metagRoot

F469877

General Info

Members	Datasets	Scaffolds	Average Seq Length
619	361	520	308

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|8025478263\|8025479858
Length	339
Sequence	ETPAATASPDPASPDSPAAPAGPALPGPAPTGVPGGSAASVVRPEGPWVHRDVAANGARFHIAEMGDGPLVLLLHGFPQFWWTWRHQLPVLAEAGFRAVAMDLRGVGGSDRTPRGYDPANLALDITGVIRSLGEPDAALVGHDLGGYLAWTAAVMRPKLVRRLAVSSMPHPRRWRSAMLADPRQSSAGSHIWGFQRPWIPERRLVADDAALVGRLMREWSGPRQPEDEAVDTYRRAMTIPSTAHCSIEPYRWMVRSMARPDGIQFNRRMKRPVRVPTLHLHGSLDPVMRTRSAAGSGEYVEAPYRWRLFDGLGHFPHEEDPVAFSTELVNWLKDPEPDR

Samples

	Sample ID	Description	Type	Environment
1	2547132111	Streptomyces sp. TOR3209	Isolate	Rhizosphere
2	2554235005	Streptomyces violaceusniger SPC6	Isolate	Rhizosphere
3	2582581312	Streptomyces atratus OK008	Isolate	Rhizosphere
4	2582581313	Streptomyces mirabilis OV308	Isolate	Rhizosphere
5	2582581314	Streptomyces mirabilis YR139	Isolate	Rhizosphere
6	2616644814	Streptomyces mirabilis OK461	Isolate	Rhizosphere
7	2616644941	Streptomyces atratus OK807	Isolate	Rhizosphere
8	2643221548	Streptomyces sp. Root55	Isolate	Unclassified
9	2643221578	Streptomyces sp. Root63	Isolate	Unclassified
10	2643221587	Streptomyces sp. Root66D1	Isolate	Unclassified
11	2643221647	Streptomyces sp. Root369	Isolate	Unclassified
12	2643221670	Streptomyces sp. Root431	Isolate	Unclassified
13	2643221673	Streptomyces sp. Root1295	Isolate	Unclassified
14	2643221677	Streptomyces sp. Root1304	Isolate	Unclassified
15	2643221678	Streptomyces sp. Root1310	Isolate	Unclassified
16	2643221682	Streptomyces sp. Root1319	Isolate	Unclassified
17	2643221714	Streptomyces sp. Root264	Isolate	Unclassified
18	2767802112	Streptomyces avicenniae NRRL B-24776	Isolate	Rhizosphere
19	2784132148	Streptomyces sp. E5N91 SAI-083	Isolate	Unclassified
20	2784746763	Streptomyces ossamyceticus SAI-001	Isolate	Unclassified
21	2784746768	Streptomyces griseorubiginosus SAI-142	Isolate	Unclassified
22	2786546132	Streptomyces sp. W SAI-097	Isolate	Unclassified
23	2791355406	Streptomyces rhizosphaericus NRRL B-24304	Isolate	Unclassified
24	2802429296	Streptomyces sampsonii KJ40	Isolate	Rhizosphere
25	2808606359	Streptomyces sp. RJA2910	Isolate	Unclassified
26	2808606375	Streptomyces sp. SLBN-31	Isolate	Unclassified
27	2808606448	Streptomyces sp. 193411	Isolate	Unclassified
28	2808606982	Streptomyces sp. SLBN-118	Isolate	Unclassified
29	2811994879	Streptomyces sp. 4-17	Isolate	Unclassified
30	2811994917	Streptomyces sp. SLBN-134	Isolate	Unclassified
31	2818991463	Streptomyces argenteolus 3259	Isolate	Rhizosphere
32	2852635781	Streptomyces sp. AK010	Isolate	Rhizosphere
33	2862178590	Streptomyces sp. SDr-06	Isolate	Rhizosphere
34	2862281513	Streptomyces sp. Act143	Isolate	Rhizosphere
35	2862290372	Streptomyces triticagri NEAU-YY421	Isolate	Rhizosphere
36	2862382967	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
37	2862507626	Streptomyces sp. NWU339	Isolate	Unclassified
38	2862574272	Streptomyces sp. AcE210	Isolate	Nodule
39	2862705112	Streptomyces triticirhizae NEAU-YY642	Isolate	Rhizosphere
40	2863404153	Streptomyces scabiei SAI-025 (Annotation) (version 2)	Isolate	Unclassified
41	2867346516	Streptomyces radicis AZ1-7	Isolate	Unclassified
42	2867369537	Streptomyces sp. Z26	Isolate	Unclassified
43	2867428634	Streptomyces sp. RP5T	Isolate	Unclassified
44	2867475112	Streptomyces sp. TM32	Isolate	Unclassified
45	2873151551	Streptomyces silaceus ACCC40021	Isolate	Rhizosphere
46	2875391855	Streptomyces cavourensis 1AS2a	Isolate	Rhizosphere
47	2877676314	Streptomyces griseorubiginosus 3E-1	Isolate	Unclassified
48	2912715099	Streptomyces sp. Z423-1	Isolate	Rhizosphere
49	2912723979	Streptomyces sp. NEAU-sy36	Isolate	Rhizosphere
50	2912757875	Streptomyces sp. S4.7	Isolate	Rhizosphere
51	2918501144	Streptomyces sp. PvR006	Isolate	Rhizosphere
52	2935390628	Streptomyces sp. PvR034	Isolate	Rhizosphere
53	2946045630	Streptomyces sp. W4I9-2	Isolate	Rhizosphere
54	2946064051	Streptomyces luteogriseus W4I19-1	Isolate	Rhizosphere
55	2946072368	Streptomyces achromogenes W4I19-2	Isolate	Rhizosphere
56	2947224130	Streptomyces afghaniensis W1I20	Isolate	Rhizosphere
57	2954002825	Streptomyces turgidiscabies W2I16	Isolate	Rhizosphere
58	2954380949	Streptomyces ciscaucasicus W1I15	Isolate	Rhizosphere
59	2954673503	Streptomyces sp. SAI-119	Isolate	Rhizosphere
60	2954682443	Streptomyces sp. SAI-149	Isolate	Rhizosphere
61	2954691527	Streptomyces sp. SAI-127	Isolate	Rhizosphere
62	2954701450	Streptomyces sp. SAI-144	Isolate	Rhizosphere
63	2954711539	Streptomyces sp. SAI-090	Isolate	Rhizosphere
64	2954721474	Streptomyces sp. SAI-117	Isolate	Rhizosphere
65	2954731030	Streptomyces sp. SAI-133	Isolate	Rhizosphere
66	2954740390	Streptomyces sp. SAI-041	Isolate	Rhizosphere
67	2954749733	Streptomyces sp. SAI-135	Isolate	Rhizosphere
68	2954759201	Streptomyces sp. SAI-208	Isolate	Rhizosphere
69	2966598605	Kitasatospora papulosa SLBN-177	Isolate	Rhizosphere
70	2990044586	Streptomyces sedi JCM 16909	Isolate	Unclassified
71	2990059506	Streptomyces sp. CAP261	Isolate	Unclassified
72	2990088156	Streptomyces albidus CAP 215	Isolate	Unclassified
73	2995463766	Streptacidiphilus fuscans NEAU-YB345	Isolate	Unclassified
74	2997451912	Streptomyces piniterrae jys28	Isolate	Rhizosphere
75	2997600082	Streptomyces coffeae CA1R205	Isolate	Unclassified
76	3006321560	Actinacidiphila epipremni PRB2-1	Isolate	Unclassified
77	3006393351	Streptomyces sp. SID4985	Isolate	Unclassified
78	3006425503	Streptomyces zingiberis PLAI1-29	Isolate	Unclassified
79	3006486233	Streptomyces sp. BR123	Isolate	Rhizosphere
80	3006493962	Streptomyces grisecoloratus TRM S81-3	Isolate	Rhizosphere
81	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
82	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
83	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
84	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
85	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
86	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
87	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
88	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
89	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
90	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
91	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
92	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
93	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
94	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
95	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
96	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
97	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
98	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
99	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
100	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
101	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
102	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
103	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
104	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
105	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
106	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
107	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
108	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
109	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
110	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
111	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
112	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
113	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
114	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
115	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
116	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
117	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
118	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
119	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
120	3300015688	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01	Metagenome	Rhizosphere
121	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
140	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
141	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
142	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
143	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
144	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
145	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
146	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
147	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
148	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
149	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
150	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
151	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
152	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
153	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
154	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
155	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
156	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
157	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
158	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
159	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
160	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
161	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
162	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
163	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
164	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
165	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
166	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
167	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
168	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
169	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
170	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
171	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
172	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
173	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
174	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
175	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
176	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
177	3300042135	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127	Metagenome	Rhizosphere
178	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
179	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
180	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
181	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
182	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
183	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
184	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
185	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
186	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
187	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
188	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
189	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
190	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
191	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
192	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
193	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
194	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
195	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
196	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
197	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
198	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
199	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
200	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
201	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
202	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
203	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
204	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
205	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
206	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
207	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
208	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
209	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
210	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
211	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
212	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
213	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
214	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
215	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
216	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
217	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
218	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
219	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
220	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
221	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
222	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
223	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
224	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
225	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
226	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
227	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
228	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
229	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
230	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
231	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
232	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
233	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
234	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
235	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
236	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
237	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
238	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
239	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
240	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
241	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
242	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
243	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
244	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
245	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
246	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
247	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
248	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
249	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
250	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
251	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
252	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
253	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
254	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
255	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
256	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
257	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
258	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
259	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
260	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
261	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
262	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
263	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
264	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
265	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
266	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
267	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
268	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
269	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
270	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
271	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
272	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
273	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
274	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
275	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
276	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
277	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
278	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
279	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
280	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
281	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
282	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
283	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
284	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
285	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
286	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
287	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
288	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
289	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
290	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
291	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
292	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
293	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
294	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
295	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
296	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
297	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
298	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
299	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
300	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
301	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
302	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
303	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
304	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
305	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
306	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
307	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
308	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
309	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
310	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
311	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
312	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
313	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
314	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
315	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
316	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
317	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
318	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
319	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
320	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
321	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
322	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
323	3300053100	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere	Metagenome	Endosphere
324	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
325	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
326	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
327	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
328	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
329	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
330	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
331	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
332	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
333	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
334	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
335	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
336	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
337	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
338	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
339	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
340	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
341	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
342	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
343	8008485437	Streptomyces mimosae 3MP-10	Isolate	Unclassified
344	8008558824	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
345	8008574985	Streptomyces sp. Jing01	Isolate	Rhizosphere
346	8023623736	Streptomyces sp. 111WW2	Isolate	Unclassified
347	8025413630	Streptomyces sp. CAI-17	Isolate	Rhizosphere
348	8025478263	Streptomyces telluris AA8	Isolate	Rhizosphere
349	8025524527	Streptomyces sp. 3MP-14	Isolate	Unclassified
350	8025530807	Streptomyces sp. 4R-3d	Isolate	Unclassified
351	8033684223	Streptomyces phytophilus PIP175	Isolate	Unclassified
352	8047893842	Streptomyces cangkringensis DSM 41769	Isolate	Rhizosphere
353	8048127548	Streptomyces samsunensis DSM 42010	Isolate	Rhizosphere
354	8048356638	Streptomyces rhizosphaericus DSM 41760	Isolate	Rhizosphere
355	8048369669	Streptomyces indonesiensis DSM 41759	Isolate	Rhizoplane
356	8048379754	Streptomyces asiaticus DSM 41761	Isolate	Rhizosphere
357	8048406513	Streptomyces heilongjiangensis NEAU-W2	Isolate	Unclassified
358	8054160619	Streptomyces rhizoryzae RS10V-4	Isolate	Rhizosphere
359	8056447290	Streptomyces huiliensis SCA2-4	Isolate	Rhizosphere
360	8056667051	Streptomyces sichuanensis SCA3-4	Isolate	Rhizosphere
361	8056829672	Streptomyces barringtoniae JA03	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	83.52
Metatranscriptomes	0.48
Isolates	15.99

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.01
Nodule	0.65
Rhizoplane	0.48
Rhizosphere	80.78
Stem	0
Stem Tuber	0
Unclassified	13.09

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10017408	3300001989	Bacteria	2593
2	JGI24737J22298_10034894	3300001990	Bacteria	1558
3	JGI24735J21928_10057686	3300002067	Bacteria	1117
4	JGI24738J21930_10014153	3300002075	Bacteria	1715
5	rootH1_10000824	3300003316	Bacteria	3491
6	rootH1_10095730	3300003316	Bacteria	2980
7	rootH2_10006122	3300003320	Bacteria	3083
8	rootL2_10028340	3300003322	Bacteria	2193
9	rootH1_10037094	3300003323	Bacteria	2665
10	rootH1_10055314	3300003323	Bacteria	4022
11	rootH1_10096513	3300003323	Bacteria	1445
12	Ga0006562J51391_1083747	3300003578	Bacteria	4080
13	Ga0006562J51391_1083748	3300003578	Bacteria	3500
14	Ga0006562J51391_1173083	3300003578	Bacteria	1520
15	Ga0070658_10007470	3300005327	Bacteria	8822
16	Ga0070709_10075687	3300005434	Bacteria	2184
17	Ga0068853_100120232	3300005539	Bacteria	2342
18	Ga0070665_100073524	3300005548	Bacteria	3424
19	Ga0068855_100000171	3300005563	Bacteria	82971
20	Ga0068854_100335454	3300005578	Bacteria	1233
21	Ga0068856_100284426	3300005614	Bacteria	1670
22	Ga0081455_10039376	3300005937	Bacteria	4178
23	Ga0075363_100046600	3300006048	Bacteria	2300
24	Ga0075370_10134080	3300006353	Bacteria	1446
25	Ga0075431_100177544	3300006847	Bacteria	2187
26	Ga0075429_100087033	3300006880	Bacteria	2723
27	Ga0099826_10061363	3300006948	Bacteria	2444
28	Ga0105251_10035257	3300009011	Bacteria	2470
29	Ga0105244_10101331	3300009036	Bacteria	1408
30	Ga0105240_10004230	3300009093	Bacteria	21951
31	Ga0105245_10748732	3300009098	Bacteria	1013
32	Ga0105247_10079135	3300009101	Bacteria	2068
33	Ga0114129_10414006	3300009147	Bacteria	1774
34	Ga0105243_10073181	3300009148	Bacteria	2776
35	Ga0105241_10013253	3300009174	Bacteria	6042
36	Ga0105237_10059610	3300009545	Bacteria	3818
37	Ga0105238_10005994	3300009551	Bacteria	12054
38	Ga0105238_10239462	3300009551	Bacteria	1792
39	Ga0105239_10875856	3300010375	Bacteria	1030
40	Ga0105246_10012325	3300011119	Bacteria	5331
41	Ga0105246_10047616	3300011119	Bacteria	2928
42	Ga0157369_10339063	3300013105	Bacteria	1561
43	Ga0157374_10024362	3300013296	Bacteria	5426
44	Ga0157372_10079872	3300013307	Bacteria	3700
45	Ga0182008_10002106	3300014497	Bacteria	12693
46	Ga0182007_10001245	3300015262	Bacteria	13833
47	Ga0183367_1015	3300015688	Bacteria	298435
48	Ga0209758_1011645	3300025297	Bacteria	5059
49	Ga0207426_1001874	3300025302	Bacteria	15407
50	Ga0207426_1007401	3300025302	Bacteria	4603
51	Ga0207647_10004042	3300025904	Bacteria	10931
52	Ga0207647_10016161	3300025904	Bacteria	5098
53	Ga0207699_10066668	3300025906	Bacteria	2186
54	Ga0207654_10006704	3300025911	Bacteria	5794
55	Ga0207695_10001520	3300025913	Bacteria	38493
56	Ga0207671_10000879	3300025914	Bacteria	38034
57	Ga0207660_10220696	3300025917	Bacteria	1488
58	Ga0207652_10209858	3300025921	Bacteria	1753
59	Ga0207694_10001878	3300025924	Bacteria	17410
60	Ga0207664_10028913	3300025929	Bacteria	4218
61	Ga0207709_10040266	3300025935	Bacteria	2797
62	Ga0207709_10047674	3300025935	Bacteria	2606
63	Ga0207667_10028298	3300025949	Bacteria	6089
64	Ga0207639_10088610	3300026041	Bacteria	2470
65	Ga0207678_10136879	3300026067	Bacteria	2090
66	Ga0207702_10321138	3300026078	Bacteria	1474
67	Ga0209371_1017746	3300027312	Bacteria	1833
68	Ga0268266_10180017	3300028379	Bacteria	1924
69	Ga0307517_10002603	3300028786	Bacteria	28721
70	Ga0307517_10026479	3300028786	Bacteria	7025
71	Ga0307515_10017159	3300028794	Bacteria	13209
72	Ga0268256_1017163	3300030500	Bacteria	2048
73	Ga0268256_1036181	3300030500	Bacteria	1141
74	Ga0307511_10004995	3300030521	Bacteria	13528
75	Ga0307511_10154584	3300030521	Bacteria	1306
76	Ga0307511_10178613	3300030521	Bacteria	1149
77	Ga0307512_10000978	3300030522	Bacteria	42035
78	Ga0307512_10008082	3300030522	Bacteria	10305
79	Ga0307513_10024628	3300031456	Bacteria	6997
80	Ga0307509_10030035	3300031507	Bacteria	6016
81	Ga0307509_10040760	3300031507	Bacteria	5048
82	Ga0307509_10115515	3300031507	Bacteria	2676
83	Ga0307508_10006208	3300031616	Bacteria	11267
84	Ga0307508_10006811	3300031616	Bacteria	10689
85	Ga0307508_10092435	3300031616	Bacteria	2614
86	Ga0307508_10286882	3300031616	Bacteria	1239
87	Ga0307514_10008147	3300031649	Bacteria	8953
88	Ga0307514_10025296	3300031649	Bacteria	4802
89	Ga0307514_10112375	3300031649	Bacteria	1925
90	Ga0316575_10017335	3300031665	Bacteria	2734
91	Ga0316579_10003338	3300031691	Bacteria	6235
92	Ga0316576_10000050	3300031727	Bacteria	37008
93	Ga0316576_10010824	3300031727	Bacteria	5945
94	Ga0316578_10042533	3300031728	Bacteria	2634
95	Ga0307516_10019954	3300031730	Bacteria	6929
96	Ga0307516_10046424	3300031730	Bacteria	4286
97	Ga0307516_10141304	3300031730	Bacteria	2177
98	Ga0307516_10286050	3300031730	Bacteria	1329
99	Ga0307416_100113801	3300032002	Bacteria	2392
100	Ga0316583_10002742	3300032133	Bacteria	6160
101	Ga0316585_10009451	3300032137	Bacteria	2846
102	Ga0307507_10034543	3300033179	Bacteria	5220
103	Ga0307507_10112921	3300033179	Bacteria	2211
104	Ga0307510_10103333	3300033180	Bacteria	2627
105	Ga0373956_0013304	3300035119	Bacteria	3422
106	Ga0316574_0035058	3300035398	Bacteria	3064
107	Ga0316582_0100980	3300036647	Bacteria	1910
108	Ga0316584_0000463	3300036712	Bacteria	21184
109	Ga0395900_0159103	3300037418	Bacteria	2305
110	Ga0395900_0323662	3300037418	Bacteria	1521
111	Ga0395898_0016611	3300037466	Bacteria	7524
112	Ga0395898_0084607	3300037466	Bacteria	3057
113	Ga0395898_0116930	3300037466	Bacteria	2555
114	Ga0316581_0009201	3300037588	Bacteria	2709
115	Ga0395901_0025842	3300038443	Bacteria	6030
116	Ga0395901_0252115	3300038443	Bacteria	1839
117	Ga0439436_0000868	3300041404	Bacteria	8261
118	Ga0439436_0001510	3300041404	Bacteria	6768
119	Ga0439439_0002621	3300041406	Bacteria	3850
120	Ga0451837_0204830	3300041494	Bacteria	1934
121	Ga0451853_2320229	3300041512	Bacteria	2391
122	Ga0439433_0009543	3300041999	Bacteria	2116
123	Ga0439448_0000317	3300042005	Bacteria	10704
124	Ga0439449_0000196	3300042007	Bacteria	21165
125	Ga0439449_0004702	3300042007	Bacteria	5270
126	Ga0439457_000199	3300042014	Bacteria	15929
127	Ga0439457_000429	3300042014	Bacteria	12105
128	Ga0439462_0005293	3300042015	Bacteria	3178
129	Ga0450894_001016	3300042131	Bacteria	4299
130	Ga0450898_002051	3300042134	Bacteria	2767
131	Ga0450899_000249	3300042135	Bacteria	5771
132	Ga0450900_000954	3300042136	Bacteria	2609
133	Ga0450903_000783	3300042138	Bacteria	6187
134	Ga0450906_000187	3300042145	Bacteria	11699
135	Ga0439458_0000126	3300042157	Bacteria	15861
136	Ga0466969_0013114	3300044656	Bacteria	4368
137	Ga0466969_0023923	3300044656	Bacteria	3143
138	Ga0466969_0031057	3300044656	Bacteria	2720
139	Ga0466969_0069772	3300044656	Bacteria	1691
140	Ga0466972_0000963	3300044658	Bacteria	13831
141	Ga0466972_0014666	3300044658	Bacteria	3923
142	Ga0466972_0080102	3300044658	Bacteria	1555
143	Ga0466965_0003394	3300044683	Bacteria	6975
144	Ga0466965_0026203	3300044683	Bacteria	2826
145	Ga0466965_0046562	3300044683	Bacteria	2147
146	Ga0466965_0150804	3300044683	Bacteria	1215
147	Ga0466966_0003092	3300044684	Bacteria	10962
148	Ga0466966_0003462	3300044684	Bacteria	10400
149	Ga0466966_0042784	3300044684	Bacteria	2905
150	Ga0466961_0005043	3300044693	Bacteria	8305
151	Ga0466961_0014703	3300044693	Bacteria	5029
152	Ga0466961_0016321	3300044693	Bacteria	4769
153	Ga0466963_0000577	3300044694	Bacteria	17374
154	Ga0466963_0008536	3300044694	Bacteria	6148
155	Ga0466963_0245934	3300044694	Bacteria	1255
156	Ga0466963_0264784	3300044694	Bacteria	1207
157	Ga0466964_0008334	3300044706	Bacteria	3890
158	Ga0466971_0000648	3300044719	Bacteria	13792
159	Ga0466971_0002669	3300044719	Bacteria	7531
160	Ga0466970_0006133	3300044765	Bacteria	5987
161	Ga0466970_0023701	3300044765	Bacteria	3207
162	Ga0466957_0007078	3300044842	Bacteria	6342
163	Ga0466957_0019045	3300044842	Bacteria	4036
164	Ga0466960_0003148	3300044901	Bacteria	6325
165	Ga0466960_0096628	3300044901	Bacteria	1515
166	Ga0466959_0023864	3300045049	Bacteria	4527
167	Ga0466959_0024836	3300045049	Bacteria	4438
168	Ga0466959_0127647	3300045049	Bacteria	1804
169	Ga0466959_0130038	3300045049	Bacteria	1784
170	Ga0466958_0014401	3300045836	Bacteria	4516
171	Ga0466958_0082099	3300045836	Bacteria	1985
172	Ga0466967_0003562	3300045976	Bacteria	10205
173	Ga0466967_0209890	3300045976	Bacteria	1846
174	Ga0495617_040994	3300046452	Bacteria	1548
175	Ga0495592_0000860	3300046454	Bacteria	21001
176	Ga0495592_0029009	3300046454	Bacteria	4189
177	Ga0495592_0056412	3300046454	Bacteria	2903
178	Ga0495603_0000709	3300046455	Bacteria	18891
179	Ga0495603_0004282	3300046455	Bacteria	8502
180	Ga0495603_0015768	3300046455	Bacteria	4569
181	Ga0495603_0061620	3300046455	Bacteria	2215
182	Ga0495603_0065244	3300046455	Bacteria	2145
183	Ga0495603_0076387	3300046455	Bacteria	1966
184	Ga0495629_0001763	3300046459	Bacteria	16966
185	Ga0495629_0005791	3300046459	Bacteria	9217
186	Ga0495629_0016679	3300046459	Bacteria	5271
187	Ga0495629_0020928	3300046459	Bacteria	4668
188	Ga0495629_0034734	3300046459	Bacteria	3564
189	Ga0495629_0052894	3300046459	Bacteria	2842
190	Ga0495638_0025309	3300046460	Bacteria	3860
191	Ga0495638_0038620	3300046460	Bacteria	3032
192	Ga0495638_0211923	3300046460	Bacteria	1088
193	Ga0495651_0000759	3300046462	Bacteria	24956
194	Ga0495651_0010775	3300046462	Bacteria	7028
195	Ga0495651_0027667	3300046462	Bacteria	4418
196	Ga0495653_0013183	3300046463	Bacteria	6740
197	Ga0495580_0013874	3300046472	Bacteria	6136
198	Ga0495580_0145682	3300046472	Bacteria	1641
199	Ga0495605_0016409	3300046474	Bacteria	4008
200	Ga0495639_0012763	3300046475	Bacteria	3624
201	Ga0495662_0001288	3300046476	Bacteria	12402
202	Ga0495662_0001331	3300046476	Bacteria	12230
203	Ga0495662_0003663	3300046476	Bacteria	7748
204	Ga0495662_0066414	3300046476	Bacteria	1745
205	Ga0495664_0001242	3300046477	Bacteria	13340
206	Ga0495664_0028568	3300046477	Bacteria	3257
207	Ga0495664_0075516	3300046477	Bacteria	2016
208	Ga0495584_0023684	3300046491	Bacteria	3113
209	Ga0495585_0013793	3300046492	Bacteria	4722
210	Ga0495585_0049232	3300046492	Bacteria	2341
211	Ga0495594_0002320	3300046499	Bacteria	9905
212	Ga0495594_0004137	3300046499	Bacteria	7452
213	Ga0495594_0198237	3300046499	Bacteria	1144
214	Ga0495607_0058835	3300046501	Bacteria	2195
215	Ga0495607_0072327	3300046501	Bacteria	1920
216	Ga0495583_0012237	3300046506	Bacteria	4871
217	Ga0495583_0041914	3300046506	Bacteria	2141
218	Ga0495606_0008611	3300046507	Bacteria	8817
219	Ga0495608_0000457	3300046511	Bacteria	28465
220	Ga0495608_0214962	3300046511	Bacteria	1208
221	Ga0495610_0043904	3300046512	Bacteria	2223
222	Ga0495616_0005356	3300046513	Bacteria	7914
223	Ga0495618_0033224	3300046514	Bacteria	3234
224	Ga0495618_0060376	3300046514	Bacteria	2404
225	Ga0495618_0223699	3300046514	Bacteria	1186
226	Ga0495620_0007414	3300046515	Bacteria	5958
227	Ga0495620_0007866	3300046515	Bacteria	5751
228	Ga0495628_0014350	3300046516	Bacteria	6641
229	Ga0495628_0021249	3300046516	Bacteria	5343
230	Ga0495628_0029110	3300046516	Bacteria	4482
231	Ga0495628_0078393	3300046516	Bacteria	2569
232	Ga0495628_0101783	3300046516	Bacteria	2216
233	Ga0495628_0251344	3300046516	Bacteria	1320
234	Ga0495630_0003018	3300046517	Bacteria	11673
235	Ga0495630_0005987	3300046517	Bacteria	8598
236	Ga0495630_0212834	3300046517	Bacteria	1475
237	Ga0495631_0009485	3300046518	Bacteria	4860
238	Ga0495643_0001360	3300046522	Bacteria	22880
239	Ga0495643_0007256	3300046522	Bacteria	7170
240	Ga0495648_0036374	3300046524	Bacteria	3178
241	Ga0495666_0005632	3300046526	Bacteria	6304
242	Ga0495642_0015525	3300046528	Bacteria	2962
243	Ga0495652_0003622	3300046529	Bacteria	15139
244	Ga0495652_0017771	3300046529	Bacteria	6348
245	Ga0495652_0025407	3300046529	Bacteria	5241
246	Ga0495652_0118345	3300046529	Bacteria	2117
247	Ga0495654_0005236	3300046530	Bacteria	7567
248	Ga0495665_0000760	3300046531	Bacteria	16759
249	Ga0495640_0000456	3300046533	Bacteria	29903
250	Ga0495640_0007511	3300046533	Bacteria	8566
251	Ga0495640_0018257	3300046533	Bacteria	5209
252	Ga0495640_0076247	3300046533	Bacteria	2237
253	Ga0495640_0077516	3300046533	Bacteria	2215
254	Ga0495586_0049099	3300046535	Bacteria	2281
255	Ga0495586_0056314	3300046535	Bacteria	2132
256	Ga0495587_0000690	3300046536	Bacteria	22646
257	Ga0495587_0008832	3300046536	Bacteria	6466
258	Ga0495587_0099936	3300046536	Bacteria	1672
259	Ga0495609_0010394	3300046538	Bacteria	4465
260	Ga0495597_0013636	3300046542	Bacteria	3888
261	Ga0495597_0038097	3300046542	Bacteria	2156
262	Ga0495645_0008492	3300046543	Bacteria	7172
263	Ga0495645_0029067	3300046543	Bacteria	4017
264	Ga0495622_0004786	3300046557	Bacteria	6273
265	Ga0495622_0010722	3300046557	Bacteria	4230
266	Ga0495622_0067832	3300046557	Bacteria	1648
267	Ga0495633_0012204	3300046558	Bacteria	4582
268	Ga0495633_0035362	3300046558	Bacteria	2399
269	Ga0495667_0000576	3300046559	Bacteria	23444
270	Ga0495667_0226160	3300046559	Bacteria	1193
271	Ga0495668_0198880	3300046616	Bacteria	1097
272	Ga0495634_0004615	3300046642	Bacteria	10755
273	Ga0495634_0027459	3300046642	Bacteria	3959
274	Ga0495634_0058909	3300046642	Bacteria	2559
275	Ga0495625_0014518	3300046660	Bacteria	6278
276	Ga0495635_0000630	3300046663	Bacteria	22652
277	Ga0495635_0016467	3300046663	Bacteria	5163
278	Ga0495635_0215865	3300046663	Bacteria	1298
279	Ga0495661_0163984	3300046665	Bacteria	1191
280	Ga0495588_0001717	3300046674	Bacteria	9330
281	Ga0495588_0001804	3300046674	Bacteria	9125
282	Ga0495588_0007472	3300046674	Bacteria	4976
283	Ga0495588_0155225	3300046674	Bacteria	1210
284	Ga0495657_0000753	3300046675	Bacteria	28805
285	Ga0495657_0002765	3300046675	Bacteria	14612
286	Ga0495657_0006660	3300046675	Bacteria	9021
287	Ga0495657_0033193	3300046675	Bacteria	3595
288	Ga0495599_0090301	3300046678	Bacteria	1911
289	Ga0495623_0000839	3300046679	Bacteria	20792
290	Ga0495623_0014297	3300046679	Bacteria	5141
291	Ga0495646_0000669	3300046680	Bacteria	18793
292	Ga0495646_0001826	3300046680	Bacteria	12794
293	Ga0495646_0086551	3300046680	Bacteria	1817
294	Ga0495613_0000866	3300046689	Bacteria	23233
295	Ga0495613_0003669	3300046689	Bacteria	11514
296	Ga0495613_0005024	3300046689	Bacteria	9931
297	Ga0495613_0012673	3300046689	Bacteria	6269
298	Ga0495613_0016989	3300046689	Bacteria	5416
299	Ga0495613_0087001	3300046689	Bacteria	2265
300	Ga0495624_0007199	3300046690	Bacteria	7825
301	Ga0495670_0019590	3300046691	Bacteria	3332
302	Ga0495670_0166789	3300046691	Bacteria	1159
303	Ga0495671_0006819	3300046692	Bacteria	6562
304	Ga0495671_0124816	3300046692	Bacteria	1255
305	Ga0495649_0026281	3300046694	Bacteria	3239
306	Ga0495649_0113295	3300046694	Bacteria	1437
307	Ga0495589_0003235	3300046794	Bacteria	8887
308	Ga0495589_0014832	3300046794	Bacteria	4008
309	Ga0495589_0069478	3300046794	Bacteria	1722
310	Ga0495589_0077248	3300046794	Bacteria	1622
311	Ga0495600_0000470	3300046809	Bacteria	20967
312	Ga0495600_0005556	3300046809	Bacteria	7610
313	Ga0495600_0060162	3300046809	Bacteria	2480
314	Ga0495660_0009547	3300046810	Bacteria	5655
315	Ga0495660_0027011	3300046810	Bacteria	3249
316	Ga0495581_0002931	3300047315	Bacteria	9757
317	Ga0495581_0002999	3300047315	Bacteria	9676
318	Ga0495581_0049864	3300047315	Bacteria	2418
319	Ga0495581_0114038	3300047315	Bacteria	1572
320	Ga0495581_0146682	3300047315	Bacteria	1377
321	Ga0495581_0234417	3300047315	Bacteria	1073
322	Ga0495604_0000597	3300047317	Bacteria	31188
323	Ga0495604_0000885	3300047317	Bacteria	24895
324	Ga0495604_0031456	3300047317	Bacteria	4208
325	Ga0495604_0089592	3300047317	Bacteria	2286
326	Ga0495604_0178743	3300047317	Bacteria	1486
327	Ga0495636_0004258	3300047318	Bacteria	5614
328	Ga0495636_0004429	3300047318	Bacteria	5497
329	Ga0495636_0021320	3300047318	Bacteria	2616
330	Ga0495636_0123417	3300047318	Bacteria	1147
331	Ga0495674_0015461	3300047319	Bacteria	7132
332	Ga0495674_0073939	3300047319	Bacteria	2936
333	Ga0495674_0304363	3300047319	Bacteria	1301
334	Ga0495672_0088521	3300047320	Bacteria	1706
335	Ga0495676_0003592	3300047321	Bacteria	14079
336	Ga0495676_0019453	3300047321	Bacteria	5971
337	Ga0495676_0032614	3300047321	Bacteria	4394
338	Ga0495676_0033924	3300047321	Bacteria	4289
339	Ga0495676_0071907	3300047321	Bacteria	2657
340	Ga0495683_0042555	3300047323	Bacteria	2289
341	Ga0495683_0048905	3300047323	Bacteria	2119
342	Ga0495683_0092691	3300047323	Bacteria	1461
343	Ga0495687_003104	3300047443	Bacteria	12436
344	Ga0495687_003604	3300047443	Bacteria	11080
345	Ga0495687_013166	3300047443	Bacteria	4330
346	Ga0495687_020853	3300047443	Bacteria	3186
347	Ga0495687_076727	3300047443	Bacteria	1321
348	Ga0495675_0001676	3300047444	Bacteria	13289
349	Ga0495675_0009353	3300047444	Bacteria	6096
350	Ga0495675_0151612	3300047444	Bacteria	1432
351	Ga0495677_0013126	3300047445	Bacteria	3015
352	Ga0495685_000169	3300047447	Bacteria	21935
353	Ga0495685_002339	3300047447	Bacteria	5924
354	Ga0495685_009049	3300047447	Bacteria	3319
355	Ga0495685_021745	3300047447	Bacteria	2207
356	Ga0495685_026581	3300047447	Bacteria	1991
357	Ga0495685_030471	3300047447	Bacteria	1854
358	Ga0495685_039982	3300047447	Bacteria	1604
359	Ga0495673_0058684	3300047469	Bacteria	1657
360	Ga0495681_0001188	3300047470	Bacteria	19816
361	Ga0495681_0001992	3300047470	Bacteria	14922
362	Ga0495681_0022365	3300047470	Bacteria	3385
363	Ga0495681_0046838	3300047470	Bacteria	2059
364	Ga0495684_0011420	3300047471	Bacteria	6856
365	Ga0495686_0036670	3300047472	Bacteria	3146
366	Ga0495593_0000502	3300047673	Bacteria	22126
367	Ga0495593_0006117	3300047673	Bacteria	7081
368	Ga0495593_0048473	3300047673	Bacteria	2257
369	Ga0495593_0055822	3300047673	Bacteria	2077
370	Ga0495602_0001475	3300048088	Bacteria	23381
371	Ga0495614_0003095	3300048089	Bacteria	7410
372	Ga0495614_0003948	3300048089	Bacteria	6657
373	Ga0495626_0045286	3300048091	Bacteria	2054
374	Ga0496108_0045431	3300048911	Bacteria	3669
375	Ga0496111_0183024	3300048914	Bacteria	1558
376	Ga0496123_0200219	3300048926	Bacteria	1024
377	Ga0495678_016976	3300049459	Bacteria	3310
378	Ga0495682_0017223	3300049460	Bacteria	2730
379	Ga0501031_0005577	3300049568	Bacteria	8199
380	Ga0501031_0012595	3300049568	Bacteria	5524
381	Ga0501031_0094633	3300049568	Bacteria	1949
382	Ga0501032_0003144	3300049569	Bacteria	12704
383	Ga0501032_0010563	3300049569	Bacteria	6658
384	Ga0501032_0076830	3300049569	Bacteria	2223
385	Ga0501032_0207127	3300049569	Bacteria	1279
386	Ga0501033_0002024	3300049570	Bacteria	17626
387	Ga0501033_0007814	3300049570	Bacteria	8287
388	Ga0501033_0016477	3300049570	Bacteria	5597
389	Ga0501033_0035978	3300049570	Bacteria	3711
390	Ga0501033_0036048	3300049570	Bacteria	3707
391	Ga0501033_0043291	3300049570	Bacteria	3353
392	Ga0501033_0074361	3300049570	Bacteria	2494
393	Ga0501033_0102731	3300049570	Bacteria	2085
394	Ga0501034_0005565	3300049571	Bacteria	13729
395	Ga0501034_0014105	3300049571	Bacteria	8233
396	Ga0501034_0040685	3300049571	Bacteria	4704
397	Ga0501034_0052703	3300049571	Bacteria	4098
398	Ga0501034_0081190	3300049571	Bacteria	3245
399	Ga0501034_0205238	3300049571	Bacteria	1927
400	Ga0501036_0002046	3300049572	Bacteria	15716
401	Ga0501036_0003440	3300049572	Bacteria	12645
402	Ga0501036_0016057	3300049572	Bacteria	6255
403	Ga0501036_0019416	3300049572	Bacteria	5706
404	Ga0501036_0076806	3300049572	Bacteria	2825
405	Ga0501036_0132427	3300049572	Bacteria	2104
406	Ga0501037_0001542	3300049573	Bacteria	16807
407	Ga0501037_0006092	3300049573	Bacteria	8814
408	Ga0501037_0013806	3300049573	Bacteria	5952
409	Ga0501038_0013850	3300049574	Bacteria	7349
410	Ga0501038_0015188	3300049574	Bacteria	7004
411	Ga0501038_0019137	3300049574	Bacteria	6175
412	Ga0501038_0104087	3300049574	Bacteria	2359
413	Ga0501039_0006347	3300049575	Bacteria	8981
414	Ga0501039_0031591	3300049575	Bacteria	4082
415	Ga0501039_0068988	3300049575	Bacteria	2745
416	Ga0501039_0122462	3300049575	Bacteria	2039
417	Ga0501040_0049151	3300049576	Bacteria	2883
418	Ga0501041_0010125	3300049577	Bacteria	5556
419	Ga0501042_0009713	3300049578	Bacteria	6426
420	Ga0501042_0070648	3300049578	Bacteria	2498
421	Ga0501043_0003070	3300049579	Bacteria	13878
422	Ga0501043_0006543	3300049579	Bacteria	9348
423	Ga0501043_0008595	3300049579	Bacteria	8048
424	Ga0501043_0015937	3300049579	Bacteria	5891
425	Ga0501043_0033503	3300049579	Bacteria	4042
426	Ga0501043_0096204	3300049579	Bacteria	2327
427	Ga0501043_0117524	3300049579	Bacteria	2086
428	Ga0501043_0123270	3300049579	Bacteria	2032
429	Ga0501046_0021677	3300049580	Bacteria	5299
430	Ga0501046_0212450	3300049580	Bacteria	1435
431	Ga0501047_0000082	3300049581	Bacteria	121193
432	Ga0501047_0021508	3300049581	Bacteria	6194
433	Ga0501047_0033783	3300049581	Bacteria	4936
434	Ga0501047_0039899	3300049581	Bacteria	4541
435	Ga0501047_0041754	3300049581	Bacteria	4431
436	Ga0501047_0091368	3300049581	Bacteria	2922
437	Ga0501047_0093775	3300049581	Bacteria	2881
438	Ga0501047_0221665	3300049581	Bacteria	1747
439	Ga0501047_0262097	3300049581	Bacteria	1576
440	Ga0501047_0370324	3300049581	Bacteria	1267
441	Ga0501048_0019430	3300049582	Bacteria	4984
442	Ga0501048_0042745	3300049582	Bacteria	3243
443	Ga0501048_0380292	3300049582	Bacteria	1008
444	Ga0501067_0004475	3300049583	Bacteria	7707
445	Ga0501068_0008167	3300049584	Bacteria	5815
446	Ga0501068_0105979	3300049584	Bacteria	1745
447	Ga0501069_0224498	3300049585	Bacteria	1092
448	Ga0501070_0005731	3300049586	Bacteria	10590
449	Ga0501070_0038348	3300049586	Bacteria	3997
450	Ga0501070_0093141	3300049586	Bacteria	2493
451	Ga0501071_0003578	3300049587	Bacteria	9727
452	Ga0501072_0002873	3300049588	Bacteria	12947
453	Ga0501073_0164688	3300049589	Bacteria	1535
454	Ga0501074_0009630	3300049590	Bacteria	7012
455	Ga0501076_0006187	3300049592	Bacteria	8661
456	Ga0501077_0031170	3300049593	Bacteria	3392
457	Ga0501079_0004079	3300049741	Bacteria	10819
458	Ga0501080_0292933	3300049742	Bacteria	1477
459	Ga0501083_0008503	3300049744	Bacteria	7248
460	Ga0501035_0009978	3300049822	Bacteria	8814
461	Ga0501035_0019649	3300049822	Bacteria	6209
462	Ga0501035_0064918	3300049822	Bacteria	3243
463	Ga0501035_0065271	3300049822	Bacteria	3233
464	Ga0501035_0115850	3300049822	Bacteria	2345
465	Ga0501035_0190692	3300049822	Bacteria	1762
466	Ga0501035_0206591	3300049822	Bacteria	1682
467	Ga0501035_0234623	3300049822	Bacteria	1562
468	Ga0501044_0001749	3300049823	Bacteria	25344
469	Ga0501044_0004845	3300049823	Bacteria	15045
470	Ga0501044_0007943	3300049823	Bacteria	11662
471	Ga0501044_0012253	3300049823	Bacteria	9283
472	Ga0501044_0031956	3300049823	Bacteria	5534
473	Ga0501044_0120866	3300049823	Bacteria	2620
474	Ga0501044_0154797	3300049823	Bacteria	2272
475	Ga0501044_0208374	3300049823	Bacteria	1910
476	Ga0501044_0358066	3300049823	Bacteria	1377
477	Ga0501044_0375086	3300049823	Bacteria	1338
478	Ga0501045_0006846	3300049824	Bacteria	7896
479	nmdc:mga03n38_53516_c1	3300050490	Bacteria	1810
480	nmdc:mga07m45_56059_c1	3300050496	Bacteria	2227
481	nmdc:mga05p37_667653_c1	3300050507	Bacteria	1161
482	nmdc:mga09592_137935_c1	3300050508	Bacteria	2101
483	nmdc:mga09592_97118_c1	3300050508	Bacteria	2521
484	Ga0495601_0007337	3300053077	Bacteria	6463
485	Ga0495601_0351119	3300053077	Bacteria	959
486	Ga0495612_0011146	3300053078	Bacteria	3628
487	Ga0495612_0096613	3300053078	Bacteria	1255
488	Ga0495595_0133063	3300053084	Bacteria	1217
489	Ga0495619_0006203	3300053085	Bacteria	7576
490	Ga0495619_0191164	3300053085	Bacteria	1417
491	Ga0500578_0019485	3300053086	Bacteria	4356
492	Ga0500578_0110738	3300053086	Bacteria	1731
493	Ga0500643_000826	3300053087	Bacteria	19993
494	Ga0500640_000713	3300053095	Bacteria	8895
495	Ga0500654_064824	3300053099	Bacteria	1835
496	Ga0500660_064322	3300053100	Bacteria	1750
497	Ga0500560_011995	3300053107	Bacteria	2230
498	Ga0500560_032696	3300053107	Bacteria	1584
499	Ga0500560_050038	3300053107	Bacteria	1338
500	Ga0500569_000206	3300053109	Bacteria	9432
501	Ga0500572_014624	3300053111	Bacteria	1965
502	Ga0500652_000411	3300053131	Bacteria	15365
503	Ga0500658_0001474	3300053134	Bacteria	9402
504	Ga0500561_0000178	3300053137	Bacteria	11732
505	Ga0500573_0056399	3300053140	Bacteria	2255
506	Ga0500573_0097093	3300053140	Bacteria	1660
507	Ga0500579_004743	3300053143	Bacteria	8287
508	Ga0500600_0000529	3300053149	Bacteria	17565
509	Ga0500616_0004263	3300053153	Bacteria	10282
510	Ga0500624_006515	3300053157	Bacteria	1582
511	Ga0500633_0011904	3300053160	Bacteria	2383
512	Ga0500634_0001811	3300053161	Bacteria	8600
513	Ga0500656_002096	3300053732	Bacteria	1782
514	Ga0500587_007598	3300053739	Bacteria	1407
515	Ga0501084_0023186	3300054114	Bacteria	5181
516	Ga0501082_0003356	3300060353	Bacteria	13980
517	Ga0466962_0002610	3300061719	Bacteria	8567
518	Ga0466962_0017439	3300061719	Bacteria	3456
519	Ga0466962_0031050	3300061719	Bacteria	2558
520	Ga0530510_0036185	3300061734	Bacteria	3558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300002075	JGI24738J21930_10014153	JGI24738J21930_100141531	269
2	3300049582	Ga0501048_0019430	Ga0501048_0019430_4160_4969	269
3	3300049585	Ga0501069_0224498	Ga0501069_0224498_268_1077	269
4	3300003322	rootL2_10028340	rootL2_100283402	275
5	3300046452	Ga0495617_040994	Ga0495617_040994_163_990	275
6	3300046460	Ga0495638_0025309	Ga0495638_0025309_1169_1996	275
7	3300046492	Ga0495585_0049232	Ga0495585_0049232_1433_2260	275
8	3300046522	Ga0495643_0001360	Ga0495643_0001360_13488_14315	275
9	3300046535	Ga0495586_0056314	Ga0495586_0056314_10_837	275
10	3300046559	Ga0495667_0226160	Ga0495667_0226160_349_1176	275
11	3300046691	Ga0495670_0019590	Ga0495670_0019590_827_1654	275
12	3300046794	Ga0495589_0003235	Ga0495589_0003235_3812_4639	275
13	3300046810	Ga0495660_0009547	Ga0495660_0009547_1871_2698	275
14	3300047315	Ga0495581_0114038	Ga0495581_0114038_162_989	275
15	3300047323	Ga0495683_0092691	Ga0495683_0092691_517_1344	275
16	3300047443	Ga0495687_013166	Ga0495687_013166_1803_2630	275
17	3300047447	Ga0495685_000169	Ga0495685_000169_8514_9341	275
18	3300047470	Ga0495681_0001992	Ga0495681_0001992_1293_2120	275
19	3300053085	Ga0495619_0191164	Ga0495619_0191164_121_948	275
20	3300053086	Ga0500578_0019485	Ga0500578_0019485_3063_3890	275
21	3300053087	Ga0500643_000826	Ga0500643_000826_18194_19027	275
22	3300053099	Ga0500654_064824	Ga0500654_064824_373_1200	275
23	3300053100	Ga0500660_064322	Ga0500660_064322_250_1077	275
24	3300053107	Ga0500560_011995	Ga0500560_011995_1144_1971	275
25	3300053107	Ga0500560_032696	Ga0500560_032696_400_1227	275
26	3300053109	Ga0500569_000206	Ga0500569_000206_5533_6360	275
27	3300053131	Ga0500652_000411	Ga0500652_000411_10406_11233	275
28	3300053134	Ga0500658_0001474	Ga0500658_0001474_1566_2393	275
29	3300053137	Ga0500561_0000178	Ga0500561_0000178_9851_10678	275
30	3300053140	Ga0500573_0097093	Ga0500573_0097093_599_1426	275
31	3300053143	Ga0500579_004743	Ga0500579_004743_1868_2695	275
32	3300053149	Ga0500600_0000529	Ga0500600_0000529_7461_8288	275
33	3300053153	Ga0500616_0004263	Ga0500616_0004263_7156_7983	275
34	3300053160	Ga0500633_0011904	Ga0500633_0011904_754_1581	275
35	3300053161	Ga0500634_0001811	Ga0500634_0001811_3900_4727	275
36	3300053732	Ga0500656_002096	Ga0500656_002096_614_1441	275
37	3300053739	Ga0500587_007598	Ga0500587_007598_525_1352	275
38	3300005327	Ga0070658_10007470	Ga0070658_1000747012	281
39	3300009098	Ga0105245_10748732	Ga0105245_107487321	281
40	iso_pu_bacteria	2616644941	2616903699	283
41	3300011119	Ga0105246_10012325	Ga0105246_100123254	287
42	3300013105	Ga0157369_10339063	Ga0157369_103390632	287
43	3300044765	Ga0466970_0023701	Ga0466970_0023701_2299_3162	287
44	3300046454	Ga0495592_0056412	Ga0495592_0056412_1695_2558	287
45	3300046455	Ga0495603_0000709	Ga0495603_0000709_13711_14583	287
46	3300046459	Ga0495629_0001763	Ga0495629_0001763_12233_13105	287
47	3300046459	Ga0495629_0005791	Ga0495629_0005791_7389_8252	287
48	3300046459	Ga0495629_0016679	Ga0495629_0016679_2009_2872	287
49	3300046459	Ga0495629_0052894	Ga0495629_0052894_77_946	287
50	3300046462	Ga0495651_0010775	Ga0495651_0010775_2226_3089	287
51	3300046476	Ga0495662_0066414	Ga0495662_0066414_429_1301	287
52	3300046477	Ga0495664_0028568	Ga0495664_0028568_1379_2242	287
53	3300046514	Ga0495618_0033224	Ga0495618_0033224_1236_2099	287
54	3300046516	Ga0495628_0014350	Ga0495628_0014350_1906_2769	287
55	3300046516	Ga0495628_0251344	Ga0495628_0251344_290_1153	287
56	3300046529	Ga0495652_0017771	Ga0495652_0017771_1333_2196	287
57	3300046533	Ga0495640_0000456	Ga0495640_0000456_13740_14603	287
58	3300046642	Ga0495634_0027459	Ga0495634_0027459_2918_3781	287
59	3300046674	Ga0495588_0155225	Ga0495588_0155225_267_1139	287
60	3300046675	Ga0495657_0033193	Ga0495657_0033193_1133_1996	287
61	3300046690	Ga0495624_0007199	Ga0495624_0007199_4123_4986	287
62	3300046691	Ga0495670_0166789	Ga0495670_0166789_264_1136	287
63	3300046809	Ga0495600_0005556	Ga0495600_0005556_6532_7395	287
64	3300047315	Ga0495581_0049864	Ga0495581_0049864_1040_1903	287
65	3300047321	Ga0495676_0003592	Ga0495676_0003592_291_1154	287
66	3300047321	Ga0495676_0033924	Ga0495676_0033924_1274_2146	287
67	3300048089	Ga0495614_0003948	Ga0495614_0003948_4591_5463	287
68	3300048914	Ga0496111_0183024	Ga0496111_0183024_13_876	287
69	3300049568	Ga0501031_0005577	Ga0501031_0005577_3064_3927	287
70	3300049569	Ga0501032_0003144	Ga0501032_0003144_4160_5023	287
71	3300049570	Ga0501033_0007814	Ga0501033_0007814_4160_5023	287
72	3300049571	Ga0501034_0005565	Ga0501034_0005565_4160_5023	287
73	3300049572	Ga0501036_0003440	Ga0501036_0003440_7685_8548	287
74	3300049573	Ga0501037_0006092	Ga0501037_0006092_7684_8547	287
75	3300049574	Ga0501038_0015188	Ga0501038_0015188_5064_5927	287
76	3300049575	Ga0501039_0006347	Ga0501039_0006347_3959_4822	287
77	3300049576	Ga0501040_0049151	Ga0501040_0049151_1931_2794	287
78	3300049577	Ga0501041_0010125	Ga0501041_0010125_277_1140	287
79	3300049578	Ga0501042_0009713	Ga0501042_0009713_3064_3927	287
80	3300049579	Ga0501043_0003070	Ga0501043_0003070_8856_9719	287
81	3300049580	Ga0501046_0021677	Ga0501046_0021677_277_1140	287
82	3300049581	Ga0501047_0021508	Ga0501047_0021508_5064_5927	287
83	3300049583	Ga0501067_0004475	Ga0501067_0004475_268_1131	287
84	3300049584	Ga0501068_0008167	Ga0501068_0008167_77_940	287
85	3300049587	Ga0501071_0003578	Ga0501071_0003578_6934_7797	287
86	3300049588	Ga0501072_0002873	Ga0501072_0002873_7716_8579	287
87	3300049589	Ga0501073_0164688	Ga0501073_0164688_268_1131	287
88	3300049592	Ga0501076_0006187	Ga0501076_0006187_3586_4449	287
89	3300049593	Ga0501077_0031170	Ga0501077_0031170_2274_3137	287
90	3300049741	Ga0501079_0004079	Ga0501079_0004079_7329_8192	287
91	3300049742	Ga0501080_0292933	Ga0501080_0292933_486_1349	287
92	3300049744	Ga0501083_0008503	Ga0501083_0008503_4404_5267	287
93	3300049822	Ga0501035_0009978	Ga0501035_0009978_7684_8547	287
94	3300049823	Ga0501044_0004845	Ga0501044_0004845_13915_14778	287
95	3300049824	Ga0501045_0006846	Ga0501045_0006846_2936_3799	287
96	3300050490	nmdc:mga03n38_53516_c1	nmdc:mga03n38_53516_c1_846_1709	287
97	3300054114	Ga0501084_0023186	Ga0501084_0023186_90_953	287
98	3300060353	Ga0501082_0003356	Ga0501082_0003356_6516_7379	287
99	3300061734	Ga0530510_0036185	Ga0530510_0036185_1546_2409	287
100	3300002067	JGI24735J21928_10057686	JGI24735J21928_100576861	292
101	3300046514	Ga0495618_0223699	Ga0495618_0223699_65_943	292
102	3300046516	Ga0495628_0078393	Ga0495628_0078393_66_944	292
103	3300046663	Ga0495635_0215865	Ga0495635_0215865_65_943	292
104	3300047443	Ga0495687_003104	Ga0495687_003104_2065_2943	292
105	3300047673	Ga0495593_0055822	Ga0495593_0055822_1178_2056	292
106	3300049574	Ga0501038_0104087	Ga0501038_0104087_1463_2341	292
107	3300009148	Ga0105243_10073181	Ga0105243_100731812	294
108	3300011119	Ga0105246_10047616	Ga0105246_100476162	294
109	3300035119	Ga0373956_0013304	Ga0373956_0013304_1322_2245	294
110	3300044683	Ga0466965_0026203	Ga0466965_0026203_594_1484	296
111	3300042135	Ga0450899_000249	Ga0450899_000249_50_946	298
112	3300005548	Ga0070665_100073524	Ga0070665_1000735242	299
113	3300005563	Ga0068855_100000171	Ga0068855_10000017119	299
114	3300005614	Ga0068856_100284426	Ga0068856_1002844262	299
115	3300009093	Ga0105240_10004230	Ga0105240_100042305	299
116	3300009174	Ga0105241_10013253	Ga0105241_100132532	299
117	3300009545	Ga0105237_10059610	Ga0105237_100596103	299
118	3300009551	Ga0105238_10005994	Ga0105238_100059946	299
119	3300010375	Ga0105239_10875856	Ga0105239_108758562	299
120	3300013296	Ga0157374_10024362	Ga0157374_100243624	299
121	3300025904	Ga0207647_10016161	Ga0207647_100161614	299
122	3300025911	Ga0207654_10006704	Ga0207654_100067046	299
123	3300025913	Ga0207695_10001520	Ga0207695_100015206	299
124	3300025914	Ga0207671_10000879	Ga0207671_100008795	299
125	3300025924	Ga0207694_10001878	Ga0207694_100018786	299
126	3300025949	Ga0207667_10028298	Ga0207667_100282983	299
127	3300026067	Ga0207678_10136879	Ga0207678_101368791	299
128	3300026078	Ga0207702_10321138	Ga0207702_103211382	299
129	3300044693	Ga0466961_0016321	Ga0466961_0016321_2943_3842	299
130	3300045049	Ga0466959_0127647	Ga0466959_0127647_322_1221	299
131	3300046529	Ga0495652_0118345	Ga0495652_0118345_47_946	299
132	3300046557	Ga0495622_0067832	Ga0495622_0067832_589_1488	299
133	3300047317	Ga0495604_0178743	Ga0495604_0178743_210_1109	299
134	3300047444	Ga0495675_0151612	Ga0495675_0151612_461_1360	299
135	3300053077	Ga0495601_0351119	Ga0495601_0351119_23_922	299
136	3300053078	Ga0495612_0011146	Ga0495612_0011146_176_1075	299
137	3300044656	Ga0466969_0069772	Ga0466969_0069772_627_1541	300
138	3300045049	Ga0466959_0130038	Ga0466959_0130038_314_1228	300
139	3300061719	Ga0466962_0002610	Ga0466962_0002610_3001_3915	300
140	3300031665	Ga0316575_10017335	Ga0316575_100173352	301
141	3300031691	Ga0316579_10003338	Ga0316579_100033382	301
142	3300031727	Ga0316576_10000050	Ga0316576_1000005018	301
143	3300031728	Ga0316578_10042533	Ga0316578_100425333	301
144	3300032133	Ga0316583_10002742	Ga0316583_100027426	301
145	3300032137	Ga0316585_10009451	Ga0316585_100094512	301
146	3300035398	Ga0316574_0035058	Ga0316574_0035058_599_1522	301
147	3300036647	Ga0316582_0100980	Ga0316582_0100980_806_1729	301
148	3300036712	Ga0316584_0000463	Ga0316584_0000463_11950_12873	301
149	3300037588	Ga0316581_0009201	Ga0316581_0009201_571_1494	301
150	3300042136	Ga0450900_000954	Ga0450900_000954_288_1202	302
151	3300044656	Ga0466969_0013114	Ga0466969_0013114_1347_2276	302
152	3300044656	Ga0466969_0023923	Ga0466969_0023923_575_1507	302
153	3300044684	Ga0466966_0003092	Ga0466966_0003092_6478_7410	302
154	3300044693	Ga0466961_0005043	Ga0466961_0005043_6777_7709	302
155	3300045049	Ga0466959_0024836	Ga0466959_0024836_3096_4028	302
156	iso_pu_bacteria	2995463766	2995471407	302
157	iso_pu_bacteria	8033684223	8033686527	302
158	iso_pu_bacteria	8056829672	8056833165	302
159	3300013307	Ga0157372_10079872	Ga0157372_100798723	303
160	3300025917	Ga0207660_10220696	Ga0207660_102206962	303
161	3300025921	Ga0207652_10209858	Ga0207652_102098582	303
162	iso_pu_bacteria	8008574985	8008578126	303
163	3300005434	Ga0070709_10075687	Ga0070709_100756872	304
164	3300009147	Ga0114129_10414006	Ga0114129_104140061	304
165	3300025906	Ga0207699_10066668	Ga0207699_100666682	304
166	3300025929	Ga0207664_10028913	Ga0207664_100289133	304
167	3300028786	Ga0307517_10002603	Ga0307517_1000260319	304
168	3300030521	Ga0307511_10178613	Ga0307511_101786131	304
169	3300031730	Ga0307516_10141304	Ga0307516_101413042	304
170	3300033179	Ga0307507_10112921	Ga0307507_101129212	304
171	3300044694	Ga0466963_0264784	Ga0466963_0264784_88_1017	304
172	3300046499	Ga0495594_0198237	Ga0495594_0198237_47_979	304
173	3300046511	Ga0495608_0214962	Ga0495608_0214962_140_1072	304
174	3300050507	nmdc:mga05p37_667653_c1	nmdc:mga05p37_667653_c1_72_995	304
175	3300050508	nmdc:mga09592_97118_c1	nmdc:mga09592_97118_c1_707_1630	304
176	iso_pu_bacteria	2767802112	2768642612	304
177	iso_pu_bacteria	2791355406	2793983163	304
178	iso_pu_bacteria	2862705112	2862710638	304
179	iso_pu_bacteria	2867346516	2867348653	304
180	iso_pu_bacteria	2867369537	2867372787	304
181	iso_pu_bacteria	2990044586	2990045496	304
182	iso_pu_bacteria	2990088156	2990090950	304
183	iso_pu_bacteria	2997600082	2997600140	304
184	iso_pu_bacteria	3006425503	3006425593	304
185	iso_pu_bacteria	8008485437	8008485751	304
186	iso_pu_bacteria	8025524527	8025524835	304
187	iso_pu_bacteria	8047893842	8047897796	304
188	iso_pu_bacteria	8048127548	8048128697	304
189	iso_pu_bacteria	8048356638	8048361075	304
190	iso_pu_bacteria	8048369669	8048374782	304
191	iso_pu_bacteria	8048379754	8048383440	304
192	3300006847	Ga0075431_100177544	Ga0075431_1001775443	305
193	3300006880	Ga0075429_100087033	Ga0075429_1000870332	305
194	3300050508	nmdc:mga09592_137935_c1	nmdc:mga09592_137935_c1_267_1193	305
195	iso_pu_bacteria	2582581312	2585297956	305
196	iso_pu_bacteria	2643221587	2643947563	305
197	iso_pu_bacteria	2643221677	2644435255	305
198	iso_pu_bacteria	2808606982	2811845431	305
199	iso_pu_bacteria	2918501144	2918504752	305
200	iso_pu_bacteria	8054160619	8054161262	305
201	3300031727	Ga0316576_10010824	Ga0316576_100108242	306
202	3300037418	Ga0395900_0323662	Ga0395900_0323662_106_1026	306
203	3300037466	Ga0395898_0084607	Ga0395898_0084607_326_1246	306
204	3300038443	Ga0395901_0025842	Ga0395901_0025842_1899_2819	306
205	3300044658	Ga0466972_0080102	Ga0466972_0080102_143_1063	306
206	3300044719	Ga0466971_0002669	Ga0466971_0002669_3543_4463	306
207	3300045836	Ga0466958_0082099	Ga0466958_0082099_736_1656	306
208	3300046694	Ga0495649_0113295	Ga0495649_0113295_144_1064	306
209	3300049570	Ga0501033_0002024	Ga0501033_0002024_14173_15093	306
210	3300049570	Ga0501033_0043291	Ga0501033_0043291_2277_3203	306
211	3300049571	Ga0501034_0205238	Ga0501034_0205238_561_1487	306
212	3300049572	Ga0501036_0076806	Ga0501036_0076806_642_1568	306
213	3300049579	Ga0501043_0117524	Ga0501043_0117524_743_1669	306
214	3300049581	Ga0501047_0041754	Ga0501047_0041754_779_1705	306
215	3300049582	Ga0501048_0380292	Ga0501048_0380292_47_973	306
216	3300049584	Ga0501068_0105979	Ga0501068_0105979_580_1506	306
217	3300049586	Ga0501070_0005731	Ga0501070_0005731_1263_2189	306
218	3300049822	Ga0501035_0019649	Ga0501035_0019649_1543_2463	306
219	3300049822	Ga0501035_0234623	Ga0501035_0234623_447_1373	306
220	3300049823	Ga0501044_0001749	Ga0501044_0001749_5854_6780	306
221	3300049823	Ga0501044_0358066	Ga0501044_0358066_348_1274	306
222	3300053084	Ga0495595_0133063	Ga0495595_0133063_108_1028	306
223	3300061719	Ga0466962_0031050	Ga0466962_0031050_253_1173	306
224	3300003578	Ga0006562J51391_1173083	Ga0006562J51391_11730832	307
225	3300031649	Ga0307514_10025296	Ga0307514_100252965	307
226	3300046455	Ga0495603_0065244	Ga0495603_0065244_1044_2006	307
227	3300046499	Ga0495594_0002320	Ga0495594_0002320_3819_4781	307
228	3300046501	Ga0495607_0072327	Ga0495607_0072327_38_1000	307
229	3300046557	Ga0495622_0010722	Ga0495622_0010722_3015_3977	307
230	3300046674	Ga0495588_0001804	Ga0495588_0001804_3741_4703	307
231	3300047318	Ga0495636_0123417	Ga0495636_0123417_117_1079	307
232	3300047321	Ga0495676_0019453	Ga0495676_0019453_12_974	307
233	iso_pu_bacteria	2643221548	2643763418	307
234	iso_pu_bacteria	2643221670	2644390304	307
235	iso_pu_bacteria	2643221682	2644463712	307
236	iso_pu_bacteria	2818991463	2819698206	307
237	iso_pu_bacteria	2862290372	2862294542	307
238	iso_pu_bacteria	2912723979	2912731139	307
239	iso_pu_bacteria	2966598605	2966602400	307
240	iso_pu_bacteria	3006393351	3006399871	307
241	3300025302	Ga0207426_1007401	Ga0207426_10074013	308
242	3300031616	Ga0307508_10006208	Ga0307508_100062088	308
243	3300046454	Ga0495592_0000860	Ga0495592_0000860_13230_14186	308
244	3300046462	Ga0495651_0000759	Ga0495651_0000759_10551_11507	308
245	3300046463	Ga0495653_0013183	Ga0495653_0013183_2816_3772	308
246	3300046472	Ga0495580_0013874	Ga0495580_0013874_5048_6004	308
247	3300046476	Ga0495662_0001331	Ga0495662_0001331_1842_2798	308
248	3300046511	Ga0495608_0000457	Ga0495608_0000457_9441_10397	308
249	3300046516	Ga0495628_0029110	Ga0495628_0029110_3248_4204	308
250	3300046517	Ga0495630_0003018	Ga0495630_0003018_8000_8956	308
251	3300046526	Ga0495666_0005632	Ga0495666_0005632_376_1332	308
252	3300046529	Ga0495652_0003622	Ga0495652_0003622_2559_3515	308
253	3300046531	Ga0495665_0000760	Ga0495665_0000760_9073_10029	308
254	3300046533	Ga0495640_0076247	Ga0495640_0076247_143_1099	308
255	3300046536	Ga0495587_0000690	Ga0495587_0000690_12745_13701	308
256	3300046543	Ga0495645_0008492	Ga0495645_0008492_2795_3748	308
257	3300046543	Ga0495645_0029067	Ga0495645_0029067_1741_2697	308
258	3300046558	Ga0495633_0035362	Ga0495633_0035362_1293_2246	308
259	3300046559	Ga0495667_0000576	Ga0495667_0000576_10551_11507	308
260	3300046663	Ga0495635_0016467	Ga0495635_0016467_2687_3643	308
261	3300046675	Ga0495657_0000753	Ga0495657_0000753_16040_16996	308
262	3300046678	Ga0495599_0090301	Ga0495599_0090301_549_1505	308
263	3300046679	Ga0495623_0000839	Ga0495623_0000839_10106_11062	308
264	3300046680	Ga0495646_0001826	Ga0495646_0001826_9055_10011	308
265	3300046689	Ga0495613_0003669	Ga0495613_0003669_8000_8956	308
266	3300046809	Ga0495600_0000470	Ga0495600_0000470_11810_12766	308
267	3300047315	Ga0495581_0002999	Ga0495581_0002999_3563_4519	308
268	3300047317	Ga0495604_0000885	Ga0495604_0000885_13346_14302	308
269	3300047319	Ga0495674_0304363	Ga0495674_0304363_196_1152	308
270	3300047444	Ga0495675_0001676	Ga0495675_0001676_9203_10159	308
271	3300047471	Ga0495684_0011420	Ga0495684_0011420_5159_6115	308
272	3300047673	Ga0495593_0006117	Ga0495593_0006117_356_1312	308
273	3300048088	Ga0495602_0001475	Ga0495602_0001475_12320_13276	308
274	3300049586	Ga0501070_0093141	Ga0501070_0093141_436_1362	308
275	3300053077	Ga0495601_0007337	Ga0495601_0007337_548_1504	308
276	3300053085	Ga0495619_0006203	Ga0495619_0006203_6256_7212	308
277	3300053140	Ga0500573_0056399	Ga0500573_0056399_251_1207	308
278	iso_pu_bacteria	2554235005	2554257129	308
279	iso_pu_bacteria	2582581313	2585305235	308
280	iso_pu_bacteria	2643221647	2644266033	308
281	iso_pu_bacteria	2784746768	2785370396	308
282	iso_pu_bacteria	2786546132	2786671567	308
283	iso_pu_bacteria	2802429296	2804846637	308
284	iso_pu_bacteria	2867428634	2867430849	308
285	iso_pu_bacteria	2867475112	2867480718	308
286	iso_pu_bacteria	2877676314	2877680211	308
287	iso_pu_bacteria	2912715099	2912718791	308
288	iso_pu_bacteria	2947224130	2947228180	308
289	iso_pu_bacteria	2954380949	2954385198	308
290	iso_pu_bacteria	2954673503	2954677851	308
291	iso_pu_bacteria	2954682443	2954686305	308
292	iso_pu_bacteria	2954691527	2954695981	308
293	iso_pu_bacteria	2954701450	2954711153	308
294	iso_pu_bacteria	2954711539	2954715388	308
295	iso_pu_bacteria	2954721474	2954725308	308
296	iso_pu_bacteria	2954731030	2954736507	308
297	iso_pu_bacteria	2954740390	2954744242	308
298	iso_pu_bacteria	2954749733	2954755336	308
299	iso_pu_bacteria	2954759201	2954763208	308
300	iso_pu_bacteria	2997451912	2997454374	308
301	iso_pu_bacteria	8025413630	8025415098	308
302	3300003316	rootH1_10095730	rootH1_100957303	309
303	3300003323	rootH1_10037094	rootH1_100370943	309
304	3300003323	rootH1_10096513	rootH1_100965132	309
305	3300025302	Ga0207426_1001874	Ga0207426_10018748	309
306	3300048926	Ga0496123_0200219	Ga0496123_0200219_19_948	309
307	iso_pu_bacteria	2862178590	2862180113	309
308	iso_pu_bacteria	3006486233	3006492753	309
309	3300037466	Ga0395898_0116930	Ga0395898_0116930_1076_2011	310
310	3300045976	Ga0466967_0003562	Ga0466967_0003562_2364_3299	310
311	3300047447	Ga0495685_026581	Ga0495685_026581_328_1350	310
312	3300049823	Ga0501044_0007943	Ga0501044_0007943_7733_8668	310
313	iso_pu_bacteria	2643221578	2643900611	310
314	iso_pu_bacteria	2643221673	2644405168	310
315	iso_pu_bacteria	2862281513	2862286564	310
316	iso_pu_bacteria	2912757875	2912761770	310
317	iso_pu_bacteria	2935390628	2935392767	310
318	iso_pu_bacteria	2946045630	2946049080	310
319	iso_pu_bacteria	8025530807	8025538225	310
320	iso_pu_bacteria	8056447290	8056453955	310
321	3300047444	Ga0495675_0009353	Ga0495675_0009353_4527_5636	311
322	3300003316	rootH1_10000824	rootH1_100008244	312
323	3300003323	rootH1_10055314	rootH1_100553142	312
324	3300005539	Ga0068853_100120232	Ga0068853_1001202322	312
325	3300005578	Ga0068854_100335454	Ga0068854_1003354541	312
326	3300006948	Ga0099826_10061363	Ga0099826_100613633	312
327	3300025297	Ga0209758_1011645	Ga0209758_10116453	312
328	3300026041	Ga0207639_10088610	Ga0207639_100886101	312
329	3300027312	Ga0209371_1017746	Ga0209371_10177462	312
330	3300028379	Ga0268266_10180017	Ga0268266_101800171	312
331	3300030500	Ga0268256_1017163	Ga0268256_10171632	312
332	3300031616	Ga0307508_10092435	Ga0307508_100924352	312
333	3300037466	Ga0395898_0016611	Ga0395898_0016611_3979_4917	312
334	3300042005	Ga0439448_0000317	Ga0439448_0000317_5559_6500	312
335	3300042007	Ga0439449_0000196	Ga0439449_0000196_7265_8203	312
336	3300042138	Ga0450903_000783	Ga0450903_000783_1882_2823	312
337	3300042157	Ga0439458_0000126	Ga0439458_0000126_7894_8835	312
338	3300047318	Ga0495636_0004258	Ga0495636_0004258_2117_3055	312
339	3300047443	Ga0495687_003604	Ga0495687_003604_4183_5121	312
340	3300047447	Ga0495685_002339	Ga0495685_002339_946_1884	312
341	3300047447	Ga0495685_021745	Ga0495685_021745_1123_2064	312
342	3300047447	Ga0495685_039982	Ga0495685_039982_162_1100	312
343	3300047472	Ga0495686_0036670	Ga0495686_0036670_976_1914	312
344	3300049570	Ga0501033_0035978	Ga0501033_0035978_1577_2536	312
345	3300049571	Ga0501034_0040685	Ga0501034_0040685_347_1306	312
346	3300049572	Ga0501036_0019416	Ga0501036_0019416_1918_2877	312
347	3300049579	Ga0501043_0015937	Ga0501043_0015937_2004_2963	312
348	3300049581	Ga0501047_0033783	Ga0501047_0033783_741_1700	312
349	3300049822	Ga0501035_0190692	Ga0501035_0190692_264_1211	312
350	3300049823	Ga0501044_0154797	Ga0501044_0154797_1313_2260	312
351	3300053086	Ga0500578_0110738	Ga0500578_0110738_35_973	312
352	iso_pu_bacteria	2582581314	2585312999	312
353	iso_pu_bacteria	2616644814	2616702944	312
354	iso_pu_bacteria	2643221678	2644437507	312
355	iso_pu_bacteria	2643221714	2644628084	312
356	iso_pu_bacteria	2808606359	2808842970	312
357	iso_pu_bacteria	2811994879	2812357149	312
358	iso_pu_bacteria	2811994917	2812479793	312
359	iso_pu_bacteria	2852635781	2852639970	312
360	iso_pu_bacteria	2862574272	2862578515	312
361	iso_pu_bacteria	2946064051	2946068726	312
362	iso_pu_bacteria	2946072368	2946076729	312
363	iso_pu_bacteria	8025478263	8025479858	312
364	3300049822	Ga0501035_0206591	Ga0501035_0206591_276_1232	313
365	iso_pu_bacteria	2808606375	2808921322	313
366	iso_pu_bacteria	2875391855	2875394758	313
367	iso_pu_bacteria	3006321560	3006325261	313
368	3300003320	rootH2_10006122	rootH2_100061223	314
369	3300006048	Ga0075363_100046600	Ga0075363_1000466003	314
370	3300006353	Ga0075370_10134080	Ga0075370_101340801	314
371	3300015688	Ga0183367_1015	Ga0183367_1015132	314
372	3300049569	Ga0501032_0076830	Ga0501032_0076830_1241_2194	314
373	3300049570	Ga0501033_0036048	Ga0501033_0036048_1113_2066	314
374	3300049572	Ga0501036_0132427	Ga0501036_0132427_365_1318	314
375	3300049579	Ga0501043_0096204	Ga0501043_0096204_108_1061	314
376	3300049581	Ga0501047_0093775	Ga0501047_0093775_1388_2341	314
377	3300049822	Ga0501035_0115850	Ga0501035_0115850_702_1655	314
378	3300049823	Ga0501044_0120866	Ga0501044_0120866_328_1281	314
379	3300049823	Ga0501044_0208374	Ga0501044_0208374_542_1636	314
380	3300050496	nmdc:mga07m45_56059_c1	nmdc:mga07m45_56059_c1_73_1017	314
381	iso_pu_bacteria	2784746763	2785342256	314
382	iso_pu_bacteria	8048406513	8048410108	314
383	3300046455	Ga0495603_0004282	Ga0495603_0004282_3719_4666	315
384	3300046455	Ga0495603_0076387	Ga0495603_0076387_856_1812	315
385	3300046492	Ga0495585_0013793	Ga0495585_0013793_1400_2356	315
386	3300046499	Ga0495594_0004137	Ga0495594_0004137_3865_4812	315
387	3300046533	Ga0495640_0007511	Ga0495640_0007511_6809_7765	315
388	3300046674	Ga0495588_0007472	Ga0495588_0007472_1848_2795	315
389	3300047317	Ga0495604_0031456	Ga0495604_0031456_3008_3964	315
390	3300049573	Ga0501037_0013806	Ga0501037_0013806_1570_2664	315
391	3300049581	Ga0501047_0000082	Ga0501047_0000082_41830_42924	315
392	3300003578	Ga0006562J51391_1083747	Ga0006562J51391_10837471	316
393	3300003578	Ga0006562J51391_1083748	Ga0006562J51391_10837483	316
394	3300009011	Ga0105251_10035257	Ga0105251_100352573	316
395	3300009036	Ga0105244_10101331	Ga0105244_101013311	316
396	3300009101	Ga0105247_10079135	Ga0105247_100791351	316
397	3300009551	Ga0105238_10239462	Ga0105238_102394622	316
398	3300025935	Ga0207709_10040266	Ga0207709_100402662	316
399	3300025935	Ga0207709_10047674	Ga0207709_100476742	316
400	3300028786	Ga0307517_10026479	Ga0307517_100264796	316
401	3300028794	Ga0307515_10017159	Ga0307515_1001715914	316
402	3300030521	Ga0307511_10004995	Ga0307511_100049953	316
403	3300030521	Ga0307511_10154584	Ga0307511_101545841	316
404	3300030522	Ga0307512_10008082	Ga0307512_100080824	316
405	3300031456	Ga0307513_10024628	Ga0307513_100246283	316
406	3300031507	Ga0307509_10030035	Ga0307509_100300354	316
407	3300031507	Ga0307509_10040760	Ga0307509_100407601	316
408	3300031507	Ga0307509_10115515	Ga0307509_101155152	316
409	3300031616	Ga0307508_10286882	Ga0307508_102868821	316
410	3300031649	Ga0307514_10008147	Ga0307514_100081476	316
411	3300031649	Ga0307514_10112375	Ga0307514_101123751	316
412	3300031730	Ga0307516_10019954	Ga0307516_100199542	316
413	3300031730	Ga0307516_10046424	Ga0307516_100464243	316
414	3300031730	Ga0307516_10286050	Ga0307516_102860502	316
415	3300032002	Ga0307416_100113801	Ga0307416_1001138012	316
416	3300033179	Ga0307507_10034543	Ga0307507_100345433	316
417	3300033180	Ga0307510_10103333	Ga0307510_101033332	316
418	3300037418	Ga0395900_0159103	Ga0395900_0159103_872_1822	316
419	3300038443	Ga0395901_0252115	Ga0395901_0252115_700_1650	316
420	3300041404	Ga0439436_0000868	Ga0439436_0000868_5993_6949	316
421	3300041404	Ga0439436_0001510	Ga0439436_0001510_4496_5446	316
422	3300041406	Ga0439439_0002621	Ga0439439_0002621_2363_3313	316
423	3300041512	Ga0451853_2320229	Ga0451853_2320229_35_997	316
424	3300041999	Ga0439433_0009543	Ga0439433_0009543_148_1104	316
425	3300042007	Ga0439449_0004702	Ga0439449_0004702_3228_4178	316
426	3300042014	Ga0439457_000199	Ga0439457_000199_3716_4672	316
427	3300042014	Ga0439457_000429	Ga0439457_000429_8440_9390	316
428	3300042015	Ga0439462_0005293	Ga0439462_0005293_2169_3119	316
429	3300042131	Ga0450894_001016	Ga0450894_001016_1895_2857	316
430	3300042134	Ga0450898_002051	Ga0450898_002051_389_1351	316
431	3300042145	Ga0450906_000187	Ga0450906_000187_896_1858	316
432	3300044656	Ga0466969_0031057	Ga0466969_0031057_1498_2448	316
433	3300044658	Ga0466972_0000963	Ga0466972_0000963_1196_2146	316
434	3300044658	Ga0466972_0014666	Ga0466972_0014666_960_1910	316
435	3300044683	Ga0466965_0003394	Ga0466965_0003394_5582_6532	316
436	3300044683	Ga0466965_0046562	Ga0466965_0046562_1153_2103	316
437	3300044684	Ga0466966_0003462	Ga0466966_0003462_722_1672	316
438	3300044684	Ga0466966_0042784	Ga0466966_0042784_910_1860	316
439	3300044693	Ga0466961_0014703	Ga0466961_0014703_2906_3856	316
440	3300044694	Ga0466963_0000577	Ga0466963_0000577_9070_10020	316
441	3300044694	Ga0466963_0008536	Ga0466963_0008536_1552_2502	316
442	3300044694	Ga0466963_0245934	Ga0466963_0245934_278_1228	316
443	3300044706	Ga0466964_0008334	Ga0466964_0008334_1995_2945	316
444	3300044719	Ga0466971_0000648	Ga0466971_0000648_10957_11907	316
445	3300044765	Ga0466970_0006133	Ga0466970_0006133_2820_3770	316
446	3300044842	Ga0466957_0007078	Ga0466957_0007078_4611_5561	316
447	3300044842	Ga0466957_0019045	Ga0466957_0019045_556_1506	316
448	3300045049	Ga0466959_0023864	Ga0466959_0023864_2521_3471	316
449	3300045836	Ga0466958_0014401	Ga0466958_0014401_2521_3471	316
450	3300046454	Ga0495592_0029009	Ga0495592_0029009_1527_2477	316
451	3300046455	Ga0495603_0015768	Ga0495603_0015768_1604_2554	316
452	3300046455	Ga0495603_0061620	Ga0495603_0061620_772_1722	316
453	3300046459	Ga0495629_0020928	Ga0495629_0020928_2463_3413	316
454	3300046459	Ga0495629_0034734	Ga0495629_0034734_107_1057	316
455	3300046460	Ga0495638_0038620	Ga0495638_0038620_2021_2971	316
456	3300046460	Ga0495638_0211923	Ga0495638_0211923_67_1017	316
457	3300046462	Ga0495651_0027667	Ga0495651_0027667_687_1637	316
458	3300046472	Ga0495580_0145682	Ga0495580_0145682_445_1395	316
459	3300046474	Ga0495605_0016409	Ga0495605_0016409_254_1204	316
460	3300046475	Ga0495639_0012763	Ga0495639_0012763_2548_3498	316
461	3300046476	Ga0495662_0001288	Ga0495662_0001288_5462_6412	316
462	3300046476	Ga0495662_0003663	Ga0495662_0003663_2148_3098	316
463	3300046477	Ga0495664_0001242	Ga0495664_0001242_5082_6032	316
464	3300046477	Ga0495664_0075516	Ga0495664_0075516_408_1358	316
465	3300046491	Ga0495584_0023684	Ga0495584_0023684_30_980	316
466	3300046501	Ga0495607_0058835	Ga0495607_0058835_1110_2060	316
467	3300046506	Ga0495583_0012237	Ga0495583_0012237_1398_2348	316
468	3300046506	Ga0495583_0041914	Ga0495583_0041914_694_1644	316
469	3300046507	Ga0495606_0008611	Ga0495606_0008611_2298_3248	316
470	3300046512	Ga0495610_0043904	Ga0495610_0043904_519_1469	316
471	3300046513	Ga0495616_0005356	Ga0495616_0005356_6422_7372	316
472	3300046514	Ga0495618_0060376	Ga0495618_0060376_860_1810	316
473	3300046515	Ga0495620_0007414	Ga0495620_0007414_3464_4414	316
474	3300046515	Ga0495620_0007866	Ga0495620_0007866_332_1282	316
475	3300046516	Ga0495628_0021249	Ga0495628_0021249_4358_5308	316
476	3300046516	Ga0495628_0101783	Ga0495628_0101783_794_1744	316
477	3300046517	Ga0495630_0005987	Ga0495630_0005987_1924_2874	316
478	3300046517	Ga0495630_0212834	Ga0495630_0212834_70_1020	316
479	3300046518	Ga0495631_0009485	Ga0495631_0009485_2102_3052	316
480	3300046522	Ga0495643_0007256	Ga0495643_0007256_976_1926	316
481	3300046524	Ga0495648_0036374	Ga0495648_0036374_581_1531	316
482	3300046528	Ga0495642_0015525	Ga0495642_0015525_1661_2611	316
483	3300046529	Ga0495652_0025407	Ga0495652_0025407_2011_2961	316
484	3300046530	Ga0495654_0005236	Ga0495654_0005236_6120_7070	316
485	3300046533	Ga0495640_0018257	Ga0495640_0018257_382_1332	316
486	3300046533	Ga0495640_0077516	Ga0495640_0077516_30_980	316
487	3300046535	Ga0495586_0049099	Ga0495586_0049099_1057_2007	316
488	3300046536	Ga0495587_0008832	Ga0495587_0008832_4055_5005	316
489	3300046536	Ga0495587_0099936	Ga0495587_0099936_280_1230	316
490	3300046538	Ga0495609_0010394	Ga0495609_0010394_2173_3123	316
491	3300046542	Ga0495597_0013636	Ga0495597_0013636_2410_3360	316
492	3300046542	Ga0495597_0038097	Ga0495597_0038097_932_1882	316
493	3300046557	Ga0495622_0004786	Ga0495622_0004786_2207_3157	316
494	3300046558	Ga0495633_0012204	Ga0495633_0012204_1266_2216	316
495	3300046616	Ga0495668_0198880	Ga0495668_0198880_85_1035	316
496	3300046642	Ga0495634_0004615	Ga0495634_0004615_6467_7417	316
497	3300046642	Ga0495634_0058909	Ga0495634_0058909_264_1214	316
498	3300046660	Ga0495625_0014518	Ga0495625_0014518_1335_2285	316
499	3300046663	Ga0495635_0000630	Ga0495635_0000630_6339_7289	316
500	3300046665	Ga0495661_0163984	Ga0495661_0163984_84_1034	316
501	3300046674	Ga0495588_0001717	Ga0495588_0001717_7045_7995	316
502	3300046675	Ga0495657_0002765	Ga0495657_0002765_7134_8084	316
503	3300046675	Ga0495657_0006660	Ga0495657_0006660_3906_4856	316
504	3300046679	Ga0495623_0014297	Ga0495623_0014297_2675_3625	316
505	3300046680	Ga0495646_0000669	Ga0495646_0000669_6405_7355	316
506	3300046680	Ga0495646_0086551	Ga0495646_0086551_569_1519	316
507	3300046689	Ga0495613_0000866	Ga0495613_0000866_20250_21200	316
508	3300046689	Ga0495613_0005024	Ga0495613_0005024_3822_4772	316
509	3300046689	Ga0495613_0012673	Ga0495613_0012673_3791_4741	316
510	3300046689	Ga0495613_0016989	Ga0495613_0016989_2000_2950	316
511	3300046689	Ga0495613_0087001	Ga0495613_0087001_201_1151	316
512	3300046692	Ga0495671_0006819	Ga0495671_0006819_599_1549	316
513	3300046692	Ga0495671_0124816	Ga0495671_0124816_224_1174	316
514	3300046694	Ga0495649_0026281	Ga0495649_0026281_265_1215	316
515	3300046794	Ga0495589_0014832	Ga0495589_0014832_2784_3734	316
516	3300046794	Ga0495589_0069478	Ga0495589_0069478_498_1448	316
517	3300046794	Ga0495589_0077248	Ga0495589_0077248_374_1324	316
518	3300046809	Ga0495600_0060162	Ga0495600_0060162_536_1486	316
519	3300046810	Ga0495660_0027011	Ga0495660_0027011_2025_2975	316
520	3300047315	Ga0495581_0002931	Ga0495581_0002931_6571_7521	316
521	3300047315	Ga0495581_0146682	Ga0495581_0146682_202_1152	316
522	3300047315	Ga0495581_0234417	Ga0495581_0234417_94_1044	316
523	3300047317	Ga0495604_0000597	Ga0495604_0000597_7703_8653	316
524	3300047317	Ga0495604_0089592	Ga0495604_0089592_473_1423	316
525	3300047318	Ga0495636_0004429	Ga0495636_0004429_4274_5224	316
526	3300047318	Ga0495636_0021320	Ga0495636_0021320_538_1488	316
527	3300047319	Ga0495674_0015461	Ga0495674_0015461_6073_7023	316
528	3300047319	Ga0495674_0073939	Ga0495674_0073939_1129_2079	316
529	3300047320	Ga0495672_0088521	Ga0495672_0088521_235_1185	316
530	3300047321	Ga0495676_0032614	Ga0495676_0032614_2909_3859	316
531	3300047321	Ga0495676_0071907	Ga0495676_0071907_434_1384	316
532	3300047323	Ga0495683_0042555	Ga0495683_0042555_600_1550	316
533	3300047323	Ga0495683_0048905	Ga0495683_0048905_785_1735	316
534	3300047443	Ga0495687_020853	Ga0495687_020853_733_1683	316
535	3300047443	Ga0495687_076727	Ga0495687_076727_233_1183	316
536	3300047445	Ga0495677_0013126	Ga0495677_0013126_880_1830	316
537	3300047447	Ga0495685_009049	Ga0495685_009049_2241_3191	316
538	3300047447	Ga0495685_030471	Ga0495685_030471_595_1545	316
539	3300047469	Ga0495673_0058684	Ga0495673_0058684_577_1527	316
540	3300047470	Ga0495681_0001188	Ga0495681_0001188_15522_16472	316
541	3300047470	Ga0495681_0022365	Ga0495681_0022365_945_1895	316
542	3300047470	Ga0495681_0046838	Ga0495681_0046838_499_1449	316
543	3300047673	Ga0495593_0000502	Ga0495593_0000502_6057_7007	316
544	3300047673	Ga0495593_0048473	Ga0495593_0048473_776_1726	316
545	3300048089	Ga0495614_0003095	Ga0495614_0003095_4236_5186	316
546	3300048091	Ga0495626_0045286	Ga0495626_0045286_1077_2027	316
547	3300048911	Ga0496108_0045431	Ga0496108_0045431_1209_2159	316
548	3300049459	Ga0495678_016976	Ga0495678_016976_1532_2482	316
549	3300049460	Ga0495682_0017223	Ga0495682_0017223_1577_2527	316
550	3300049568	Ga0501031_0012595	Ga0501031_0012595_546_1496	316
551	3300049569	Ga0501032_0010563	Ga0501032_0010563_672_1622	316
552	3300049569	Ga0501032_0207127	Ga0501032_0207127_309_1259	316
553	3300049570	Ga0501033_0016477	Ga0501033_0016477_308_1258	316
554	3300049570	Ga0501033_0074361	Ga0501033_0074361_888_1838	316
555	3300049570	Ga0501033_0102731	Ga0501033_0102731_88_1038	316
556	3300049571	Ga0501034_0014105	Ga0501034_0014105_1873_2823	316
557	3300049571	Ga0501034_0052703	Ga0501034_0052703_448_1398	316
558	3300049571	Ga0501034_0081190	Ga0501034_0081190_1306_2256	316
559	3300049572	Ga0501036_0002046	Ga0501036_0002046_8975_9925	316
560	3300049572	Ga0501036_0016057	Ga0501036_0016057_2202_3152	316
561	3300049573	Ga0501037_0001542	Ga0501037_0001542_10586_11536	316
562	3300049574	Ga0501038_0013850	Ga0501038_0013850_30_980	316
563	3300049575	Ga0501039_0031591	Ga0501039_0031591_2194_3144	316
564	3300049575	Ga0501039_0068988	Ga0501039_0068988_505_1455	316
565	3300049578	Ga0501042_0070648	Ga0501042_0070648_1065_2015	316
566	3300049579	Ga0501043_0006543	Ga0501043_0006543_5078_6028	316
567	3300049579	Ga0501043_0008595	Ga0501043_0008595_2171_3121	316
568	3300049580	Ga0501046_0212450	Ga0501046_0212450_343_1293	316
569	3300049581	Ga0501047_0039899	Ga0501047_0039899_3344_4294	316
570	3300049581	Ga0501047_0262097	Ga0501047_0262097_133_1083	316
571	3300049581	Ga0501047_0370324	Ga0501047_0370324_225_1175	316
572	3300049582	Ga0501048_0042745	Ga0501048_0042745_221_1171	316
573	3300049586	Ga0501070_0038348	Ga0501070_0038348_2160_3110	316
574	3300049590	Ga0501074_0009630	Ga0501074_0009630_2180_3130	316
575	3300049822	Ga0501035_0064918	Ga0501035_0064918_657_1607	316
576	3300049822	Ga0501035_0065271	Ga0501035_0065271_628_1578	316
577	3300049823	Ga0501044_0012253	Ga0501044_0012253_218_1168	316
578	3300049823	Ga0501044_0375086	Ga0501044_0375086_217_1167	316
579	3300053078	Ga0495612_0096613	Ga0495612_0096613_103_1053	316
580	3300053095	Ga0500640_000713	Ga0500640_000713_7109_8059	316
581	3300053107	Ga0500560_050038	Ga0500560_050038_208_1158	316
582	3300053111	Ga0500572_014624	Ga0500572_014624_382_1332	316
583	3300053157	Ga0500624_006515	Ga0500624_006515_535_1485	316
584	3300061719	Ga0466962_0017439	Ga0466962_0017439_910_1860	316
585	iso_pu_bacteria	2862382967	2862388223	316
586	iso_pu_bacteria	2862507626	2862510201	316
587	iso_pu_bacteria	2863404153	2863412004	316
588	iso_pu_bacteria	2954002825	2954006226	316
589	iso_pu_bacteria	2990059506	2990066671	316
590	iso_pu_bacteria	8008558824	8008566124	316
591	iso_pu_bacteria	8056667051	8056669129	316
592	3300014497	Ga0182008_10002106	Ga0182008_1000210611	317
593	3300015262	Ga0182007_10001245	Ga0182007_100012452	317
594	3300044683	Ga0466965_0150804	Ga0466965_0150804_107_1063	317
595	3300044901	Ga0466960_0003148	Ga0466960_0003148_630_1586	317
596	3300044901	Ga0466960_0096628	Ga0466960_0096628_442_1395	317
597	3300045976	Ga0466967_0209890	Ga0466967_0209890_596_1549	317
598	iso_pu_bacteria	2547132111	2547411574	317
599	iso_pu_bacteria	2784132148	2784589344	317
600	iso_pu_bacteria	2808606448	2809233004	317
601	iso_pu_bacteria	2873151551	2873155049	317
602	iso_pu_bacteria	3006493962	3006500284	317
603	iso_pu_bacteria	8023623736	8023628713	317
604	3300049568	Ga0501031_0094633	Ga0501031_0094633_658_1626	319
605	3300049574	Ga0501038_0019137	Ga0501038_0019137_2502_3470	319
606	3300049575	Ga0501039_0122462	Ga0501039_0122462_451_1419	319
607	3300049579	Ga0501043_0033503	Ga0501043_0033503_919_1887	319
608	3300049579	Ga0501043_0123270	Ga0501043_0123270_648_1616	319
609	3300049581	Ga0501047_0091368	Ga0501047_0091368_1418_2386	319
610	3300049581	Ga0501047_0221665	Ga0501047_0221665_359_1327	319
611	3300049823	Ga0501044_0031956	Ga0501044_0031956_2398_3366	319
612	3300041494	Ga0451837_0204830	Ga0451837_0204830_537_1502	321
613	3300001989	JGI24739J22299_10017408	JGI24739J22299_100174083	322
614	3300001990	JGI24737J22298_10034894	JGI24737J22298_100348942	322
615	3300005937	Ga0081455_10039376	Ga0081455_100393764	322
616	3300025904	Ga0207647_10004042	Ga0207647_100040425	322
617	3300030500	Ga0268256_1036181	Ga0268256_10361812	322
618	3300030522	Ga0307512_10000978	Ga0307512_1000097820	322
619	3300031616	Ga0307508_10006811	Ga0307508_100068116	322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

69

321

0.77 PF12146

Hydrolase_4

Serine aminopeptidase, S33

68

321

0.68 PF12697

Abhydrolase_6

Alpha/beta hydrolase family

71

327

0.61 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5ng7-assembly1.cif.gz_A	novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments	0.9021	31	316
7jqy-assembly1.cif.gz_B	crystal structure of cfl1-d123s from burkholderia cenocepacia	0.8863	24	317
7jqx-assembly1.cif.gz_A	crystal structure of cfl1 wild-type from burkholderia cenocepacia	0.8861	24	317
4nvr-assembly2.cif.gz_D	2.22 angstrom resolution crystal structure of a putative acyltransferase from salmonella enterica	0.8831	31	315
5ng7-assembly1.cif.gz_A	novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments	0.8782	31	316

ID	Description	Score	Start	End	Superfamily
af_I6YCQ4_15_321_3.40.50.1820	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.9399	32	316	3.40.50.1820
5ng7B00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.9102	31	316	3.40.50.1820
af_A0A0R4ILH2_75_359_3.40.50.1820	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.9015	33	316	3.40.50.1820
af_A0A0R4ILH2_75_359_3.40.50.1820	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.8954	33	316	3.40.50.1820
af_Q3V1F8_86_363_3.40.50.1820	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain	0.8921	36	316	3.40.50.1820

ID	Description	Score	Start	End	GO Terms
AF-A0A6N7I5L9-F1-model_v4	Alpha/beta fold hydrolase	0.9659	18	322	GO:0016787
AF-A0A5D0T763-F1-model_v4	Alpha/beta hydrolase	0.9586	31	317	GO:0016787
AF-A0A6J5YYM4-F1-model_v4	Unannotated protein	0.9582	31	316	GO:0003824
AF-A0A7Z0PTM3-F1-model_v4	Alpha/beta hydrolase	0.9511	1	322	GO:0016787
AF-A0A7Z0PTM3-F1-model_v4	Alpha/beta hydrolase	0.9481	1	322	GO:0016787

Feature Viewer

pLDDT	pTM	Quality
90.5	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F469877

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

69

321

0.77

PF12146

Hydrolase_4

Serine aminopeptidase, S33

68

321

0.68

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

71

327

0.61

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map