 253 |
| 327 | 3300025292 | Ga0209676_1000241 | Ga0209676_100024193 | 253 |
| 328 | 3300025294 | Ga0209025_1000661 | Ga0209025_100066118 | 253 |
| 329 | 3300025294 | Ga0209025_1056584 | Ga0209025_10565842 | 253 |
| 330 | 3300025298 | Ga0209050_1011384 | Ga0209050_10113842 | 253 |
| 331 | 3300025303 | Ga0209051_1000180 | Ga0209051_100018065 | 253 |
| 332 | 3300025935 | Ga0207709_10000438 | Ga0207709_100004389 | 253 |
| 333 | 3300025935 | Ga0207709_10001829 | Ga0207709_100018295 | 253 |
| 334 | 3300031731 | Ga0307405_10654448 | Ga0307405_106544481 | 253 |
| 335 | 3300032005 | Ga0307411_10093870 | Ga0307411_100938702 | 253 |
| 336 | 3300041458 | Ga0451798_0974092 | Ga0451798_0974092_382_1185 | 253 |
| 337 | iso_pu_bacteria | 2513020051 | 2513229861 | 253 |
| 338 | iso_pu_bacteria | 2643221658 | 2644327268 | 253 |
| 339 | iso_pu_bacteria | 2643221672 | 2644401872 | 253 |
| 340 | iso_pu_bacteria | 2928084124 | 2928085381 | 253 |
| 341 | iso_pu_bacteria | 2929160207 | 2929160217 | 253 |
| 342 | 3300005354 | Ga0070675_100276520 | Ga0070675_1002765202 | 254 |
| 343 | 3300005354 | Ga0070675_100352101 | Ga0070675_1003521012 | 254 |
| 344 | 3300005367 | Ga0070667_100054862 | Ga0070667_1000548624 | 254 |
| 345 | 3300005445 | Ga0070708_100582211 | Ga0070708_1005822111 | 254 |
| 346 | 3300005467 | Ga0070706_100004228 | Ga0070706_10000422816 | 254 |
| 347 | 3300005468 | Ga0070707_100025621 | Ga0070707_1000256214 | 254 |
| 348 | 3300005471 | Ga0070698_100136261 | Ga0070698_1001362612 | 254 |
| 349 | 3300005564 | Ga0070664_100282323 | Ga0070664_1002823232 | 254 |
| 350 | 3300006178 | Ga0075367_10027470 | Ga0075367_100274702 | 254 |
| 351 | 3300006195 | Ga0075366_10007139 | Ga0075366_100071399 | 254 |
| 352 | 3300006195 | Ga0075366_10073824 | Ga0075366_100738242 | 254 |
| 353 | 3300006353 | Ga0075370_10001864 | Ga0075370_100018642 | 254 |
| 354 | 3300006353 | Ga0075370_10026714 | Ga0075370_100267142 | 254 |
| 355 | 3300014497 | Ga0182008_10004502 | Ga0182008_100045026 | 254 |
| 356 | 3300015261 | Ga0182006_1010480 | Ga0182006_10104804 | 254 |
| 357 | 3300015262 | Ga0182007_10003951 | Ga0182007_100039512 | 254 |
| 358 | 3300015683 | Ga0183362_10004 | Ga0183362_10004269 | 254 |
| 359 | 3300025893 | Ga0207682_10113368 | Ga0207682_101133681 | 254 |
| 360 | 3300025910 | Ga0207684_10108260 | Ga0207684_101082602 | 254 |
| 361 | 3300025922 | Ga0207646_10054700 | Ga0207646_100547003 | 254 |
| 362 | 3300025986 | Ga0207658_10067427 | Ga0207658_100674272 | 254 |
| 363 | 3300026067 | Ga0207678_10351296 | Ga0207678_103512962 | 254 |
| 364 | 3300050493 | nmdc:mga0k408_76349_c1 | nmdc:mga0k408_76349_c1_1085_1876 | 254 |
| 365 | 3300050496 | nmdc:mga07m45_59709_c1 | nmdc:mga07m45_59709_c1_231_1022 | 254 |
| 366 | iso_pu_bacteria | 2597489888 | 2597866252 | 254 |
| 367 | iso_pu_bacteria | 2597489889 | 2597872087 | 254 |
| 368 | iso_pu_bacteria | 2599185189 | 2599509739 | 254 |
| 369 | iso_pu_bacteria | 2599185214 | 2599621515 | 254 |
| 370 | iso_pu_bacteria | 2599185226 | 2599670801 | 254 |
| 371 | iso_pu_bacteria | 2599185227 | 2599679291 | 254 |
| 372 | iso_pu_bacteria | 2599185229 | 2599691026 | 254 |
| 373 | iso_pu_bacteria | 2599185303 | 2599951889 | 254 |
| 374 | iso_pu_bacteria | 2600255296 | 2601693811 | 254 |
| 375 | iso_pu_bacteria | 2643221571 | 2643870802 | 254 |
| 376 | iso_pu_bacteria | 2643221713 | 2644621310 | 254 |
| 377 | iso_pu_bacteria | 2675903420 | 2677899051 | 254 |
| 378 | iso_pu_bacteria | 2721755607 | 2723250988 | 254 |
| 379 | iso_pu_bacteria | 2831265667 | 2831268673 | 254 |
| 380 | iso_pu_bacteria | 2838054893 | 2838058103 | 254 |
| 381 | iso_pu_bacteria | 2842826826 | 2842829022 | 254 |
| 382 | iso_pu_bacteria | 2842837860 | 2842840539 | 254 |
| 383 | iso_pu_bacteria | 2860867994 | 2860872649 | 254 |
| 384 | iso_pu_bacteria | 2928070936 | 2928072173 | 254 |
| 385 | iso_pu_bacteria | 2946027586 | 2946033253 | 254 |
| 386 | iso_pu_bacteria | 2947233263 | 2947234041 | 254 |
| 387 | iso_pu_bacteria | 8054347763 | 8054352897 | 254 |
| 388 | iso_pu_bacteria | 8056148874 | 8056151871 | 254 |
| 389 | 3300003781 | Ga0055536_1002738 | Ga0055536_100273811 | 255 |
| 390 | 3300003791 | Ga0055530_10005730 | Ga0055530_100057302 | 255 |
| 391 | 3300003792 | Ga0055540_1001063 | Ga0055540_100106310 | 255 |
| 392 | 3300003794 | Ga0055531_10001334 | Ga0055531_1000133410 | 255 |
| 393 | 3300005344 | Ga0070661_100234577 | Ga0070661_1002345772 | 255 |
| 394 | 3300005366 | Ga0070659_100027253 | Ga0070659_1000272534 | 255 |
| 395 | 3300005548 | Ga0070665_100265496 | Ga0070665_1002654962 | 255 |
| 396 | 3300005578 | Ga0068854_100036610 | Ga0068854_1000366103 | 255 |
| 397 | 3300006353 | Ga0075370_10017703 | Ga0075370_100177034 | 255 |
| 398 | 3300006353 | Ga0075370_10117912 | Ga0075370_101179122 | 255 |
| 399 | 3300006358 | Ga0068871_100299153 | Ga0068871_1002991531 | 255 |
| 400 | 3300009036 | Ga0105244_10007210 | Ga0105244_100072106 | 255 |
| 401 | 3300014497 | Ga0182008_10003516 | Ga0182008_100035165 | 255 |
| 402 | 3300015261 | Ga0182006_1001381 | Ga0182006_100138111 | 255 |
| 403 | 3300015262 | Ga0182007_10000214 | Ga0182007_1000021411 | 255 |
| 404 | 3300017792 | Ga0163161_10146045 | Ga0163161_101460452 | 255 |
| 405 | 3300025245 | Ga0207425_1001469 | Ga0207425_10014696 | 255 |
| 406 | 3300025258 | Ga0209129_1000297 | Ga0209129_100029742 | 255 |
| 407 | 3300025284 | Ga0209130_1000392 | Ga0209130_100039215 | 255 |
| 408 | 3300025292 | Ga0209676_1000496 | Ga0209676_100049614 | 255 |
| 409 | 3300025292 | Ga0209676_1005991 | Ga0209676_10059916 | 255 |
| 410 | 3300025294 | Ga0209025_1000410 | Ga0209025_100041022 | 255 |
| 411 | 3300025294 | Ga0209025_1000627 | Ga0209025_100062745 | 255 |
| 412 | 3300025295 | Ga0209564_1000110 | Ga0209564_1000110188 | 255 |
| 413 | 3300025297 | Ga0209758_1000039 | Ga0209758_1000039188 | 255 |
| 414 | 3300025298 | Ga0209050_1000484 | Ga0209050_100048452 | 255 |
| 415 | 3300025299 | Ga0209256_1000074 | Ga0209256_1000074188 | 255 |
| 416 | 3300025302 | Ga0207426_1000121 | Ga0207426_1000121187 | 255 |
| 417 | 3300025303 | Ga0209051_1000081 | Ga0209051_1000081180 | 255 |
| 418 | 3300025304 | Ga0209257_1000565 | Ga0209257_100056513 | 255 |
| 419 | 3300025304 | Ga0209257_1004562 | Ga0209257_10045628 | 255 |
| 420 | 3300025728 | Ga0207655_1001161 | Ga0207655_100116121 | 255 |
| 421 | 3300025924 | Ga0207694_10017236 | Ga0207694_100172364 | 255 |
| 422 | 3300025932 | Ga0207690_10069140 | Ga0207690_100691403 | 255 |
| 423 | 3300025935 | Ga0207709_10001037 | Ga0207709_1000103717 | 255 |
| 424 | 3300025945 | Ga0207679_10028463 | Ga0207679_100284632 | 255 |
| 425 | 3300025981 | Ga0207640_10070623 | Ga0207640_100706232 | 255 |
| 426 | 3300026041 | Ga0207639_10578020 | Ga0207639_105780202 | 255 |
| 427 | 3300026116 | Ga0207674_10064682 | Ga0207674_100646823 | 255 |
| 428 | 3300031548 | Ga0307408_100006099 | Ga0307408_1000060994 | 255 |
| 429 | 3300046460 | Ga0495638_0008100 | Ga0495638_0008100_3982_4776 | 255 |
| 430 | 3300046513 | Ga0495616_0001568 | Ga0495616_0001568_720_1514 | 255 |
| 431 | 3300046518 | Ga0495631_0000004 | Ga0495631_0000004_42486_43280 | 255 |
| 432 | 3300046520 | Ga0495637_0012316 | Ga0495637_0012316_991_1785 | 255 |
| 433 | 3300046530 | Ga0495654_0003251 | Ga0495654_0003251_7539_8333 | 255 |
| 434 | 3300046539 | Ga0495621_0003922 | Ga0495621_0003922_2055_2849 | 255 |
| 435 | 3300046616 | Ga0495668_0036801 | Ga0495668_0036801_405_1199 | 255 |
| 436 | 3300046691 | Ga0495670_0058771 | Ga0495670_0058771_1099_1893 | 255 |
| 437 | 3300048906 | Ga0496103_0099165 | Ga0496103_0099165_135_929 | 255 |
| 438 | 3300048921 | Ga0496118_0023238 | Ga0496118_0023238_2216_3010 | 255 |
| 439 | 3300048925 | Ga0496122_0090371 | Ga0496122_0090371_745_1539 | 255 |
| 440 | 3300048927 | Ga0496124_0010612 | Ga0496124_0010612_724_1518 | 255 |
| 441 | 3300048928 | Ga0496125_0013523 | Ga0496125_0013523_1213_2007 | 255 |
| 442 | 3300050496 | nmdc:mga07m45_13831_c1 | nmdc:mga07m45_13831_c1_304_1098 | 255 |
| 443 | 3300053108 | Ga0500562_032310 | Ga0500562_032310_384_1178 | 255 |
| 444 | 3300053118 | Ga0500594_0004945 | Ga0500594_0004945_376_1170 | 255 |
| 445 | 3300053134 | Ga0500658_0000057 | Ga0500658_0000057_53689_54483 | 255 |
| 446 | 3300053136 | Ga0500559_0006069 | Ga0500559_0006069_1817_2611 | 255 |
| 447 | 3300053139 | Ga0500568_0035770 | Ga0500568_0035770_1063_1857 | 255 |
| 448 | 3300053141 | Ga0500574_031600 | Ga0500574_031600_556_1350 | 255 |
| 449 | iso_pu_bacteria | 2738541307 | 2738883563 | 255 |
| 450 | iso_pu_bacteria | 2808606385 | 2808977468 | 255 |
| 451 | iso_pu_bacteria | 2808606388 | 2808992874 | 255 |
| 452 | iso_pu_bacteria | 2852612431 | 2852618030 | 255 |
| 453 | iso_pu_bacteria | 2852667396 | 2852673088 | 255 |
| 454 | iso_pu_bacteria | 8054503363 | 8054508536 | 255 |
| 455 | 3300003215 | JGI25153J46596_10005472 | JGI25153J46596_100054727 | 256 |
| 456 | 3300003773 | Ga0055537_1003327 | Ga0055537_10033275 | 256 |
| 457 | 3300003781 | Ga0055536_1002250 | Ga0055536_100225010 | 256 |
| 458 | 3300003790 | Ga0055528_1007163 | Ga0055528_10071635 | 256 |
| 459 | 3300005328 | Ga0070676_10002485 | Ga0070676_100024856 | 256 |
| 460 | 3300005331 | Ga0070670_100011859 | Ga0070670_1000118595 | 256 |
| 461 | 3300005334 | Ga0068869_100008447 | Ga0068869_1000084475 | 256 |
| 462 | 3300005338 | Ga0068868_100010456 | Ga0068868_1000104562 | 256 |
| 463 | 3300005354 | Ga0070675_100026636 | Ga0070675_1000266364 | 256 |
| 464 | 3300005355 | Ga0070671_100007238 | Ga0070671_1000072384 | 256 |
| 465 | 3300005364 | Ga0070673_100009194 | Ga0070673_1000091942 | 256 |
| 466 | 3300005455 | Ga0070663_100424534 | Ga0070663_1004245341 | 256 |
| 467 | 3300005457 | Ga0070662_100040555 | Ga0070662_1000405552 | 256 |
| 468 | 3300005459 | Ga0068867_100005860 | Ga0068867_1000058605 | 256 |
| 469 | 3300005543 | Ga0070672_100026650 | Ga0070672_1000266502 | 256 |
| 470 | 3300005840 | Ga0068870_10019671 | Ga0068870_100196713 | 256 |
| 471 | 3300025258 | Ga0209129_1003087 | Ga0209129_10030873 | 256 |
| 472 | 3300025263 | Ga0209565_1001048 | Ga0209565_10010486 | 256 |
| 473 | 3300025263 | Ga0209565_1002757 | Ga0209565_10027574 | 256 |
| 474 | 3300025273 | Ga0209673_1000396 | Ga0209673_100039615 | 256 |
| 475 | 3300025273 | Ga0209673_1004732 | Ga0209673_10047324 | 256 |
| 476 | 3300025291 | Ga0209675_1003680 | Ga0209675_10036804 | 256 |
| 477 | 3300025292 | Ga0209676_1000167 | Ga0209676_100016767 | 256 |
| 478 | 3300025294 | Ga0209025_1009005 | Ga0209025_10090054 | 256 |
| 479 | 3300025295 | Ga0209564_1000123 | Ga0209564_1000123155 | 256 |
| 480 | 3300025297 | Ga0209758_1002335 | Ga0209758_100233514 | 256 |
| 481 | 3300025298 | Ga0209050_1000015 | Ga0209050_1000015532 | 256 |
| 482 | 3300025298 | Ga0209050_1000285 | Ga0209050_100028540 | 256 |
| 483 | 3300025299 | Ga0209256_1000082 | Ga0209256_1000082173 | 256 |
| 484 | 3300025302 | Ga0207426_1000112 | Ga0207426_100011228 | 256 |
| 485 | 3300025303 | Ga0209051_1000010 | Ga0209051_1000010532 | 256 |
| 486 | 3300025304 | Ga0209257_1000026 | Ga0209257_1000026145 | 256 |
| 487 | 3300025907 | Ga0207645_10001047 | Ga0207645_1000104714 | 256 |
| 488 | 3300025908 | Ga0207643_10015932 | Ga0207643_100159324 | 256 |
| 489 | 3300025925 | Ga0207650_10053364 | Ga0207650_100533642 | 256 |
| 490 | 3300025926 | Ga0207659_10096189 | Ga0207659_100961891 | 256 |
| 491 | 3300025926 | Ga0207659_10097561 | Ga0207659_100975612 | 256 |
| 492 | 3300025927 | Ga0207687_10011653 | Ga0207687_100116532 | 256 |
| 493 | 3300025931 | Ga0207644_10008031 | Ga0207644_100080314 | 256 |
| 494 | 3300025933 | Ga0207706_10034320 | Ga0207706_100343203 | 256 |
| 495 | 3300025933 | Ga0207706_10049084 | Ga0207706_100490843 | 256 |
| 496 | 3300025935 | Ga0207709_10044923 | Ga0207709_100449232 | 256 |
| 497 | 3300025940 | Ga0207691_10037655 | Ga0207691_100376554 | 256 |
| 498 | 3300025945 | Ga0207679_10036045 | Ga0207679_100360453 | 256 |
| 499 | 3300025960 | Ga0207651_10020643 | Ga0207651_100206434 | 256 |
| 500 | 3300026023 | Ga0207677_10038114 | Ga0207677_100381142 | 256 |
| 501 | 3300026089 | Ga0207648_10010248 | Ga0207648_100102485 | 256 |
| 502 | 3300026116 | Ga0207674_10017241 | Ga0207674_100172416 | 256 |
| 503 | 3300031901 | Ga0307406_10043596 | Ga0307406_100435962 | 256 |
| 504 | 3300046683 | Ga0495658_0018269 | Ga0495658_0018269_389_1189 | 256 |
| 505 | 3300046690 | Ga0495624_0024245 | Ga0495624_0024245_2506_3306 | 256 |
| 506 | 3300047321 | Ga0495676_0077602 | Ga0495676_0077602_694_1494 | 256 |
| 507 | 3300047673 | Ga0495593_0000598 | Ga0495593_0000598_16420_17220 | 256 |
| 508 | 3300048089 | Ga0495614_0049802 | Ga0495614_0049802_476_1276 | 256 |
| 509 | 3300048922 | Ga0496119_0053573 | Ga0496119_0053573_375_1151 | 256 |
| 510 | 3300050493 | nmdc:mga0k408_52510_c1 | nmdc:mga0k408_52510_c1_257_1105 | 256 |
| 511 | 3300050496 | nmdc:mga07m45_127127_c1 | nmdc:mga07m45_127127_c1_523_1323 | 256 |
| 512 | 3300053093 | Ga0500651_0000079 | Ga0500651_0000079_5371_6171 | 256 |
| 513 | 3300053094 | Ga0500566_0002061 | Ga0500566_0002061_10875_11675 | 256 |
| 514 | 3300053110 | Ga0500571_000018 | Ga0500571_000018_22507_23307 | 256 |
| 515 | 3300053120 | Ga0500597_021070 | Ga0500597_021070_1017_1817 | 256 |
| 516 | 3300053133 | Ga0500655_000774 | Ga0500655_000774_4864_5664 | 256 |
| 517 | 3300053134 | Ga0500658_0000456 | Ga0500658_0000456_1238_2038 | 256 |
| 518 | 3300053161 | Ga0500634_0060278 | Ga0500634_0060278_297_1097 | 256 |
| 519 | 3300053162 | Ga0500638_004202 | Ga0500638_004202_4647_5447 | 256 |
| 520 | iso_pu_bacteria | 2511231002 | 2511242693 | 256 |
| 521 | iso_pu_bacteria | 2818991446 | 2819597681 | 256 |
| 522 | iso_pu_bacteria | 2899924645 | 2899929100 | 256 |
| 523 | iso_pu_bacteria | 2928037797 | 2928040465 | 256 |
| 524 | iso_pu_bacteria | 2928044640 | 2928046786 | 256 |
| 525 | iso_pu_bacteria | 2928051484 | 2928058025 | 256 |
| 526 | iso_pu_bacteria | 2928064002 | 2928067634 | 256 |
| 527 | 3300003578 | Ga0006562J51391_1034746 | Ga0006562J51391_10347464 | 257 |
| 528 | 3300005539 | Ga0068853_100020374 | Ga0068853_1000203742 | 257 |
| 529 | 3300013104 | Ga0157370_10209073 | Ga0157370_102090732 | 257 |
| 530 | 3300013306 | Ga0163162_10488083 | Ga0163162_104880832 | 257 |
| 531 | 3300041997 | Ga0439431_0022070 | Ga0439431_0022070_248_1039 | 257 |
| 532 | 3300048921 | Ga0496118_0008367 | Ga0496118_0008367_5742_6587 | 257 |
| 533 | 3300048925 | Ga0496122_0035479 | Ga0496122_0035479_734_1570 | 257 |
| 534 | 3300048926 | Ga0496123_0099622 | Ga0496123_0099622_833_1678 | 257 |
| 535 | 3300049459 | Ga0495678_063637 | Ga0495678_063637_183_1019 | 257 |
| 536 | 3300049579 | Ga0501043_0000071 | Ga0501043_0000071_17302_18096 | 257 |
| 537 | 3300049580 | Ga0501046_0000311 | Ga0501046_0000311_17300_18094 | 257 |
| 538 | 3300049581 | Ga0501047_0000087 | Ga0501047_0000087_99242_100036 | 257 |
| 539 | 3300049582 | Ga0501048_0000226 | Ga0501048_0000226_34999_35793 | 257 |
| 540 | 3300049824 | Ga0501045_0009015 | Ga0501045_0009015_81_875 | 257 |
| 541 | 3300002738 | JGI25154J39366_1002691 | JGI25154J39366_10026912 | 258 |
| 542 | 3300003316 | rootH1_10067063 | rootH1_100670634 | 258 |
| 543 | 3300003320 | rootH2_10034396 | rootH2_100343964 | 258 |
| 544 | 3300003323 | rootH1_10081743 | rootH1_100817435 | 258 |
| 545 | 3300003751 | Ga0055538_1000042 | Ga0055538_1000042117 | 258 |
| 546 | 3300003752 | Ga0055539_1000055 | Ga0055539_1000055117 | 258 |
| 547 | 3300003756 | Ga0055533_1000067 | Ga0055533_1000067117 | 258 |
| 548 | 3300003758 | Ga0055532_1000053 | Ga0055532_1000053117 | 258 |
| 549 | 3300003759 | Ga0055525_1000103 | Ga0055525_100010319 | 258 |
| 550 | 3300003760 | Ga0055527_1007239 | Ga0055527_10072391 | 258 |
| 551 | 3300003761 | Ga0055535_1000133 | Ga0055535_100013378 | 258 |
| 552 | 3300003762 | Ga0055542_1000003 | Ga0055542_1000003370 | 258 |
| 553 | 3300003784 | Ga0055534_1000945 | Ga0055534_10009452 | 258 |
| 554 | 3300003792 | Ga0055540_1025407 | Ga0055540_10254071 | 258 |
| 555 | 3300003841 | Ga0055541_1000042 | Ga0055541_100004260 | 258 |
| 556 | 3300005331 | Ga0070670_100000686 | Ga0070670_10000068611 | 258 |
| 557 | 3300005834 | Ga0068851_10001057 | Ga0068851_100010575 | 258 |
| 558 | 3300006195 | Ga0075366_10001013 | Ga0075366_100010133 | 258 |
| 559 | 3300009092 | Ga0105250_10000691 | Ga0105250_100006915 | 258 |
| 560 | 3300009148 | Ga0105243_10445404 | Ga0105243_104454041 | 258 |
| 561 | 3300013100 | Ga0157373_10035762 | Ga0157373_100357623 | 258 |
| 562 | 3300013102 | Ga0157371_10013100 | Ga0157371_100131006 | 258 |
| 563 | 3300025206 | Ga0209435_100313 | Ga0209435_1003135 | 258 |
| 564 | 3300025224 | Ga0209784_100060 | Ga0209784_10006061 | 258 |
| 565 | 3300025225 | Ga0209566_100075 | Ga0209566_10007561 | 258 |
| 566 | 3300025226 | Ga0209674_100100 | Ga0209674_10010061 | 258 |
| 567 | 3300025228 | Ga0209672_100719 | Ga0209672_1007199 | 258 |
| 568 | 3300025229 | Ga0209147_100096 | Ga0209147_10009661 | 258 |
| 569 | 3300025230 | Ga0209563_100118 | Ga0209563_100118114 | 258 |
| 570 | 3300025233 | Ga0209437_108097 | Ga0209437_1080972 | 258 |
| 571 | 3300025242 | Ga0209258_100015 | Ga0209258_100015489 | 258 |
| 572 | 3300025242 | Ga0209258_100387 | Ga0209258_10038761 | 258 |
| 573 | 3300025245 | Ga0207425_1011362 | Ga0207425_10113622 | 258 |
| 574 | 3300025246 | Ga0209646_1000276 | Ga0209646_100027646 | 258 |
| 575 | 3300025253 | Ga0209677_100057 | Ga0209677_10005761 | 258 |
| 576 | 3300025254 | Ga0209148_1000028 | Ga0209148_1000028180 | 258 |
| 577 | 3300025256 | Ga0209759_1034851 | Ga0209759_10348511 | 258 |
| 578 | 3300025263 | Ga0209565_1001227 | Ga0209565_10012276 | 258 |
| 579 | 3300025273 | Ga0209673_1042389 | Ga0209673_10423892 | 258 |
| 580 | 3300025284 | Ga0209130_1007351 | Ga0209130_10073511 | 258 |
| 581 | 3300025291 | Ga0209675_1000703 | Ga0209675_100070311 | 258 |
| 582 | 3300025291 | Ga0209675_1008294 | Ga0209675_10082944 | 258 |
| 583 | 3300025292 | Ga0209676_1012832 | Ga0209676_10128321 | 258 |
| 584 | 3300025294 | Ga0209025_1037213 | Ga0209025_10372133 | 258 |
| 585 | 3300025295 | Ga0209564_1000247 | Ga0209564_100024717 | 258 |
| 586 | 3300025303 | Ga0209051_1024635 | Ga0209051_10246351 | 258 |
| 587 | 3300025304 | Ga0209257_1010064 | Ga0209257_10100644 | 258 |
| 588 | 3300025321 | Ga0207656_10005408 | Ga0207656_100054084 | 258 |
| 589 | 3300025711 | Ga0207696_1000339 | Ga0207696_100033914 | 258 |
| 590 | 3300025925 | Ga0207650_10000324 | Ga0207650_1000032430 | 258 |
| 591 | 3300028379 | Ga0268266_10052801 | Ga0268266_100528013 | 258 |
| 592 | 3300031730 | Ga0307516_10007238 | Ga0307516_100072388 | 258 |
| 593 | 3300046457 | Ga0495590_0011562 | Ga0495590_0011562_2283_3161 | 258 |
| 594 | 3300046506 | Ga0495583_0001282 | Ga0495583_0001282_7986_8762 | 258 |
| 595 | 3300046519 | Ga0495632_0001652 | Ga0495632_0001652_4707_5585 | 258 |
| 596 | 3300046530 | Ga0495654_0003266 | Ga0495654_0003266_1223_1999 | 258 |
| 597 | 3300046538 | Ga0495609_0104177 | Ga0495609_0104177_129_1007 | 258 |
| 598 | 3300046694 | Ga0495649_0005163 | Ga0495649_0005163_3169_4047 | 258 |
| 599 | 3300046810 | Ga0495660_0035915 | Ga0495660_0035915_1459_2337 | 258 |
| 600 | 3300046810 | Ga0495660_0044478 | Ga0495660_0044478_583_1359 | 258 |
| 601 | 3300047443 | Ga0495687_001439 | Ga0495687_001439_18355_19233 | 258 |
| 602 | 3300048920 | Ga0496117_0004392 | Ga0496117_0004392_7795_8571 | 258 |
| 603 | 3300048921 | Ga0496118_0045244 | Ga0496118_0045244_423_1199 | 258 |
| 604 | 3300048924 | Ga0496121_0030332 | Ga0496121_0030332_2524_3300 | 258 |
| 605 | 3300048925 | Ga0496122_0072657 | Ga0496122_0072657_391_1167 | 258 |
| 606 | 3300048926 | Ga0496123_0048696 | Ga0496123_0048696_1682_2458 | 258 |
| 607 | 3300048929 | Ga0496126_0012012 | Ga0496126_0012012_373_1149 | 258 |
| 608 | 3300053093 | Ga0500651_0004907 | Ga0500651_0004907_2363_3226 | 258 |
| 609 | 3300053730 | Ga0500645_000346 | Ga0500645_000346_18590_19501 | 258 |
| 610 | 3300001915 | JGI24741J21665_1006156 | JGI24741J21665_10061562 | 259 |
| 611 | 3300005288 | Ga0065714_10065214 | Ga0065714_100652144 | 259 |
| 612 | 3300005331 | Ga0070670_100001050 | Ga0070670_10000105010 | 259 |
| 613 | 3300006051 | Ga0075364_10028970 | Ga0075364_100289703 | 259 |
| 614 | 3300009036 | Ga0105244_10003334 | Ga0105244_1000333410 | 259 |
| 615 | 3300013308 | Ga0157375_10018063 | Ga0157375_100180634 | 259 |
| 616 | 3300025925 | Ga0207650_10000278 | Ga0207650_1000027815 | 259 |
| 617 | 3300028786 | Ga0307517_10061150 | Ga0307517_100611502 | 259 |
| 618 | 3300030521 | Ga0307511_10126332 | Ga0307511_101263322 | 259 |
| 619 | 3300046512 | Ga0495610_0004885 | Ga0495610_0004885_7898_8677 | 259 |
| 620 | 3300046530 | Ga0495654_0003434 | Ga0495654_0003434_7900_8679 | 259 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wxk-assembly1.cif.gz_B | earp bound with domain i of ef-p | 0.7981 | 113 | 150 |
| 5inn-assembly3.cif.gz_C | mouse tdp2 d358n protein, apo state with increased disorder amongst variable dna-binding grasp conformations | 0.7818 | 17 | 259 |
| 5inn-assembly3.cif.gz_C | mouse tdp2 d358n protein, apo state with increased disorder amongst variable dna-binding grasp conformations | 0.7756 | 17 | 259 |
| 7di7-assembly1.cif.gz_A | falcilysin in complex with chloroquine | 0.7738 | 111 | 151 |
| 5inm-assembly3.cif.gz_C | mouse tdp2 protein, apo state with variable dna-binding grasp conformations | 0.7696 | 19 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAW1_9_253_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.8685 | 19 | 259 | 3.60.10.10 |
| af_P0AAW1_9_253_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.8521 | 19 | 259 | 3.60.10.10 |
| af_Q9HDZ2_710_875_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.8361 | 24 | 183 | 3.60.10.10 |
| af_P09151_393_501_3.30.160.270 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Alpha-isopropylmalate synthase LeuA, regulatory domain | 0.8294 | 112 | 148 | 3.30.160.270 |
| af_A0A1D6L8D5_102_153_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8032 | 111 | 150 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A455UAP1-F1-model_v4 | Endonuclease/exonuclease/phosphatase domain-containing protein | 0.9714 | 131 | 259 |
GO:0003824
|
| AF-A0A379ULU1-F1-model_v4 | Endonuclease/Exonuclease/ phosphatase family protein | 0.9708 | 145 | 259 |
GO:0004519
GO:0004527 |
| AF-W7W7M8-F1-model_v4 | Endonuclease/exonuclease/phosphatase domain-containing protein | 0.9559 | 109 | 259 |
GO:0003824
GO:0006506 GO:0016020 |
| AF-A0A7H4LWV3-F1-model_v4 | Endonuclease/Exonuclease/phosphatase family protein | 0.9539 | 115 | 259 |
GO:0004519
GO:0004527 |
| AF-A9MIT9-F1-model_v4 | Endonuclease/exonuclease/phosphatase domain-containing protein | 0.9538 | 166 | 259 |
GO:0003824
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar