F469859
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 619 | 365 | 587 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0247118|Ga0501070_0247118_411_1211 |
| Length | 266 |
| Sequence | MHSAATLPLRASPAATICNGVTRIFVVTMIMVWPDRFRTSPVSDTSDAIMLDIQNLTKTYRSAQERIAVLRGACLRVEPGESVALTGESGSGKSTLLHLIAGLDQADSGSIRFEDTEVTGLADRGRATLRRERLGLVFQQFNLIPSLTVADNLAFQARIAGRHDGRWQGELVDRLGLGDVLKRYPEQLSGGQQQRVAIGRALAVRPPLLLADEPTGNLDEATADGVMDLARDLIKRTGCGFLMVTHSARLAATLDRQVRLSAGQIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 7 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 8 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 9 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 10 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 11 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 12 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 13 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 14 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 15 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 16 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 17 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 18 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 19 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 20 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 21 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 22 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 23 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 165 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 166 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 170 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 177 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 178 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 179 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 180 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 189 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 208 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 209 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 279 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 327 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 337 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 338 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 340 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 341 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 343 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 348 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 350 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 352 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 355 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 356 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 357 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 358 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 359 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 360 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 361 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 362 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 363 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 364 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 365 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.13 |
| Metatranscriptomes | 0.16 |
| Isolates | 4.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.24 |
| Nodule | 3.55 |
| Rhizoplane | 3.55 |
| Rhizosphere | 74.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10037506 | 3300001990 | Bacteria | 1493 |
| 2 | JGI25406J46586_10001070 | 3300003203 | Bacteria | 12840 |
| 3 | JGI25404J52841_10005846 | 3300003659 | Bacteria | 2551 |
| 4 | Ga0070683_100039979 | 3300005329 | Bacteria | 4309 |
| 5 | Ga0068869_100645658 | 3300005334 | Bacteria | 898 |
| 6 | Ga0070680_100097862 | 3300005336 | Bacteria | 2433 |
| 7 | Ga0070680_100267135 | 3300005336 | Bacteria | 1448 |
| 8 | Ga0070680_100698008 | 3300005336 | Bacteria | 873 |
| 9 | Ga0070682_100140230 | 3300005337 | Bacteria | 1647 |
| 10 | Ga0070660_100015135 | 3300005339 | Bacteria | 5566 |
| 11 | Ga0070691_10028127 | 3300005341 | Bacteria | 2625 |
| 12 | Ga0070692_10108039 | 3300005345 | Bacteria | 1535 |
| 13 | Ga0070668_100124669 | 3300005347 | Bacteria | 2062 |
| 14 | Ga0070671_100376557 | 3300005355 | Bacteria | 1213 |
| 15 | Ga0070674_100021497 | 3300005356 | Bacteria | 4144 |
| 16 | Ga0070659_100061934 | 3300005366 | Bacteria | 2957 |
| 17 | Ga0070659_100566076 | 3300005366 | Bacteria | 974 |
| 18 | Ga0070709_10000732 | 3300005434 | Bacteria | 18548 |
| 19 | Ga0070709_10068699 | 3300005434 | Bacteria | 2280 |
| 20 | Ga0070709_10123135 | 3300005434 | Bacteria | 1761 |
| 21 | Ga0070709_10489253 | 3300005434 | Bacteria | 933 |
| 22 | Ga0070714_100010788 | 3300005435 | Bacteria | 7232 |
| 23 | Ga0070714_100056936 | 3300005435 | Bacteria | 3345 |
| 24 | Ga0070714_100130000 | 3300005435 | Bacteria | 2250 |
| 25 | Ga0070714_100558377 | 3300005435 | Bacteria | 1097 |
| 26 | Ga0070713_100004657 | 3300005436 | Bacteria | 9258 |
| 27 | Ga0070713_100053012 | 3300005436 | Bacteria | 3360 |
| 28 | Ga0070713_100089395 | 3300005436 | Bacteria | 2645 |
| 29 | Ga0070713_100128305 | 3300005436 | Bacteria | 2234 |
| 30 | Ga0070713_100310531 | 3300005436 | Bacteria | 1454 |
| 31 | Ga0070710_10004377 | 3300005437 | Bacteria | 6688 |
| 32 | Ga0070710_10014128 | 3300005437 | Bacteria | 4012 |
| 33 | Ga0070710_10167727 | 3300005437 | Bacteria | 1366 |
| 34 | Ga0070711_100001113 | 3300005439 | Bacteria | 14371 |
| 35 | Ga0070663_100015495 | 3300005455 | Bacteria | 4924 |
| 36 | Ga0070662_100029453 | 3300005457 | Bacteria | 3832 |
| 37 | Ga0070681_10087866 | 3300005458 | Bacteria | 3061 |
| 38 | Ga0070681_10168780 | 3300005458 | Bacteria | 2110 |
| 39 | Ga0070707_100062897 | 3300005468 | Bacteria | 3561 |
| 40 | Ga0070698_100083348 | 3300005471 | Bacteria | 3187 |
| 41 | Ga0070679_100023653 | 3300005530 | Bacteria | 6017 |
| 42 | Ga0070679_100396250 | 3300005530 | Bacteria | 1327 |
| 43 | Ga0070684_100008002 | 3300005535 | Bacteria | 8253 |
| 44 | Ga0070684_100021034 | 3300005535 | Bacteria | 5420 |
| 45 | Ga0070697_100031162 | 3300005536 | Bacteria | 4288 |
| 46 | Ga0070697_100062812 | 3300005536 | Bacteria | 3032 |
| 47 | Ga0070697_100165141 | 3300005536 | Bacteria | 1872 |
| 48 | Ga0068853_100034017 | 3300005539 | Bacteria | 4324 |
| 49 | Ga0068853_100127126 | 3300005539 | Bacteria | 2278 |
| 50 | Ga0070672_100042288 | 3300005543 | Bacteria | 3508 |
| 51 | Ga0070693_100096847 | 3300005547 | Bacteria | 1789 |
| 52 | Ga0070665_100401617 | 3300005548 | Bacteria | 1378 |
| 53 | Ga0068855_100012487 | 3300005563 | Bacteria | 10252 |
| 54 | Ga0068855_100052929 | 3300005563 | Bacteria | 4778 |
| 55 | Ga0068857_100023914 | 3300005577 | Bacteria | 5378 |
| 56 | Ga0068857_100059405 | 3300005577 | Bacteria | 3396 |
| 57 | Ga0068857_100420465 | 3300005577 | Bacteria | 1246 |
| 58 | Ga0068854_100376662 | 3300005578 | Bacteria | 1168 |
| 59 | Ga0068854_100511060 | 3300005578 | Bacteria | 1013 |
| 60 | Ga0068856_100928639 | 3300005614 | Bacteria | 889 |
| 61 | Ga0070702_100032706 | 3300005615 | Bacteria | 2855 |
| 62 | Ga0068852_100002923 | 3300005616 | Bacteria | 11867 |
| 63 | Ga0068852_100048949 | 3300005616 | Bacteria | 3614 |
| 64 | Ga0068852_100786722 | 3300005616 | Bacteria | 965 |
| 65 | Ga0068859_100132852 | 3300005617 | Bacteria | 2561 |
| 66 | Ga0068866_10026038 | 3300005718 | Bacteria | 2757 |
| 67 | Ga0068861_100031166 | 3300005719 | Bacteria | 3914 |
| 68 | Ga0068860_100000257 | 3300005843 | Bacteria | 78468 |
| 69 | Ga0068862_100177207 | 3300005844 | Bacteria | 1912 |
| 70 | Ga0081455_10010356 | 3300005937 | Bacteria | 9474 |
| 71 | Ga0081455_10088422 | 3300005937 | Bacteria | 2517 |
| 72 | Ga0081540_1006050 | 3300005983 | Bacteria | 8898 |
| 73 | Ga0081540_1006692 | 3300005983 | Bacteria | 8337 |
| 74 | Ga0081540_1040529 | 3300005983 | Bacteria | 2427 |
| 75 | Ga0081539_10000530 | 3300005985 | Bacteria | 79454 |
| 76 | Ga0070717_10168325 | 3300006028 | Bacteria | 1905 |
| 77 | Ga0075365_10027944 | 3300006038 | Bacteria | 3593 |
| 78 | Ga0075368_10029829 | 3300006042 | Bacteria | 2110 |
| 79 | Ga0075364_10225961 | 3300006051 | Bacteria | 1271 |
| 80 | Ga0070715_10157171 | 3300006163 | Bacteria | 1120 |
| 81 | Ga0070716_100009694 | 3300006173 | Bacteria | 4806 |
| 82 | Ga0070716_100012248 | 3300006173 | Bacteria | 4343 |
| 83 | Ga0070716_100537794 | 3300006173 | Bacteria | 869 |
| 84 | Ga0070712_100014993 | 3300006175 | Bacteria | 4983 |
| 85 | Ga0070712_100141682 | 3300006175 | Bacteria | 1836 |
| 86 | Ga0070712_100470155 | 3300006175 | Bacteria | 1050 |
| 87 | Ga0075369_10049606 | 3300006186 | Bacteria | 1813 |
| 88 | Ga0075428_100125716 | 3300006844 | Bacteria | 2790 |
| 89 | Ga0075428_100356015 | 3300006844 | Bacteria | 1571 |
| 90 | Ga0075434_100072646 | 3300006871 | Bacteria | 3432 |
| 91 | Ga0068865_100148872 | 3300006881 | Bacteria | 1774 |
| 92 | Ga0075436_100098286 | 3300006914 | Bacteria | 2037 |
| 93 | Ga0097620_100132852 | 3300006931 | Bacteria | 2561 |
| 94 | Ga0075435_100327410 | 3300007076 | Bacteria | 1312 |
| 95 | Ga0099794_10034843 | 3300007265 | Bacteria | 2374 |
| 96 | Ga0099794_10038540 | 3300007265 | Bacteria | 2265 |
| 97 | Ga0099795_10037570 | 3300007788 | Bacteria | 1705 |
| 98 | Ga0099795_10090904 | 3300007788 | Bacteria | 1183 |
| 99 | Ga0105240_10009432 | 3300009093 | Bacteria | 13814 |
| 100 | Ga0105240_10013377 | 3300009093 | Bacteria | 11267 |
| 101 | Ga0105240_10027328 | 3300009093 | Bacteria | 7471 |
| 102 | Ga0111539_10121973 | 3300009094 | Bacteria | 3054 |
| 103 | Ga0105245_10023002 | 3300009098 | Bacteria | 5468 |
| 104 | Ga0114129_10078084 | 3300009147 | Bacteria | 4605 |
| 105 | Ga0105243_10036413 | 3300009148 | Bacteria | 3820 |
| 106 | Ga0105243_10836287 | 3300009148 | Bacteria | 910 |
| 107 | Ga0105243_11101531 | 3300009148 | Bacteria | 802 |
| 108 | Ga0105241_10141400 | 3300009174 | Bacteria | 1960 |
| 109 | Ga0105248_10008995 | 3300009177 | Bacteria | 10981 |
| 110 | Ga0105248_10175028 | 3300009177 | Bacteria | 2419 |
| 111 | Ga0105237_10005001 | 3300009545 | Bacteria | 15097 |
| 112 | Ga0105237_10012543 | 3300009545 | Bacteria | 8927 |
| 113 | Ga0105238_10011156 | 3300009551 | Bacteria | 9037 |
| 114 | Ga0105238_10472193 | 3300009551 | Bacteria | 1253 |
| 115 | Ga0105249_10032742 | 3300009553 | Bacteria | 4704 |
| 116 | Ga0099796_10044981 | 3300010159 | Bacteria | 1511 |
| 117 | Ga0099796_10078459 | 3300010159 | Bacteria | 1206 |
| 118 | Ga0105239_10004474 | 3300010375 | Bacteria | 16696 |
| 119 | Ga0105239_10819732 | 3300010375 | Bacteria | 1066 |
| 120 | Ga0105239_10968208 | 3300010375 | Bacteria | 978 |
| 121 | Ga0105246_10407952 | 3300011119 | Bacteria | 1130 |
| 122 | Ga0157369_10009146 | 3300013105 | Bacteria | 11335 |
| 123 | Ga0157369_10031113 | 3300013105 | Bacteria | 5880 |
| 124 | Ga0157369_10267128 | 3300013105 | Bacteria | 1783 |
| 125 | Ga0157369_10346000 | 3300013105 | Bacteria | 1544 |
| 126 | Ga0157378_10134227 | 3300013297 | Bacteria | 2294 |
| 127 | Ga0157375_10033840 | 3300013308 | Bacteria | 4861 |
| 128 | Ga0163163_10347324 | 3300014325 | Bacteria | 1539 |
| 129 | Ga0163163_10822047 | 3300014325 | Bacteria | 993 |
| 130 | Ga0157380_10131962 | 3300014326 | Bacteria | 2133 |
| 131 | Ga0157379_10149767 | 3300014968 | Bacteria | 2105 |
| 132 | Ga0157376_10431800 | 3300014969 | Bacteria | 1280 |
| 133 | Ga0163161_10047181 | 3300017792 | Bacteria | 3111 |
| 134 | Ga0163161_10108055 | 3300017792 | Bacteria | 2077 |
| 135 | Ga0163161_10147496 | 3300017792 | Bacteria | 1786 |
| 136 | Ga0213876_10000991 | 3300021384 | Bacteria | 18609 |
| 137 | Ga0213876_10296837 | 3300021384 | Bacteria | 859 |
| 138 | Ga0209148_1009224 | 3300025254 | Bacteria | 1934 |
| 139 | Ga0209233_1002050 | 3300025261 | Bacteria | 7637 |
| 140 | Ga0209233_1004852 | 3300025261 | Bacteria | 4528 |
| 141 | Ga0209455_1005109 | 3300025272 | Bacteria | 4129 |
| 142 | Ga0209455_1012118 | 3300025272 | Bacteria | 2082 |
| 143 | Ga0207656_10062872 | 3300025321 | Bacteria | 1633 |
| 144 | Ga0207692_10000494 | 3300025898 | Bacteria | 13955 |
| 145 | Ga0207692_10042495 | 3300025898 | Bacteria | 2257 |
| 146 | Ga0207710_10006473 | 3300025900 | Bacteria | 4997 |
| 147 | Ga0207688_10130340 | 3300025901 | Bacteria | 1474 |
| 148 | Ga0207685_10069101 | 3300025905 | Bacteria | 1425 |
| 149 | Ga0207699_10004161 | 3300025906 | Bacteria | 6928 |
| 150 | Ga0207699_10015928 | 3300025906 | Bacteria | 3920 |
| 151 | Ga0207645_10065263 | 3300025907 | Bacteria | 2326 |
| 152 | Ga0207654_10203702 | 3300025911 | Bacteria | 1304 |
| 153 | Ga0207707_10043500 | 3300025912 | Bacteria | 3918 |
| 154 | Ga0207707_10058212 | 3300025912 | Bacteria | 3363 |
| 155 | Ga0207695_10020475 | 3300025913 | Bacteria | 7574 |
| 156 | Ga0207695_10028143 | 3300025913 | Bacteria | 6240 |
| 157 | Ga0207671_10145683 | 3300025914 | Bacteria | 1827 |
| 158 | Ga0207693_10007348 | 3300025915 | Bacteria | 9061 |
| 159 | Ga0207693_10054260 | 3300025915 | Bacteria | 3144 |
| 160 | Ga0207663_10000356 | 3300025916 | Bacteria | 19925 |
| 161 | Ga0207663_10056552 | 3300025916 | Bacteria | 2467 |
| 162 | Ga0207660_10026709 | 3300025917 | Bacteria | 3933 |
| 163 | Ga0207660_10166299 | 3300025917 | Bacteria | 1705 |
| 164 | Ga0207660_10236008 | 3300025917 | Bacteria | 1439 |
| 165 | Ga0207657_10006056 | 3300025919 | Bacteria | 12577 |
| 166 | Ga0207657_10117003 | 3300025919 | Bacteria | 2195 |
| 167 | Ga0207649_10417556 | 3300025920 | Bacteria | 1007 |
| 168 | Ga0207652_10018674 | 3300025921 | Bacteria | 5690 |
| 169 | Ga0207652_10997065 | 3300025921 | Bacteria | 736 |
| 170 | Ga0207646_10057962 | 3300025922 | Bacteria | 3460 |
| 171 | Ga0207646_10628179 | 3300025922 | Bacteria | 963 |
| 172 | Ga0207694_10015674 | 3300025924 | Bacteria | 5717 |
| 173 | Ga0207687_10050362 | 3300025927 | Bacteria | 2899 |
| 174 | Ga0207700_10037768 | 3300025928 | Bacteria | 3500 |
| 175 | Ga0207700_10336598 | 3300025928 | Bacteria | 1311 |
| 176 | Ga0207700_10429936 | 3300025928 | Bacteria | 1161 |
| 177 | Ga0207664_10001702 | 3300025929 | Bacteria | 14493 |
| 178 | Ga0207664_10309465 | 3300025929 | Bacteria | 1391 |
| 179 | Ga0207706_10359974 | 3300025933 | Bacteria | 1264 |
| 180 | Ga0207686_10345406 | 3300025934 | Bacteria | 1119 |
| 181 | Ga0207669_10005920 | 3300025937 | Bacteria | 5536 |
| 182 | Ga0207704_10027636 | 3300025938 | Bacteria | 3134 |
| 183 | Ga0207665_10033184 | 3300025939 | Bacteria | 3420 |
| 184 | Ga0207665_10560749 | 3300025939 | Bacteria | 888 |
| 185 | Ga0207691_10091254 | 3300025940 | Bacteria | 2730 |
| 186 | Ga0207691_10766584 | 3300025940 | Bacteria | 812 |
| 187 | Ga0207661_10012674 | 3300025944 | Bacteria | 6137 |
| 188 | Ga0207661_10043590 | 3300025944 | Bacteria | 3541 |
| 189 | Ga0207667_10011217 | 3300025949 | Bacteria | 10427 |
| 190 | Ga0207667_10088803 | 3300025949 | Bacteria | 3196 |
| 191 | Ga0207667_10435136 | 3300025949 | Bacteria | 1334 |
| 192 | Ga0207667_10993550 | 3300025949 | Bacteria | 827 |
| 193 | Ga0207668_10137570 | 3300025972 | Bacteria | 1874 |
| 194 | Ga0207668_10234194 | 3300025972 | Bacteria | 1482 |
| 195 | Ga0207677_10019638 | 3300026023 | Bacteria | 4087 |
| 196 | Ga0207703_10389261 | 3300026035 | Bacteria | 1291 |
| 197 | Ga0207639_10015161 | 3300026041 | Bacteria | 5430 |
| 198 | Ga0207678_10073479 | 3300026067 | Bacteria | 2930 |
| 199 | Ga0207678_10432212 | 3300026067 | Bacteria | 1143 |
| 200 | Ga0207708_10023977 | 3300026075 | Bacteria | 4614 |
| 201 | Ga0207702_10000056 | 3300026078 | Bacteria | 131186 |
| 202 | Ga0207641_10008809 | 3300026088 | Bacteria | 8334 |
| 203 | Ga0207648_10058517 | 3300026089 | Bacteria | 3361 |
| 204 | Ga0207674_10018427 | 3300026116 | Bacteria | 7587 |
| 205 | Ga0207674_10619321 | 3300026116 | Bacteria | 1045 |
| 206 | Ga0207698_10032169 | 3300026142 | Bacteria | 3797 |
| 207 | Ga0207698_10093936 | 3300026142 | Bacteria | 2464 |
| 208 | Ga0207698_10810232 | 3300026142 | Bacteria | 939 |
| 209 | Ga0209588_1017686 | 3300027671 | Bacteria | 2212 |
| 210 | Ga0209588_1021532 | 3300027671 | Bacteria | 2026 |
| 211 | Ga0268266_10341939 | 3300028379 | Bacteria | 1405 |
| 212 | Ga0268265_10195946 | 3300028380 | Bacteria | 1748 |
| 213 | Ga0268264_10000049 | 3300028381 | Bacteria | 329992 |
| 214 | Ga0265326_10002792 | 3300028558 | Bacteria | 5848 |
| 215 | Ga0265334_10003782 | 3300028573 | Bacteria | 6840 |
| 216 | Ga0265336_10000430 | 3300028666 | Bacteria | 25854 |
| 217 | Ga0307517_10002211 | 3300028786 | Bacteria | 31433 |
| 218 | Ga0307517_10301388 | 3300028786 | Bacteria | 898 |
| 219 | Ga0307517_10349299 | 3300028786 | Bacteria | 804 |
| 220 | Ga0307515_10338941 | 3300028794 | Bacteria | 1157 |
| 221 | Ga0265338_10000024 | 3300028800 | Bacteria | 297778 |
| 222 | Ga0265324_10031172 | 3300029957 | Bacteria | 1868 |
| 223 | Ga0307511_10100749 | 3300030521 | Bacteria | 1898 |
| 224 | Ga0265330_10008045 | 3300031235 | Bacteria | 5103 |
| 225 | Ga0265330_10013923 | 3300031235 | Bacteria | 3739 |
| 226 | Ga0265330_10033253 | 3300031235 | Bacteria | 2307 |
| 227 | Ga0265332_10011317 | 3300031238 | Bacteria | 3967 |
| 228 | Ga0265328_10146619 | 3300031239 | Bacteria | 887 |
| 229 | Ga0265325_10002005 | 3300031241 | Bacteria | 13988 |
| 230 | Ga0265340_10103774 | 3300031247 | Bacteria | 1319 |
| 231 | Ga0265339_10045819 | 3300031249 | Bacteria | 2406 |
| 232 | Ga0265331_10021452 | 3300031250 | Bacteria | 3306 |
| 233 | Ga0307513_10130648 | 3300031456 | Bacteria | 2458 |
| 234 | Ga0307513_10547723 | 3300031456 | Bacteria | 870 |
| 235 | Ga0307509_10040521 | 3300031507 | Bacteria | 5065 |
| 236 | Ga0307509_10103840 | 3300031507 | Bacteria | 2869 |
| 237 | Ga0307509_10241750 | 3300031507 | Bacteria | 1597 |
| 238 | Ga0307508_10000005 | 3300031616 | Bacteria | 286511 |
| 239 | Ga0307508_10059018 | 3300031616 | Bacteria | 3394 |
| 240 | Ga0265314_10000900 | 3300031711 | Bacteria | 35261 |
| 241 | Ga0265342_10050901 | 3300031712 | Bacteria | 2472 |
| 242 | Ga0265342_10070545 | 3300031712 | Bacteria | 2038 |
| 243 | Ga0265342_10330904 | 3300031712 | Bacteria | 796 |
| 244 | Ga0307516_10013014 | 3300031730 | Bacteria | 8910 |
| 245 | Ga0307516_10118051 | 3300031730 | Bacteria | 2447 |
| 246 | Ga0307516_10245238 | 3300031730 | Bacteria | 1488 |
| 247 | Ga0307416_100174939 | 3300032002 | Bacteria | 2004 |
| 248 | Ga0307415_100160604 | 3300032126 | Bacteria | 1741 |
| 249 | Ga0307507_10006568 | 3300033179 | Bacteria | 17727 |
| 250 | Ga0307510_10020522 | 3300033180 | Bacteria | 7720 |
| 251 | Ga0307510_10068511 | 3300033180 | Bacteria | 3560 |
| 252 | Ga0315911_1000018 | 3300033442 | Bacteria | 152089 |
| 253 | Ga0316215_1001164 | 3300033544 | Bacteria | 2550 |
| 254 | Ga0373934_0006395 | 3300035086 | Bacteria | 4370 |
| 255 | Ga0373940_0020359 | 3300035088 | Bacteria | 1685 |
| 256 | Ga0373944_0055378 | 3300035089 | Bacteria | 1259 |
| 257 | Ga0373952_0067162 | 3300035092 | Bacteria | 890 |
| 258 | Ga0373923_0001363 | 3300035111 | Bacteria | 6953 |
| 259 | Ga0373953_0008643 | 3300035117 | Bacteria | 3468 |
| 260 | Ga0373954_0005748 | 3300035118 | Bacteria | 5382 |
| 261 | Ga0373954_0033492 | 3300035118 | Bacteria | 2377 |
| 262 | Ga0373956_0003734 | 3300035119 | Bacteria | 6134 |
| 263 | Ga0373956_0248536 | 3300035119 | Bacteria | 845 |
| 264 | Ga0373957_0001574 | 3300035120 | Bacteria | 6227 |
| 265 | Ga0373957_0039158 | 3300035120 | Bacteria | 1777 |
| 266 | Ga0373960_0137412 | 3300035121 | Bacteria | 825 |
| 267 | Ga0373946_0002379 | 3300035171 | Bacteria | 6653 |
| 268 | Ga0373946_0054265 | 3300035171 | Bacteria | 1686 |
| 269 | Ga0373955_0003197 | 3300035172 | Bacteria | 7172 |
| 270 | Ga0373955_0033444 | 3300035172 | Bacteria | 2708 |
| 271 | Ga0373924_0002150 | 3300035410 | Bacteria | 6599 |
| 272 | Ga0373924_0294345 | 3300035410 | Bacteria | 720 |
| 273 | Ga0373931_0414396 | 3300035691 | Bacteria | 855 |
| 274 | Ga0373935_0000229 | 3300035692 | Bacteria | 27393 |
| 275 | Ga0373935_0046204 | 3300035692 | Bacteria | 2749 |
| 276 | Ga0373935_0112353 | 3300035692 | Bacteria | 1809 |
| 277 | Ga0373935_0427797 | 3300035692 | Bacteria | 954 |
| 278 | Ga0373927_0000071 | 3300035695 | Bacteria | 73794 |
| 279 | Ga0373927_0004081 | 3300035695 | Bacteria | 10306 |
| 280 | Ga0373927_0035793 | 3300035695 | Bacteria | 3229 |
| 281 | Ga0373927_0063549 | 3300035695 | Bacteria | 2387 |
| 282 | Ga0373927_0146282 | 3300035695 | Bacteria | 1547 |
| 283 | Ga0373927_0164629 | 3300035695 | Bacteria | 1453 |
| 284 | Ga0373927_0466129 | 3300035695 | Bacteria | 834 |
| 285 | Ga0373933_0000114 | 3300035724 | Bacteria | 52016 |
| 286 | Ga0373933_0001425 | 3300035724 | Bacteria | 14028 |
| 287 | Ga0373947_0000540 | 3300035725 | Bacteria | 22139 |
| 288 | Ga0373947_0001708 | 3300035725 | Bacteria | 13470 |
| 289 | Ga0373947_0011676 | 3300035725 | Bacteria | 5038 |
| 290 | Ga0373947_0069223 | 3300035725 | Bacteria | 2160 |
| 291 | Ga0373947_0143608 | 3300035725 | Bacteria | 1533 |
| 292 | Ga0373947_0295532 | 3300035725 | Bacteria | 1079 |
| 293 | Ga0373937_0025351 | 3300036401 | Bacteria | 5353 |
| 294 | Ga0373937_0083156 | 3300036401 | Bacteria | 2962 |
| 295 | Ga0373937_0313318 | 3300036401 | Bacteria | 1484 |
| 296 | Ga0372808_002837 | 3300036459 | Bacteria | 2053 |
| 297 | Ga0373925_0011299 | 3300037068 | Bacteria | 6478 |
| 298 | Ga0373925_0015901 | 3300037068 | Bacteria | 5445 |
| 299 | Ga0373925_0024578 | 3300037068 | Bacteria | 4399 |
| 300 | Ga0373925_0025137 | 3300037068 | Bacteria | 4349 |
| 301 | Ga0373925_0039338 | 3300037068 | Bacteria | 3499 |
| 302 | Ga0373925_0154604 | 3300037068 | Bacteria | 1803 |
| 303 | Ga0395899_0092631 | 3300037312 | Bacteria | 2188 |
| 304 | Ga0395900_0003234 | 3300037418 | Bacteria | 17637 |
| 305 | Ga0395900_0131044 | 3300037418 | Bacteria | 2570 |
| 306 | Ga0395900_0430249 | 3300037418 | Bacteria | 1279 |
| 307 | Ga0395898_0003112 | 3300037466 | Bacteria | 18739 |
| 308 | Ga0395905_0059181 | 3300037471 | Bacteria | 3582 |
| 309 | Ga0395905_0319599 | 3300037471 | Bacteria | 1442 |
| 310 | Ga0395901_0052714 | 3300038443 | Bacteria | 4228 |
| 311 | Ga0395901_0234804 | 3300038443 | Bacteria | 1914 |
| 312 | Ga0436365_0650112 | 3300039437 | Bacteria | 58550 |
| 313 | Ga0436365_1026947 | 3300039437 | Bacteria | 1223 |
| 314 | Ga0436360_1193161 | 3300039438 | Bacteria | 2031 |
| 315 | Ga0436362_0790756 | 3300039453 | Bacteria | 2420 |
| 316 | Ga0451795_0646620 | 3300041456 | Bacteria | 775 |
| 317 | Ga0451807_0166552 | 3300041486 | Bacteria | 1078 |
| 318 | Ga0466963_0127118 | 3300044694 | Bacteria | 1758 |
| 319 | Ga0466957_0026692 | 3300044842 | Bacteria | 3427 |
| 320 | Ga0466959_0095788 | 3300045049 | Bacteria | 2128 |
| 321 | Ga0466967_1136960 | 3300045976 | Bacteria | 778 |
| 322 | Ga0495617_004269 | 3300046452 | Bacteria | 5219 |
| 323 | Ga0495592_0011328 | 3300046454 | Bacteria | 6745 |
| 324 | Ga0495592_0035153 | 3300046454 | Bacteria | 3775 |
| 325 | Ga0495603_0000035 | 3300046455 | Bacteria | 57510 |
| 326 | Ga0495603_0012240 | 3300046455 | Bacteria | 5196 |
| 327 | Ga0495603_0214493 | 3300046455 | Bacteria | 1111 |
| 328 | Ga0495629_0000081 | 3300046459 | Bacteria | 85305 |
| 329 | Ga0495629_0002236 | 3300046459 | Bacteria | 14921 |
| 330 | Ga0495629_0043007 | 3300046459 | Bacteria | 3173 |
| 331 | Ga0495629_0419301 | 3300046459 | Bacteria | 908 |
| 332 | Ga0495629_0509716 | 3300046459 | Bacteria | 811 |
| 333 | Ga0495641_0003571 | 3300046461 | Bacteria | 11545 |
| 334 | Ga0495641_0119489 | 3300046461 | Bacteria | 1176 |
| 335 | Ga0495651_0033024 | 3300046462 | Bacteria | 4037 |
| 336 | Ga0495651_0107370 | 3300046462 | Bacteria | 2068 |
| 337 | Ga0495653_0021802 | 3300046463 | Bacteria | 5185 |
| 338 | Ga0495580_0007845 | 3300046472 | Bacteria | 8545 |
| 339 | Ga0495582_0000235 | 3300046473 | Bacteria | 30725 |
| 340 | Ga0495582_0186347 | 3300046473 | Bacteria | 1183 |
| 341 | Ga0495582_0299611 | 3300046473 | Bacteria | 924 |
| 342 | Ga0495639_0000010 | 3300046475 | Bacteria | 93685 |
| 343 | Ga0495639_0008724 | 3300046475 | Bacteria | 4348 |
| 344 | Ga0495662_0003600 | 3300046476 | Bacteria | 7816 |
| 345 | Ga0495662_0110847 | 3300046476 | Bacteria | 1345 |
| 346 | Ga0495664_0003381 | 3300046477 | Bacteria | 8667 |
| 347 | Ga0495664_0127817 | 3300046477 | Bacteria | 1538 |
| 348 | Ga0495664_0195603 | 3300046477 | Bacteria | 1226 |
| 349 | Ga0495594_0045839 | 3300046499 | Bacteria | 2401 |
| 350 | Ga0495606_0231448 | 3300046507 | Bacteria | 1035 |
| 351 | Ga0495608_0037291 | 3300046511 | Bacteria | 3268 |
| 352 | Ga0495608_0095113 | 3300046511 | Bacteria | 1925 |
| 353 | Ga0495610_0044581 | 3300046512 | Bacteria | 2201 |
| 354 | Ga0495618_0029014 | 3300046514 | Bacteria | 3450 |
| 355 | Ga0495618_0072387 | 3300046514 | Bacteria | 2193 |
| 356 | Ga0495618_0193470 | 3300046514 | Bacteria | 1289 |
| 357 | Ga0495628_0018214 | 3300046516 | Bacteria | 5822 |
| 358 | Ga0495628_0050808 | 3300046516 | Bacteria | 3279 |
| 359 | Ga0495630_0003778 | 3300046517 | Bacteria | 10573 |
| 360 | Ga0495630_0021706 | 3300046517 | Bacteria | 4741 |
| 361 | Ga0495630_0142515 | 3300046517 | Bacteria | 1823 |
| 362 | Ga0495632_0160759 | 3300046519 | Bacteria | 1035 |
| 363 | Ga0495644_0016803 | 3300046523 | Bacteria | 2800 |
| 364 | Ga0495648_0005171 | 3300046524 | Bacteria | 10917 |
| 365 | Ga0495648_0118560 | 3300046524 | Bacteria | 1427 |
| 366 | Ga0495666_0041695 | 3300046526 | Bacteria | 2222 |
| 367 | Ga0495666_0046722 | 3300046526 | Bacteria | 2086 |
| 368 | Ga0495652_0023860 | 3300046529 | Bacteria | 5418 |
| 369 | Ga0495652_0027318 | 3300046529 | Bacteria | 5029 |
| 370 | Ga0495652_0413290 | 3300046529 | Bacteria | 952 |
| 371 | Ga0495665_0000005 | 3300046531 | Bacteria | 86491 |
| 372 | Ga0495640_0004314 | 3300046533 | Bacteria | 11359 |
| 373 | Ga0495640_0006942 | 3300046533 | Bacteria | 8915 |
| 374 | Ga0495640_0010386 | 3300046533 | Bacteria | 7202 |
| 375 | Ga0495640_0415723 | 3300046533 | Bacteria | 824 |
| 376 | Ga0495586_0028532 | 3300046535 | Bacteria | 2986 |
| 377 | Ga0495587_0032742 | 3300046536 | Bacteria | 3140 |
| 378 | Ga0495587_0107421 | 3300046536 | Bacteria | 1605 |
| 379 | Ga0495587_0200318 | 3300046536 | Bacteria | 1129 |
| 380 | Ga0495609_0014031 | 3300046538 | Bacteria | 3773 |
| 381 | Ga0495645_0005858 | 3300046543 | Bacteria | 8485 |
| 382 | Ga0495645_0033977 | 3300046543 | Bacteria | 3721 |
| 383 | Ga0495645_0210646 | 3300046543 | Bacteria | 1312 |
| 384 | Ga0495645_0273510 | 3300046543 | Bacteria | 1114 |
| 385 | Ga0495622_0004449 | 3300046557 | Bacteria | 6508 |
| 386 | Ga0495622_0008890 | 3300046557 | Bacteria | 4654 |
| 387 | Ga0495622_0155192 | 3300046557 | Bacteria | 1034 |
| 388 | Ga0495622_0211096 | 3300046557 | Bacteria | 862 |
| 389 | Ga0495667_0020935 | 3300046559 | Bacteria | 4412 |
| 390 | Ga0495667_0030300 | 3300046559 | Bacteria | 3636 |
| 391 | Ga0495667_0042926 | 3300046559 | Bacteria | 2998 |
| 392 | Ga0495667_0277557 | 3300046559 | Bacteria | 1064 |
| 393 | Ga0495656_0023525 | 3300046615 | Bacteria | 2425 |
| 394 | Ga0495656_0060560 | 3300046615 | Bacteria | 1650 |
| 395 | Ga0495668_0012203 | 3300046616 | Bacteria | 5106 |
| 396 | Ga0495668_0034272 | 3300046616 | Bacteria | 2849 |
| 397 | Ga0495634_0000261 | 3300046642 | Bacteria | 49735 |
| 398 | Ga0495634_0021377 | 3300046642 | Bacteria | 4575 |
| 399 | Ga0495634_0037057 | 3300046642 | Bacteria | 3333 |
| 400 | Ga0495634_0174845 | 3300046642 | Bacteria | 1348 |
| 401 | Ga0495611_0210613 | 3300046648 | Bacteria | 905 |
| 402 | Ga0495625_0091563 | 3300046660 | Bacteria | 2102 |
| 403 | Ga0495625_0273812 | 3300046660 | Bacteria | 1088 |
| 404 | Ga0495625_0352933 | 3300046660 | Bacteria | 929 |
| 405 | Ga0495635_0006062 | 3300046663 | Bacteria | 8435 |
| 406 | Ga0495635_0018394 | 3300046663 | Bacteria | 4876 |
| 407 | Ga0495588_0010000 | 3300046674 | Bacteria | 4398 |
| 408 | Ga0495657_0011243 | 3300046675 | Bacteria | 6705 |
| 409 | Ga0495599_0007860 | 3300046678 | Bacteria | 6471 |
| 410 | Ga0495599_0088539 | 3300046678 | Bacteria | 1933 |
| 411 | Ga0495599_0349752 | 3300046678 | Bacteria | 886 |
| 412 | Ga0495623_0067061 | 3300046679 | Bacteria | 2240 |
| 413 | Ga0495623_0069387 | 3300046679 | Bacteria | 2197 |
| 414 | Ga0495623_0415395 | 3300046679 | Bacteria | 722 |
| 415 | Ga0495646_0031838 | 3300046680 | Bacteria | 3285 |
| 416 | Ga0495646_0059190 | 3300046680 | Bacteria | 2289 |
| 417 | Ga0495646_0313745 | 3300046680 | Bacteria | 827 |
| 418 | Ga0495647_0000500 | 3300046681 | Bacteria | 11389 |
| 419 | Ga0495658_0000771 | 3300046683 | Bacteria | 17323 |
| 420 | Ga0495658_0006453 | 3300046683 | Bacteria | 5763 |
| 421 | Ga0495658_0314274 | 3300046683 | Bacteria | 992 |
| 422 | Ga0495669_0010508 | 3300046684 | Bacteria | 3912 |
| 423 | Ga0495613_0006929 | 3300046689 | Bacteria | 8453 |
| 424 | Ga0495613_0015463 | 3300046689 | Bacteria | 5674 |
| 425 | Ga0495613_0032505 | 3300046689 | Bacteria | 3877 |
| 426 | Ga0495624_0001342 | 3300046690 | Bacteria | 19226 |
| 427 | Ga0495624_0215228 | 3300046690 | Bacteria | 1165 |
| 428 | Ga0495624_0276473 | 3300046690 | Bacteria | 1014 |
| 429 | Ga0495589_0268182 | 3300046794 | Bacteria | 795 |
| 430 | Ga0495600_0032744 | 3300046809 | Bacteria | 3373 |
| 431 | Ga0495600_0059504 | 3300046809 | Bacteria | 2495 |
| 432 | Ga0495600_0148292 | 3300046809 | Bacteria | 1520 |
| 433 | Ga0495660_0220297 | 3300046810 | Bacteria | 895 |
| 434 | Ga0495581_0000018 | 3300047315 | Bacteria | 58791 |
| 435 | Ga0495581_0016589 | 3300047315 | Bacteria | 4280 |
| 436 | Ga0495604_0045914 | 3300047317 | Bacteria | 3407 |
| 437 | Ga0495604_0073781 | 3300047317 | Bacteria | 2574 |
| 438 | Ga0495604_0211974 | 3300047317 | Bacteria | 1338 |
| 439 | Ga0495674_0000134 | 3300047319 | Bacteria | 56618 |
| 440 | Ga0495674_0252255 | 3300047319 | Bacteria | 1452 |
| 441 | Ga0495672_0008522 | 3300047320 | Bacteria | 7550 |
| 442 | Ga0495676_0034073 | 3300047321 | Bacteria | 4276 |
| 443 | Ga0495676_0347515 | 3300047321 | Bacteria | 992 |
| 444 | Ga0495680_0031781 | 3300047322 | Bacteria | 4292 |
| 445 | Ga0495675_0016169 | 3300047444 | Bacteria | 4718 |
| 446 | Ga0495685_042713 | 3300047447 | Bacteria | 1547 |
| 447 | Ga0495684_0013146 | 3300047471 | Bacteria | 6387 |
| 448 | Ga0495684_0035829 | 3300047471 | Bacteria | 3805 |
| 449 | Ga0495686_0237691 | 3300047472 | Bacteria | 1029 |
| 450 | Ga0495593_0000072 | 3300047673 | Bacteria | 43039 |
| 451 | Ga0495593_0000594 | 3300047673 | Bacteria | 20595 |
| 452 | Ga0495593_0032448 | 3300047673 | Bacteria | 2847 |
| 453 | Ga0495593_0103318 | 3300047673 | Bacteria | 1460 |
| 454 | Ga0495593_0251518 | 3300047673 | Bacteria | 885 |
| 455 | Ga0496101_0187462 | 3300048904 | Bacteria | 1595 |
| 456 | Ga0496102_0407294 | 3300048905 | Bacteria | 1278 |
| 457 | Ga0496102_0860033 | 3300048905 | Bacteria | 829 |
| 458 | Ga0496103_0029706 | 3300048906 | Bacteria | 3323 |
| 459 | Ga0496106_0007422 | 3300048909 | Bacteria | 8101 |
| 460 | Ga0496106_0101809 | 3300048909 | Bacteria | 2228 |
| 461 | Ga0496106_0252906 | 3300048909 | Bacteria | 1409 |
| 462 | Ga0496106_0488955 | 3300048909 | Bacteria | 989 |
| 463 | Ga0496107_0029943 | 3300048910 | Bacteria | 3877 |
| 464 | Ga0496107_0274032 | 3300048910 | Bacteria | 1256 |
| 465 | Ga0496108_0438969 | 3300048911 | Bacteria | 1140 |
| 466 | Ga0496110_0477090 | 3300048913 | Bacteria | 1136 |
| 467 | Ga0496112_0075692 | 3300048915 | Bacteria | 3329 |
| 468 | Ga0496114_0106185 | 3300048917 | Bacteria | 2403 |
| 469 | Ga0496114_0291857 | 3300048917 | Bacteria | 1439 |
| 470 | Ga0496114_0403821 | 3300048917 | Bacteria | 1210 |
| 471 | Ga0496115_0017903 | 3300048918 | Bacteria | 5428 |
| 472 | Ga0496115_0045996 | 3300048918 | Bacteria | 3486 |
| 473 | Ga0496115_0248022 | 3300048918 | Bacteria | 1467 |
| 474 | Ga0496115_0436732 | 3300048918 | Bacteria | 1059 |
| 475 | Ga0496116_0305297 | 3300048919 | Bacteria | 755 |
| 476 | Ga0496117_0037310 | 3300048920 | Bacteria | 3622 |
| 477 | Ga0496117_0037409 | 3300048920 | Bacteria | 3615 |
| 478 | Ga0496118_0003042 | 3300048921 | Bacteria | 21608 |
| 479 | Ga0496118_0035533 | 3300048921 | Bacteria | 4044 |
| 480 | Ga0496120_0091510 | 3300048923 | Bacteria | 1624 |
| 481 | Ga0496121_0000091 | 3300048924 | Bacteria | 216685 |
| 482 | Ga0496121_0000716 | 3300048924 | Bacteria | 61451 |
| 483 | Ga0496121_0005545 | 3300048924 | Bacteria | 16120 |
| 484 | Ga0496121_0019090 | 3300048924 | Bacteria | 6876 |
| 485 | Ga0496121_0040476 | 3300048924 | Bacteria | 4087 |
| 486 | Ga0496121_0041274 | 3300048924 | Bacteria | 4035 |
| 487 | Ga0496121_0353043 | 3300048924 | Bacteria | 979 |
| 488 | Ga0496121_0553768 | 3300048924 | Bacteria | 719 |
| 489 | Ga0496124_0012598 | 3300048927 | Bacteria | 8323 |
| 490 | Ga0496124_0257753 | 3300048927 | Bacteria | 1286 |
| 491 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 492 | Ga0496125_0000746 | 3300048928 | Bacteria | 53671 |
| 493 | Ga0496125_0013770 | 3300048928 | Bacteria | 7926 |
| 494 | Ga0496126_0004591 | 3300048929 | Bacteria | 16376 |
| 495 | Ga0496126_0005693 | 3300048929 | Bacteria | 14121 |
| 496 | Ga0496126_0021180 | 3300048929 | Bacteria | 6357 |
| 497 | Ga0496126_0061520 | 3300048929 | Bacteria | 3372 |
| 498 | Ga0496126_0129801 | 3300048929 | Bacteria | 2179 |
| 499 | Ga0496126_0174464 | 3300048929 | Bacteria | 1829 |
| 500 | Ga0495682_0134228 | 3300049460 | Bacteria | 885 |
| 501 | Ga0501031_0096761 | 3300049568 | Bacteria | 1926 |
| 502 | Ga0501032_0031733 | 3300049569 | Bacteria | 3621 |
| 503 | Ga0501032_0215846 | 3300049569 | Bacteria | 1249 |
| 504 | Ga0501033_0068962 | 3300049570 | Bacteria | 2599 |
| 505 | Ga0501034_0454308 | 3300049571 | Bacteria | 1198 |
| 506 | Ga0501036_0070794 | 3300049572 | Bacteria | 2949 |
| 507 | Ga0501036_0310787 | 3300049572 | Bacteria | 1318 |
| 508 | Ga0501037_0014354 | 3300049573 | Bacteria | 5833 |
| 509 | Ga0501037_0192717 | 3300049573 | Bacteria | 1442 |
| 510 | Ga0501038_0000621 | 3300049574 | Bacteria | 31613 |
| 511 | Ga0501038_0086836 | 3300049574 | Bacteria | 2627 |
| 512 | Ga0501038_0199039 | 3300049574 | Bacteria | 1608 |
| 513 | Ga0501039_0096527 | 3300049575 | Bacteria | 2304 |
| 514 | Ga0501040_0043042 | 3300049576 | Bacteria | 3077 |
| 515 | Ga0501042_0098853 | 3300049578 | Bacteria | 2098 |
| 516 | Ga0501043_0090823 | 3300049579 | Bacteria | 2401 |
| 517 | Ga0501043_0269462 | 3300049579 | Bacteria | 1307 |
| 518 | Ga0501046_0025427 | 3300049580 | Bacteria | 4845 |
| 519 | Ga0501047_0112228 | 3300049581 | Bacteria | 2608 |
| 520 | Ga0501047_0305411 | 3300049581 | Bacteria | 1433 |
| 521 | Ga0501048_0036430 | 3300049582 | Bacteria | 3536 |
| 522 | Ga0501067_0087347 | 3300049583 | Bacteria | 1730 |
| 523 | Ga0501068_0168483 | 3300049584 | Bacteria | 1381 |
| 524 | Ga0501070_0247118 | 3300049586 | Bacteria | 1460 |
| 525 | Ga0501071_0631393 | 3300049587 | Bacteria | 824 |
| 526 | Ga0501072_0177268 | 3300049588 | Bacteria | 1700 |
| 527 | Ga0501073_0098838 | 3300049589 | Bacteria | 2026 |
| 528 | Ga0501074_0017150 | 3300049590 | Bacteria | 5253 |
| 529 | Ga0501077_0093609 | 3300049593 | Bacteria | 1905 |
| 530 | Ga0501079_0018245 | 3300049741 | Bacteria | 5360 |
| 531 | Ga0501080_0524744 | 3300049742 | Bacteria | 1056 |
| 532 | Ga0501083_0024395 | 3300049744 | Bacteria | 4189 |
| 533 | Ga0501035_0125732 | 3300049822 | Bacteria | 2238 |
| 534 | Ga0501044_0008922 | 3300049823 | Bacteria | 10959 |
| 535 | Ga0501044_0494047 | 3300049823 | Bacteria | 1125 |
| 536 | Ga0501045_0139799 | 3300049824 | Bacteria | 1800 |
| 537 | nmdc:mga03n38_12566_c1 | 3300050490 | Bacteria | 3190 |
| 538 | nmdc:mga06z11_303276_c1 | 3300050494 | Bacteria | 950 |
| 539 | nmdc:mga06z11_320653_c1 | 3300050494 | Bacteria | 924 |
| 540 | nmdc:mga04h51_48535_c1 | 3300050495 | Bacteria | 1415 |
| 541 | nmdc:mga0n895_128691_c1 | 3300050512 | Bacteria | 2556 |
| 542 | nmdc:mga0n895_134642_c1 | 3300050512 | Bacteria | 2497 |
| 543 | nmdc:mga0rr50_370536_c1 | 3300050513 | Bacteria | 1206 |
| 544 | nmdc:mga08x19_85407_c1 | 3300050514 | Bacteria | 2077 |
| 545 | Ga0495601_0034250 | 3300053077 | Bacteria | 3167 |
| 546 | Ga0495612_0011133 | 3300053078 | Bacteria | 3631 |
| 547 | Ga0495612_0109356 | 3300053078 | Bacteria | 1182 |
| 548 | Ga0500610_0100392 | 3300053079 | Bacteria | 1498 |
| 549 | Ga0500635_0001063 | 3300053080 | Bacteria | 6566 |
| 550 | Ga0500635_0001671 | 3300053080 | Bacteria | 5362 |
| 551 | Ga0500635_0012384 | 3300053080 | Bacteria | 2448 |
| 552 | Ga0495595_0000449 | 3300053084 | Bacteria | 15558 |
| 553 | Ga0495619_0020998 | 3300053085 | Bacteria | 4165 |
| 554 | Ga0500643_095976 | 3300053087 | Bacteria | 806 |
| 555 | Ga0500651_0028614 | 3300053093 | Bacteria | 3504 |
| 556 | Ga0500566_0000065 | 3300053094 | Bacteria | 50325 |
| 557 | Ga0500566_0073701 | 3300053094 | Bacteria | 1913 |
| 558 | Ga0500554_000253 | 3300053102 | Bacteria | 11538 |
| 559 | Ga0500562_039128 | 3300053108 | Bacteria | 1260 |
| 560 | Ga0500572_004849 | 3300053111 | Bacteria | 3047 |
| 561 | Ga0500595_000253 | 3300053119 | Bacteria | 35306 |
| 562 | Ga0500595_002443 | 3300053119 | Bacteria | 9214 |
| 563 | Ga0500595_007200 | 3300053119 | Bacteria | 4635 |
| 564 | Ga0500595_019169 | 3300053119 | Bacteria | 2487 |
| 565 | Ga0500595_091501 | 3300053119 | Bacteria | 880 |
| 566 | Ga0500608_018508 | 3300053122 | Bacteria | 3179 |
| 567 | Ga0500658_0139657 | 3300053134 | Bacteria | 1086 |
| 568 | Ga0500559_0068320 | 3300053136 | Bacteria | 1596 |
| 569 | Ga0500561_0023415 | 3300053137 | Bacteria | 1480 |
| 570 | Ga0500573_0090793 | 3300053140 | Bacteria | 1725 |
| 571 | Ga0500577_0000112 | 3300053142 | Bacteria | 19856 |
| 572 | Ga0500590_045923 | 3300053148 | Bacteria | 2235 |
| 573 | Ga0500590_088033 | 3300053148 | Bacteria | 1513 |
| 574 | Ga0500603_000158 | 3300053150 | Bacteria | 16730 |
| 575 | Ga0500603_008705 | 3300053150 | Bacteria | 2258 |
| 576 | Ga0500630_124419 | 3300053159 | Bacteria | 1136 |
| 577 | Ga0500638_017919 | 3300053162 | Bacteria | 3296 |
| 578 | Ga0500638_110194 | 3300053162 | Bacteria | 1272 |
| 579 | Ga0500636_0041245 | 3300053177 | Bacteria | 2730 |
| 580 | Ga0500636_0088678 | 3300053177 | Bacteria | 1774 |
| 581 | Ga0500636_0346668 | 3300053177 | Bacteria | 710 |
| 582 | Ga0500637_0000157 | 3300053178 | Bacteria | 24963 |
| 583 | Ga0500637_0040903 | 3300053178 | Bacteria | 2619 |
| 584 | Ga0500570_105258 | 3300053724 | Bacteria | 1168 |
| 585 | Ga0500596_001862 | 3300053735 | Bacteria | 4240 |
| 586 | Ga0500596_001994 | 3300053735 | Bacteria | 4086 |
| 587 | Ga0500661_000942 | 3300055283 | Bacteria | 5444 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006844 | Ga0075428_100356015 | Ga0075428_1003560151 | 194 |
| 2 | 3300009094 | Ga0111539_10121973 | Ga0111539_101219732 | 194 |
| 3 | 3300035691 | Ga0373931_0414396 | Ga0373931_0414396_75_827 | 194 |
| 4 | 3300006051 | Ga0075364_10225961 | Ga0075364_102259612 | 199 |
| 5 | 3300011119 | Ga0105246_10407952 | Ga0105246_104079522 | 203 |
| 6 | 3300010159 | Ga0099796_10044981 | Ga0099796_100449812 | 204 |
| 7 | iso_pu_bacteria | 2513237096 | 2513658214 | 205 |
| 8 | iso_pu_bacteria | 2513237098 | 2513677508 | 205 |
| 9 | iso_pu_bacteria | 2513237137 | 2513862956 | 205 |
| 10 | iso_pu_bacteria | 2513237145 | 2513920294 | 205 |
| 11 | iso_pu_bacteria | 2517572143 | 2517889286 | 205 |
| 12 | iso_pu_bacteria | 2524023210 | 2524470334 | 205 |
| 13 | iso_pu_bacteria | 2791355197 | 2793070943 | 205 |
| 14 | iso_pu_bacteria | 2885374607 | 2885377931 | 205 |
| 15 | iso_pu_bacteria | 2885383462 | 2885392420 | 205 |
| 16 | iso_pu_bacteria | 2903748898 | 2903750243 | 205 |
| 17 | iso_pu_bacteria | 2903768456 | 2903773116 | 205 |
| 18 | iso_pu_bacteria | 2904690495 | 2904692521 | 205 |
| 19 | iso_pu_bacteria | 2906610324 | 2906613240 | 205 |
| 20 | iso_pu_bacteria | 2906635258 | 2906635470 | 205 |
| 21 | iso_pu_bacteria | 2906660503 | 2906668601 | 205 |
| 22 | iso_pu_bacteria | 2908756301 | 2908756789 | 205 |
| 23 | iso_pu_bacteria | 2922425934 | 2922433736 | 205 |
| 24 | iso_pu_bacteria | 2935630451 | 2935634779 | 205 |
| 25 | iso_pu_bacteria | 2941507105 | 2941511891 | 205 |
| 26 | iso_pu_bacteria | 2941515067 | 2941519593 | 205 |
| 27 | iso_pu_bacteria | 2941523033 | 2941527715 | 205 |
| 28 | iso_pu_bacteria | 8006933436 | 8006935774 | 205 |
| 29 | iso_pu_bacteria | 8006973647 | 8006975693 | 205 |
| 30 | iso_pu_bacteria | 8019555841 | 8019563020 | 205 |
| 31 | iso_pu_bacteria | 8019565922 | 8019573098 | 205 |
| 32 | 3300014969 | Ga0157376_10431800 | Ga0157376_104318002 | 206 |
| 33 | 3300046660 | Ga0495625_0273812 | Ga0495625_0273812_431_1075 | 206 |
| 34 | 3300049574 | Ga0501038_0199039 | Ga0501038_0199039_386_1039 | 208 |
| 35 | 3300049579 | Ga0501043_0090823 | Ga0501043_0090823_1343_1996 | 208 |
| 36 | 3300049579 | Ga0501043_0269462 | Ga0501043_0269462_419_1072 | 208 |
| 37 | 3300049581 | Ga0501047_0112228 | Ga0501047_0112228_546_1199 | 208 |
| 38 | 3300049822 | Ga0501035_0125732 | Ga0501035_0125732_1351_2004 | 208 |
| 39 | 3300003203 | JGI25406J46586_10001070 | JGI25406J46586_100010708 | 209 |
| 40 | 3300003659 | JGI25404J52841_10005846 | JGI25404J52841_100058462 | 209 |
| 41 | 3300005329 | Ga0070683_100039979 | Ga0070683_1000399792 | 209 |
| 42 | 3300005336 | Ga0070680_100267135 | Ga0070680_1002671352 | 209 |
| 43 | 3300005336 | Ga0070680_100698008 | Ga0070680_1006980081 | 209 |
| 44 | 3300005434 | Ga0070709_10000732 | Ga0070709_1000073217 | 209 |
| 45 | 3300005434 | Ga0070709_10068699 | Ga0070709_100686991 | 209 |
| 46 | 3300005434 | Ga0070709_10123135 | Ga0070709_101231352 | 209 |
| 47 | 3300005434 | Ga0070709_10489253 | Ga0070709_104892532 | 209 |
| 48 | 3300005435 | Ga0070714_100010788 | Ga0070714_1000107883 | 209 |
| 49 | 3300005435 | Ga0070714_100130000 | Ga0070714_1001300002 | 209 |
| 50 | 3300005436 | Ga0070713_100004657 | Ga0070713_1000046575 | 209 |
| 51 | 3300005436 | Ga0070713_100053012 | Ga0070713_1000530123 | 209 |
| 52 | 3300005436 | Ga0070713_100089395 | Ga0070713_1000893952 | 209 |
| 53 | 3300005436 | Ga0070713_100128305 | Ga0070713_1001283052 | 209 |
| 54 | 3300005437 | Ga0070710_10004377 | Ga0070710_100043774 | 209 |
| 55 | 3300005437 | Ga0070710_10014128 | Ga0070710_100141282 | 209 |
| 56 | 3300005439 | Ga0070711_100001113 | Ga0070711_1000011132 | 209 |
| 57 | 3300005458 | Ga0070681_10087866 | Ga0070681_100878663 | 209 |
| 58 | 3300005458 | Ga0070681_10168780 | Ga0070681_101687802 | 209 |
| 59 | 3300005530 | Ga0070679_100396250 | Ga0070679_1003962502 | 209 |
| 60 | 3300005535 | Ga0070684_100021034 | Ga0070684_1000210342 | 209 |
| 61 | 3300005577 | Ga0068857_100059405 | Ga0068857_1000594052 | 209 |
| 62 | 3300005577 | Ga0068857_100420465 | Ga0068857_1004204652 | 209 |
| 63 | 3300005578 | Ga0068854_100511060 | Ga0068854_1005110601 | 209 |
| 64 | 3300005616 | Ga0068852_100786722 | Ga0068852_1007867222 | 209 |
| 65 | 3300005617 | Ga0068859_100132852 | Ga0068859_1001328522 | 209 |
| 66 | 3300005843 | Ga0068860_100000257 | Ga0068860_10000025755 | 209 |
| 67 | 3300005937 | Ga0081455_10010356 | Ga0081455_100103567 | 209 |
| 68 | 3300005937 | Ga0081455_10088422 | Ga0081455_100884223 | 209 |
| 69 | 3300005983 | Ga0081540_1006050 | Ga0081540_10060504 | 209 |
| 70 | 3300005983 | Ga0081540_1040529 | Ga0081540_10405292 | 209 |
| 71 | 3300005985 | Ga0081539_10000530 | Ga0081539_1000053032 | 209 |
| 72 | 3300006028 | Ga0070717_10168325 | Ga0070717_101683252 | 209 |
| 73 | 3300006163 | Ga0070715_10157171 | Ga0070715_101571712 | 209 |
| 74 | 3300006173 | Ga0070716_100009694 | Ga0070716_1000096943 | 209 |
| 75 | 3300006173 | Ga0070716_100537794 | Ga0070716_1005377941 | 209 |
| 76 | 3300006175 | Ga0070712_100014993 | Ga0070712_1000149932 | 209 |
| 77 | 3300006871 | Ga0075434_100072646 | Ga0075434_1000726463 | 209 |
| 78 | 3300006914 | Ga0075436_100098286 | Ga0075436_1000982861 | 209 |
| 79 | 3300006931 | Ga0097620_100132852 | Ga0097620_1001328522 | 209 |
| 80 | 3300007076 | Ga0075435_100327410 | Ga0075435_1003274102 | 209 |
| 81 | 3300009093 | Ga0105240_10013377 | Ga0105240_100133777 | 209 |
| 82 | 3300009148 | Ga0105243_10836287 | Ga0105243_108362871 | 209 |
| 83 | 3300009545 | Ga0105237_10005001 | Ga0105237_100050012 | 209 |
| 84 | 3300009551 | Ga0105238_10472193 | Ga0105238_104721932 | 209 |
| 85 | 3300013105 | Ga0157369_10031113 | Ga0157369_100311133 | 209 |
| 86 | 3300013105 | Ga0157369_10346000 | Ga0157369_103460002 | 209 |
| 87 | 3300013297 | Ga0157378_10134227 | Ga0157378_101342272 | 209 |
| 88 | 3300014325 | Ga0163163_10347324 | Ga0163163_103473241 | 209 |
| 89 | 3300014325 | Ga0163163_10822047 | Ga0163163_108220472 | 209 |
| 90 | 3300017792 | Ga0163161_10147496 | Ga0163161_101474961 | 209 |
| 91 | 3300021384 | Ga0213876_10296837 | Ga0213876_102968371 | 209 |
| 92 | 3300025254 | Ga0209148_1009224 | Ga0209148_10092242 | 209 |
| 93 | 3300025261 | Ga0209233_1002050 | Ga0209233_10020503 | 209 |
| 94 | 3300025261 | Ga0209233_1004852 | Ga0209233_10048522 | 209 |
| 95 | 3300025272 | Ga0209455_1005109 | Ga0209455_10051092 | 209 |
| 96 | 3300025272 | Ga0209455_1012118 | Ga0209455_10121182 | 209 |
| 97 | 3300025898 | Ga0207692_10000494 | Ga0207692_1000049413 | 209 |
| 98 | 3300025898 | Ga0207692_10042495 | Ga0207692_100424953 | 209 |
| 99 | 3300025900 | Ga0207710_10006473 | Ga0207710_100064735 | 209 |
| 100 | 3300025905 | Ga0207685_10069101 | Ga0207685_100691012 | 209 |
| 101 | 3300025906 | Ga0207699_10004161 | Ga0207699_100041612 | 209 |
| 102 | 3300025906 | Ga0207699_10015928 | Ga0207699_100159281 | 209 |
| 103 | 3300025912 | Ga0207707_10058212 | Ga0207707_100582123 | 209 |
| 104 | 3300025913 | Ga0207695_10028143 | Ga0207695_100281434 | 209 |
| 105 | 3300025914 | Ga0207671_10145683 | Ga0207671_101456832 | 209 |
| 106 | 3300025915 | Ga0207693_10054260 | Ga0207693_100542602 | 209 |
| 107 | 3300025916 | Ga0207663_10000356 | Ga0207663_100003562 | 209 |
| 108 | 3300025916 | Ga0207663_10056552 | Ga0207663_100565523 | 209 |
| 109 | 3300025917 | Ga0207660_10166299 | Ga0207660_101662992 | 209 |
| 110 | 3300025917 | Ga0207660_10236008 | Ga0207660_102360082 | 209 |
| 111 | 3300025920 | Ga0207649_10417556 | Ga0207649_104175562 | 209 |
| 112 | 3300025921 | Ga0207652_10997065 | Ga0207652_109970651 | 209 |
| 113 | 3300025928 | Ga0207700_10037768 | Ga0207700_100377682 | 209 |
| 114 | 3300025928 | Ga0207700_10429936 | Ga0207700_104299361 | 209 |
| 115 | 3300025929 | Ga0207664_10001702 | Ga0207664_100017028 | 209 |
| 116 | 3300025939 | Ga0207665_10560749 | Ga0207665_105607491 | 209 |
| 117 | 3300025940 | Ga0207691_10766584 | Ga0207691_107665841 | 209 |
| 118 | 3300025944 | Ga0207661_10043590 | Ga0207661_100435902 | 209 |
| 119 | 3300025949 | Ga0207667_10088803 | Ga0207667_100888032 | 209 |
| 120 | 3300026035 | Ga0207703_10389261 | Ga0207703_103892612 | 209 |
| 121 | 3300026088 | Ga0207641_10008809 | Ga0207641_100088096 | 209 |
| 122 | 3300026116 | Ga0207674_10619321 | Ga0207674_106193211 | 209 |
| 123 | 3300028381 | Ga0268264_10000049 | Ga0268264_10000049245 | 209 |
| 124 | 3300028558 | Ga0265326_10002792 | Ga0265326_100027924 | 209 |
| 125 | 3300028573 | Ga0265334_10003782 | Ga0265334_100037824 | 209 |
| 126 | 3300028666 | Ga0265336_10000430 | Ga0265336_100004305 | 209 |
| 127 | 3300028794 | Ga0307515_10338941 | Ga0307515_103389412 | 209 |
| 128 | 3300028800 | Ga0265338_10000024 | Ga0265338_1000002488 | 209 |
| 129 | 3300029957 | Ga0265324_10031172 | Ga0265324_100311722 | 209 |
| 130 | 3300030521 | Ga0307511_10100749 | Ga0307511_101007492 | 209 |
| 131 | 3300031235 | Ga0265330_10008045 | Ga0265330_100080453 | 209 |
| 132 | 3300031507 | Ga0307509_10040521 | Ga0307509_100405212 | 209 |
| 133 | 3300031507 | Ga0307509_10103840 | Ga0307509_101038402 | 209 |
| 134 | 3300031730 | Ga0307516_10013014 | Ga0307516_100130142 | 209 |
| 135 | 3300031730 | Ga0307516_10118051 | Ga0307516_101180512 | 209 |
| 136 | 3300033179 | Ga0307507_10006568 | Ga0307507_100065686 | 209 |
| 137 | 3300033442 | Ga0315911_1000018 | Ga0315911_10000184 | 209 |
| 138 | 3300033544 | Ga0316215_1001164 | Ga0316215_10011642 | 209 |
| 139 | 3300035089 | Ga0373944_0055378 | Ga0373944_0055378_199_852 | 209 |
| 140 | 3300035111 | Ga0373923_0001363 | Ga0373923_0001363_4749_5402 | 209 |
| 141 | 3300035118 | Ga0373954_0033492 | Ga0373954_0033492_997_1650 | 209 |
| 142 | 3300035119 | Ga0373956_0248536 | Ga0373956_0248536_80_733 | 209 |
| 143 | 3300035120 | Ga0373957_0039158 | Ga0373957_0039158_1059_1712 | 209 |
| 144 | 3300035121 | Ga0373960_0137412 | Ga0373960_0137412_12_671 | 209 |
| 145 | 3300035171 | Ga0373946_0002379 | Ga0373946_0002379_4740_5393 | 209 |
| 146 | 3300035172 | Ga0373955_0033444 | Ga0373955_0033444_74_727 | 209 |
| 147 | 3300035410 | Ga0373924_0294345 | Ga0373924_0294345_27_680 | 209 |
| 148 | 3300035692 | Ga0373935_0000229 | Ga0373935_0000229_9854_10507 | 209 |
| 149 | 3300035692 | Ga0373935_0046204 | Ga0373935_0046204_1914_2567 | 209 |
| 150 | 3300035692 | Ga0373935_0112353 | Ga0373935_0112353_683_1336 | 209 |
| 151 | 3300035695 | Ga0373927_0000071 | Ga0373927_0000071_25240_25893 | 209 |
| 152 | 3300035695 | Ga0373927_0063549 | Ga0373927_0063549_525_1178 | 209 |
| 153 | 3300035695 | Ga0373927_0466129 | Ga0373927_0466129_100_753 | 209 |
| 154 | 3300035725 | Ga0373947_0000540 | Ga0373947_0000540_19172_19825 | 209 |
| 155 | 3300035725 | Ga0373947_0069223 | Ga0373947_0069223_898_1551 | 209 |
| 156 | 3300035725 | Ga0373947_0143608 | Ga0373947_0143608_351_1004 | 209 |
| 157 | 3300036401 | Ga0373937_0313318 | Ga0373937_0313318_630_1283 | 209 |
| 158 | 3300036459 | Ga0372808_002837 | Ga0372808_002837_1301_1954 | 209 |
| 159 | 3300037068 | Ga0373925_0011299 | Ga0373925_0011299_3948_4601 | 209 |
| 160 | 3300037068 | Ga0373925_0154604 | Ga0373925_0154604_92_745 | 209 |
| 161 | 3300037312 | Ga0395899_0092631 | Ga0395899_0092631_608_1261 | 209 |
| 162 | 3300037418 | Ga0395900_0003234 | Ga0395900_0003234_1672_2325 | 209 |
| 163 | 3300037418 | Ga0395900_0430249 | Ga0395900_0430249_350_1003 | 209 |
| 164 | 3300037466 | Ga0395898_0003112 | Ga0395898_0003112_7989_8642 | 209 |
| 165 | 3300038443 | Ga0395901_0052714 | Ga0395901_0052714_741_1394 | 209 |
| 166 | 3300039437 | Ga0436365_1026947 | Ga0436365_1026947_289_942 | 209 |
| 167 | 3300041486 | Ga0451807_0166552 | Ga0451807_0166552_138_791 | 209 |
| 168 | 3300044694 | Ga0466963_0127118 | Ga0466963_0127118_208_861 | 209 |
| 169 | 3300044842 | Ga0466957_0026692 | Ga0466957_0026692_2202_2855 | 209 |
| 170 | 3300045049 | Ga0466959_0095788 | Ga0466959_0095788_684_1337 | 209 |
| 171 | 3300045976 | Ga0466967_1136960 | Ga0466967_1136960_115_768 | 209 |
| 172 | 3300046454 | Ga0495592_0011328 | Ga0495592_0011328_1058_1711 | 209 |
| 173 | 3300046455 | Ga0495603_0000035 | Ga0495603_0000035_21602_22255 | 209 |
| 174 | 3300046459 | Ga0495629_0000081 | Ga0495629_0000081_58839_59492 | 209 |
| 175 | 3300046459 | Ga0495629_0043007 | Ga0495629_0043007_2151_2804 | 209 |
| 176 | 3300046461 | Ga0495641_0003571 | Ga0495641_0003571_5501_6154 | 209 |
| 177 | 3300046472 | Ga0495580_0007845 | Ga0495580_0007845_1837_2490 | 209 |
| 178 | 3300046473 | Ga0495582_0000235 | Ga0495582_0000235_6669_7322 | 209 |
| 179 | 3300046475 | Ga0495639_0000010 | Ga0495639_0000010_17496_18149 | 209 |
| 180 | 3300046475 | Ga0495639_0008724 | Ga0495639_0008724_2490_3143 | 209 |
| 181 | 3300046476 | Ga0495662_0003600 | Ga0495662_0003600_1175_1828 | 209 |
| 182 | 3300046477 | Ga0495664_0003381 | Ga0495664_0003381_308_961 | 209 |
| 183 | 3300046477 | Ga0495664_0127817 | Ga0495664_0127817_162_815 | 209 |
| 184 | 3300046477 | Ga0495664_0195603 | Ga0495664_0195603_532_1185 | 209 |
| 185 | 3300046499 | Ga0495594_0045839 | Ga0495594_0045839_597_1250 | 209 |
| 186 | 3300046511 | Ga0495608_0095113 | Ga0495608_0095113_28_681 | 209 |
| 187 | 3300046514 | Ga0495618_0029014 | Ga0495618_0029014_1651_2304 | 209 |
| 188 | 3300046514 | Ga0495618_0072387 | Ga0495618_0072387_459_1112 | 209 |
| 189 | 3300046516 | Ga0495628_0050808 | Ga0495628_0050808_2532_3185 | 209 |
| 190 | 3300046517 | Ga0495630_0003778 | Ga0495630_0003778_3932_4585 | 209 |
| 191 | 3300046517 | Ga0495630_0021706 | Ga0495630_0021706_2887_3540 | 209 |
| 192 | 3300046524 | Ga0495648_0118560 | Ga0495648_0118560_477_1130 | 209 |
| 193 | 3300046526 | Ga0495666_0041695 | Ga0495666_0041695_1216_1869 | 209 |
| 194 | 3300046526 | Ga0495666_0046722 | Ga0495666_0046722_1107_1760 | 209 |
| 195 | 3300046529 | Ga0495652_0027318 | Ga0495652_0027318_2140_2793 | 209 |
| 196 | 3300046529 | Ga0495652_0413290 | Ga0495652_0413290_228_881 | 209 |
| 197 | 3300046531 | Ga0495665_0000005 | Ga0495665_0000005_4623_5276 | 209 |
| 198 | 3300046533 | Ga0495640_0006942 | Ga0495640_0006942_5620_6273 | 209 |
| 199 | 3300046533 | Ga0495640_0010386 | Ga0495640_0010386_2151_2804 | 209 |
| 200 | 3300046535 | Ga0495586_0028532 | Ga0495586_0028532_36_689 | 209 |
| 201 | 3300046536 | Ga0495587_0107421 | Ga0495587_0107421_60_713 | 209 |
| 202 | 3300046536 | Ga0495587_0200318 | Ga0495587_0200318_359_1012 | 209 |
| 203 | 3300046543 | Ga0495645_0033977 | Ga0495645_0033977_1513_2166 | 209 |
| 204 | 3300046543 | Ga0495645_0210646 | Ga0495645_0210646_364_1017 | 209 |
| 205 | 3300046543 | Ga0495645_0273510 | Ga0495645_0273510_276_929 | 209 |
| 206 | 3300046557 | Ga0495622_0004449 | Ga0495622_0004449_3874_4527 | 209 |
| 207 | 3300046557 | Ga0495622_0008890 | Ga0495622_0008890_3068_3721 | 209 |
| 208 | 3300046559 | Ga0495667_0030300 | Ga0495667_0030300_2917_3570 | 209 |
| 209 | 3300046559 | Ga0495667_0042926 | Ga0495667_0042926_322_975 | 209 |
| 210 | 3300046642 | Ga0495634_0000261 | Ga0495634_0000261_20978_21631 | 209 |
| 211 | 3300046642 | Ga0495634_0037057 | Ga0495634_0037057_100_753 | 209 |
| 212 | 3300046642 | Ga0495634_0174845 | Ga0495634_0174845_393_1046 | 209 |
| 213 | 3300046663 | Ga0495635_0006062 | Ga0495635_0006062_1431_2084 | 209 |
| 214 | 3300046678 | Ga0495599_0349752 | Ga0495599_0349752_211_864 | 209 |
| 215 | 3300046679 | Ga0495623_0069387 | Ga0495623_0069387_822_1475 | 209 |
| 216 | 3300046679 | Ga0495623_0415395 | Ga0495623_0415395_26_679 | 209 |
| 217 | 3300046680 | Ga0495646_0031838 | Ga0495646_0031838_2099_2752 | 209 |
| 218 | 3300046680 | Ga0495646_0313745 | Ga0495646_0313745_93_746 | 209 |
| 219 | 3300046681 | Ga0495647_0000500 | Ga0495647_0000500_7182_7835 | 209 |
| 220 | 3300046683 | Ga0495658_0000771 | Ga0495658_0000771_2101_2754 | 209 |
| 221 | 3300046683 | Ga0495658_0006453 | Ga0495658_0006453_109_762 | 209 |
| 222 | 3300046689 | Ga0495613_0006929 | Ga0495613_0006929_2260_2913 | 209 |
| 223 | 3300046690 | Ga0495624_0001342 | Ga0495624_0001342_1457_2110 | 209 |
| 224 | 3300046690 | Ga0495624_0215228 | Ga0495624_0215228_399_1052 | 209 |
| 225 | 3300046809 | Ga0495600_0032744 | Ga0495600_0032744_441_1094 | 209 |
| 226 | 3300047315 | Ga0495581_0000018 | Ga0495581_0000018_19880_20533 | 209 |
| 227 | 3300047315 | Ga0495581_0016589 | Ga0495581_0016589_1106_1759 | 209 |
| 228 | 3300047317 | Ga0495604_0073781 | Ga0495604_0073781_1421_2074 | 209 |
| 229 | 3300047317 | Ga0495604_0211974 | Ga0495604_0211974_497_1150 | 209 |
| 230 | 3300047319 | Ga0495674_0000134 | Ga0495674_0000134_6258_6911 | 209 |
| 231 | 3300047319 | Ga0495674_0252255 | Ga0495674_0252255_205_858 | 209 |
| 232 | 3300047321 | Ga0495676_0034073 | Ga0495676_0034073_2181_2834 | 209 |
| 233 | 3300047471 | Ga0495684_0035829 | Ga0495684_0035829_1512_2165 | 209 |
| 234 | 3300047673 | Ga0495593_0000072 | Ga0495593_0000072_24420_25073 | 209 |
| 235 | 3300047673 | Ga0495593_0032448 | Ga0495593_0032448_110_763 | 209 |
| 236 | 3300048905 | Ga0496102_0860033 | Ga0496102_0860033_101_754 | 209 |
| 237 | 3300048906 | Ga0496103_0029706 | Ga0496103_0029706_1110_1763 | 209 |
| 238 | 3300048909 | Ga0496106_0007422 | Ga0496106_0007422_3815_4468 | 209 |
| 239 | 3300048919 | Ga0496116_0305297 | Ga0496116_0305297_60_713 | 209 |
| 240 | 3300048920 | Ga0496117_0037310 | Ga0496117_0037310_1538_2191 | 209 |
| 241 | 3300048920 | Ga0496117_0037409 | Ga0496117_0037409_2629_3282 | 209 |
| 242 | 3300048921 | Ga0496118_0003042 | Ga0496118_0003042_3618_4271 | 209 |
| 243 | 3300048921 | Ga0496118_0035533 | Ga0496118_0035533_144_797 | 209 |
| 244 | 3300048923 | Ga0496120_0091510 | Ga0496120_0091510_282_935 | 209 |
| 245 | 3300048924 | Ga0496121_0000716 | Ga0496121_0000716_3679_4332 | 209 |
| 246 | 3300048924 | Ga0496121_0005545 | Ga0496121_0005545_14741_15394 | 209 |
| 247 | 3300048924 | Ga0496121_0019090 | Ga0496121_0019090_1610_2263 | 209 |
| 248 | 3300048924 | Ga0496121_0041274 | Ga0496121_0041274_1289_1942 | 209 |
| 249 | 3300048924 | Ga0496121_0553768 | Ga0496121_0553768_41_694 | 209 |
| 250 | 3300048927 | Ga0496124_0012598 | Ga0496124_0012598_3266_3919 | 209 |
| 251 | 3300048928 | Ga0496125_0000048 | Ga0496125_0000048_119703_120356 | 209 |
| 252 | 3300048928 | Ga0496125_0000746 | Ga0496125_0000746_6245_6898 | 209 |
| 253 | 3300048928 | Ga0496125_0013770 | Ga0496125_0013770_4804_5457 | 209 |
| 254 | 3300048929 | Ga0496126_0005693 | Ga0496126_0005693_3488_4141 | 209 |
| 255 | 3300049460 | Ga0495682_0134228 | Ga0495682_0134228_26_679 | 209 |
| 256 | 3300049581 | Ga0501047_0305411 | Ga0501047_0305411_98_751 | 209 |
| 257 | 3300050512 | nmdc:mga0n895_128691_c1 | nmdc:mga0n895_128691_c1_239_898 | 209 |
| 258 | 3300050512 | nmdc:mga0n895_134642_c1 | nmdc:mga0n895_134642_c1_633_1286 | 209 |
| 259 | 3300050513 | nmdc:mga0rr50_370536_c1 | nmdc:mga0rr50_370536_c1_190_849 | 209 |
| 260 | 3300050514 | nmdc:mga08x19_85407_c1 | nmdc:mga08x19_85407_c1_253_906 | 209 |
| 261 | 3300053078 | Ga0495612_0011133 | Ga0495612_0011133_1897_2550 | 209 |
| 262 | 3300053080 | Ga0500635_0012384 | Ga0500635_0012384_801_1454 | 209 |
| 263 | 3300053093 | Ga0500651_0028614 | Ga0500651_0028614_56_709 | 209 |
| 264 | 3300053094 | Ga0500566_0073701 | Ga0500566_0073701_1173_1826 | 209 |
| 265 | 3300053119 | Ga0500595_002443 | Ga0500595_002443_3893_4546 | 209 |
| 266 | 3300053119 | Ga0500595_019169 | Ga0500595_019169_1602_2255 | 209 |
| 267 | 3300053119 | Ga0500595_091501 | Ga0500595_091501_217_870 | 209 |
| 268 | 3300053134 | Ga0500658_0139657 | Ga0500658_0139657_19_684 | 209 |
| 269 | 3300053136 | Ga0500559_0068320 | Ga0500559_0068320_718_1371 | 209 |
| 270 | 3300053140 | Ga0500573_0090793 | Ga0500573_0090793_978_1631 | 209 |
| 271 | 3300053142 | Ga0500577_0000112 | Ga0500577_0000112_4313_4966 | 209 |
| 272 | 3300053148 | Ga0500590_045923 | Ga0500590_045923_1109_1762 | 209 |
| 273 | 3300053162 | Ga0500638_110194 | Ga0500638_110194_131_784 | 209 |
| 274 | 3300053177 | Ga0500636_0346668 | Ga0500636_0346668_27_680 | 209 |
| 275 | 3300053178 | Ga0500637_0040903 | Ga0500637_0040903_1165_1818 | 209 |
| 276 | 3300053724 | Ga0500570_105258 | Ga0500570_105258_141_794 | 209 |
| 277 | 3300053735 | Ga0500596_001994 | Ga0500596_001994_559_1212 | 209 |
| 278 | 3300037418 | Ga0395900_0131044 | Ga0395900_0131044_1795_2460 | 210 |
| 279 | 3300037471 | Ga0395905_0059181 | Ga0395905_0059181_1881_2546 | 210 |
| 280 | 3300038443 | Ga0395901_0234804 | Ga0395901_0234804_1129_1794 | 210 |
| 281 | iso_pu_bacteria | 2721755755 | 2723842008 | 210 |
| 282 | iso_pu_bacteria | 2791355199 | 2793077443 | 210 |
| 283 | iso_pu_bacteria | 8006964411 | 8006968294 | 210 |
| 284 | iso_pu_bacteria | 8006994254 | 8007000224 | 210 |
| 285 | 3300005844 | Ga0068862_100177207 | Ga0068862_1001772072 | 211 |
| 286 | 3300025972 | Ga0207668_10234194 | Ga0207668_102341942 | 211 |
| 287 | 3300028380 | Ga0268265_10195946 | Ga0268265_101959462 | 211 |
| 288 | 3300028786 | Ga0307517_10002211 | Ga0307517_1000221121 | 211 |
| 289 | 3300028786 | Ga0307517_10301388 | Ga0307517_103013881 | 211 |
| 290 | 3300031456 | Ga0307513_10547723 | Ga0307513_105477232 | 211 |
| 291 | 3300049572 | Ga0501036_0310787 | Ga0501036_0310787_551_1225 | 211 |
| 292 | 3300049578 | Ga0501042_0098853 | Ga0501042_0098853_1342_2016 | 211 |
| 293 | 3300049587 | Ga0501071_0631393 | Ga0501071_0631393_98_772 | 211 |
| 294 | 3300005548 | Ga0070665_100401617 | Ga0070665_1004016172 | 212 |
| 295 | 3300005615 | Ga0070702_100032706 | Ga0070702_1000327061 | 212 |
| 296 | 3300006038 | Ga0075365_10027944 | Ga0075365_100279442 | 212 |
| 297 | 3300006844 | Ga0075428_100125716 | Ga0075428_1001257162 | 212 |
| 298 | 3300009147 | Ga0114129_10078084 | Ga0114129_100780843 | 212 |
| 299 | 3300031507 | Ga0307509_10241750 | Ga0307509_102417502 | 212 |
| 300 | 3300033180 | Ga0307510_10020522 | Ga0307510_100205223 | 212 |
| 301 | 3300046452 | Ga0495617_004269 | Ga0495617_004269_3830_4561 | 212 |
| 302 | 3300046507 | Ga0495606_0231448 | Ga0495606_0231448_43_774 | 212 |
| 303 | 3300046512 | Ga0495610_0044581 | Ga0495610_0044581_1258_1989 | 212 |
| 304 | 3300046538 | Ga0495609_0014031 | Ga0495609_0014031_1467_2198 | 212 |
| 305 | 3300046557 | Ga0495622_0211096 | Ga0495622_0211096_71_802 | 212 |
| 306 | 3300046615 | Ga0495656_0060560 | Ga0495656_0060560_359_1090 | 212 |
| 307 | 3300046616 | Ga0495668_0034272 | Ga0495668_0034272_579_1310 | 212 |
| 308 | 3300046810 | Ga0495660_0220297 | Ga0495660_0220297_16_747 | 212 |
| 309 | 3300048924 | Ga0496121_0040476 | Ga0496121_0040476_3167_3841 | 212 |
| 310 | 3300048929 | Ga0496126_0004591 | Ga0496126_0004591_14536_15210 | 212 |
| 311 | 3300053119 | Ga0500595_007200 | Ga0500595_007200_379_1110 | 212 |
| 312 | 3300053137 | Ga0500561_0023415 | Ga0500561_0023415_417_1148 | 212 |
| 313 | iso_pu_bacteria | 8006984368 | 8006985971 | 212 |
| 314 | 3300005334 | Ga0068869_100645658 | Ga0068869_1006456581 | 213 |
| 315 | 3300005336 | Ga0070680_100097862 | Ga0070680_1000978622 | 213 |
| 316 | 3300005337 | Ga0070682_100140230 | Ga0070682_1001402302 | 213 |
| 317 | 3300005339 | Ga0070660_100015135 | Ga0070660_1000151353 | 213 |
| 318 | 3300005341 | Ga0070691_10028127 | Ga0070691_100281272 | 213 |
| 319 | 3300005345 | Ga0070692_10108039 | Ga0070692_101080392 | 213 |
| 320 | 3300005347 | Ga0070668_100124669 | Ga0070668_1001246692 | 213 |
| 321 | 3300005355 | Ga0070671_100376557 | Ga0070671_1003765571 | 213 |
| 322 | 3300005356 | Ga0070674_100021497 | Ga0070674_1000214972 | 213 |
| 323 | 3300005366 | Ga0070659_100061934 | Ga0070659_1000619341 | 213 |
| 324 | 3300005366 | Ga0070659_100566076 | Ga0070659_1005660762 | 213 |
| 325 | 3300005435 | Ga0070714_100056936 | Ga0070714_1000569362 | 213 |
| 326 | 3300005435 | Ga0070714_100558377 | Ga0070714_1005583772 | 213 |
| 327 | 3300005436 | Ga0070713_100310531 | Ga0070713_1003105312 | 213 |
| 328 | 3300005437 | Ga0070710_10167727 | Ga0070710_101677272 | 213 |
| 329 | 3300005455 | Ga0070663_100015495 | Ga0070663_1000154953 | 213 |
| 330 | 3300005457 | Ga0070662_100029453 | Ga0070662_1000294531 | 213 |
| 331 | 3300005468 | Ga0070707_100062897 | Ga0070707_1000628973 | 213 |
| 332 | 3300005471 | Ga0070698_100083348 | Ga0070698_1000833483 | 213 |
| 333 | 3300005530 | Ga0070679_100023653 | Ga0070679_1000236532 | 213 |
| 334 | 3300005535 | Ga0070684_100008002 | Ga0070684_1000080023 | 213 |
| 335 | 3300005536 | Ga0070697_100031162 | Ga0070697_1000311621 | 213 |
| 336 | 3300005536 | Ga0070697_100062812 | Ga0070697_1000628122 | 213 |
| 337 | 3300005536 | Ga0070697_100165141 | Ga0070697_1001651411 | 213 |
| 338 | 3300005539 | Ga0068853_100034017 | Ga0068853_1000340173 | 213 |
| 339 | 3300005539 | Ga0068853_100127126 | Ga0068853_1001271262 | 213 |
| 340 | 3300005543 | Ga0070672_100042288 | Ga0070672_1000422881 | 213 |
| 341 | 3300005547 | Ga0070693_100096847 | Ga0070693_1000968472 | 213 |
| 342 | 3300005563 | Ga0068855_100012487 | Ga0068855_1000124872 | 213 |
| 343 | 3300005563 | Ga0068855_100052929 | Ga0068855_1000529291 | 213 |
| 344 | 3300005577 | Ga0068857_100023914 | Ga0068857_1000239143 | 213 |
| 345 | 3300005578 | Ga0068854_100376662 | Ga0068854_1003766622 | 213 |
| 346 | 3300005614 | Ga0068856_100928639 | Ga0068856_1009286391 | 213 |
| 347 | 3300005616 | Ga0068852_100002923 | Ga0068852_1000029235 | 213 |
| 348 | 3300005616 | Ga0068852_100048949 | Ga0068852_1000489493 | 213 |
| 349 | 3300005718 | Ga0068866_10026038 | Ga0068866_100260382 | 213 |
| 350 | 3300005719 | Ga0068861_100031166 | Ga0068861_1000311663 | 213 |
| 351 | 3300005983 | Ga0081540_1006692 | Ga0081540_10066925 | 213 |
| 352 | 3300006042 | Ga0075368_10029829 | Ga0075368_100298292 | 213 |
| 353 | 3300006173 | Ga0070716_100012248 | Ga0070716_1000122482 | 213 |
| 354 | 3300006175 | Ga0070712_100141682 | Ga0070712_1001416823 | 213 |
| 355 | 3300006175 | Ga0070712_100470155 | Ga0070712_1004701552 | 213 |
| 356 | 3300006186 | Ga0075369_10049606 | Ga0075369_100496062 | 213 |
| 357 | 3300006881 | Ga0068865_100148872 | Ga0068865_1001488722 | 213 |
| 358 | 3300007265 | Ga0099794_10034843 | Ga0099794_100348432 | 213 |
| 359 | 3300007265 | Ga0099794_10038540 | Ga0099794_100385403 | 213 |
| 360 | 3300007788 | Ga0099795_10037570 | Ga0099795_100375702 | 213 |
| 361 | 3300007788 | Ga0099795_10090904 | Ga0099795_100909042 | 213 |
| 362 | 3300009093 | Ga0105240_10009432 | Ga0105240_100094322 | 213 |
| 363 | 3300009093 | Ga0105240_10027328 | Ga0105240_100273283 | 213 |
| 364 | 3300009098 | Ga0105245_10023002 | Ga0105245_100230023 | 213 |
| 365 | 3300009148 | Ga0105243_10036413 | Ga0105243_100364132 | 213 |
| 366 | 3300009148 | Ga0105243_11101531 | Ga0105243_111015311 | 213 |
| 367 | 3300009174 | Ga0105241_10141400 | Ga0105241_101414002 | 213 |
| 368 | 3300009177 | Ga0105248_10008995 | Ga0105248_100089957 | 213 |
| 369 | 3300009177 | Ga0105248_10175028 | Ga0105248_101750282 | 213 |
| 370 | 3300009545 | Ga0105237_10012543 | Ga0105237_100125439 | 213 |
| 371 | 3300009551 | Ga0105238_10011156 | Ga0105238_100111567 | 213 |
| 372 | 3300009553 | Ga0105249_10032742 | Ga0105249_100327422 | 213 |
| 373 | 3300010159 | Ga0099796_10078459 | Ga0099796_100784592 | 213 |
| 374 | 3300010375 | Ga0105239_10004474 | Ga0105239_1000447410 | 213 |
| 375 | 3300010375 | Ga0105239_10819732 | Ga0105239_108197322 | 213 |
| 376 | 3300010375 | Ga0105239_10968208 | Ga0105239_109682082 | 213 |
| 377 | 3300013105 | Ga0157369_10009146 | Ga0157369_100091463 | 213 |
| 378 | 3300013105 | Ga0157369_10267128 | Ga0157369_102671282 | 213 |
| 379 | 3300013308 | Ga0157375_10033840 | Ga0157375_100338402 | 213 |
| 380 | 3300014326 | Ga0157380_10131962 | Ga0157380_101319622 | 213 |
| 381 | 3300014968 | Ga0157379_10149767 | Ga0157379_101497672 | 213 |
| 382 | 3300017792 | Ga0163161_10047181 | Ga0163161_100471812 | 213 |
| 383 | 3300017792 | Ga0163161_10108055 | Ga0163161_101080552 | 213 |
| 384 | 3300021384 | Ga0213876_10000991 | Ga0213876_100009914 | 213 |
| 385 | 3300025321 | Ga0207656_10062872 | Ga0207656_100628722 | 213 |
| 386 | 3300025901 | Ga0207688_10130340 | Ga0207688_101303401 | 213 |
| 387 | 3300025907 | Ga0207645_10065263 | Ga0207645_100652632 | 213 |
| 388 | 3300025911 | Ga0207654_10203702 | Ga0207654_102037022 | 213 |
| 389 | 3300025912 | Ga0207707_10043500 | Ga0207707_100435002 | 213 |
| 390 | 3300025913 | Ga0207695_10020475 | Ga0207695_100204755 | 213 |
| 391 | 3300025915 | Ga0207693_10007348 | Ga0207693_100073482 | 213 |
| 392 | 3300025917 | Ga0207660_10026709 | Ga0207660_100267092 | 213 |
| 393 | 3300025919 | Ga0207657_10006056 | Ga0207657_100060562 | 213 |
| 394 | 3300025919 | Ga0207657_10117003 | Ga0207657_101170032 | 213 |
| 395 | 3300025921 | Ga0207652_10018674 | Ga0207652_100186743 | 213 |
| 396 | 3300025922 | Ga0207646_10057962 | Ga0207646_100579622 | 213 |
| 397 | 3300025922 | Ga0207646_10628179 | Ga0207646_106281791 | 213 |
| 398 | 3300025924 | Ga0207694_10015674 | Ga0207694_100156742 | 213 |
| 399 | 3300025927 | Ga0207687_10050362 | Ga0207687_100503621 | 213 |
| 400 | 3300025928 | Ga0207700_10336598 | Ga0207700_103365981 | 213 |
| 401 | 3300025929 | Ga0207664_10309465 | Ga0207664_103094652 | 213 |
| 402 | 3300025933 | Ga0207706_10359974 | Ga0207706_103599742 | 213 |
| 403 | 3300025934 | Ga0207686_10345406 | Ga0207686_103454062 | 213 |
| 404 | 3300025937 | Ga0207669_10005920 | Ga0207669_100059203 | 213 |
| 405 | 3300025938 | Ga0207704_10027636 | Ga0207704_100276362 | 213 |
| 406 | 3300025939 | Ga0207665_10033184 | Ga0207665_100331842 | 213 |
| 407 | 3300025940 | Ga0207691_10091254 | Ga0207691_100912542 | 213 |
| 408 | 3300025944 | Ga0207661_10012674 | Ga0207661_100126742 | 213 |
| 409 | 3300025949 | Ga0207667_10011217 | Ga0207667_100112177 | 213 |
| 410 | 3300025949 | Ga0207667_10435136 | Ga0207667_104351362 | 213 |
| 411 | 3300025972 | Ga0207668_10137570 | Ga0207668_101375702 | 213 |
| 412 | 3300026023 | Ga0207677_10019638 | Ga0207677_100196382 | 213 |
| 413 | 3300026041 | Ga0207639_10015161 | Ga0207639_100151612 | 213 |
| 414 | 3300026067 | Ga0207678_10073479 | Ga0207678_100734792 | 213 |
| 415 | 3300026067 | Ga0207678_10432212 | Ga0207678_104322122 | 213 |
| 416 | 3300026075 | Ga0207708_10023977 | Ga0207708_100239772 | 213 |
| 417 | 3300026078 | Ga0207702_10000056 | Ga0207702_1000005626 | 213 |
| 418 | 3300026089 | Ga0207648_10058517 | Ga0207648_100585172 | 213 |
| 419 | 3300026116 | Ga0207674_10018427 | Ga0207674_100184274 | 213 |
| 420 | 3300026142 | Ga0207698_10032169 | Ga0207698_100321692 | 213 |
| 421 | 3300026142 | Ga0207698_10093936 | Ga0207698_100939363 | 213 |
| 422 | 3300026142 | Ga0207698_10810232 | Ga0207698_108102321 | 213 |
| 423 | 3300027671 | Ga0209588_1017686 | Ga0209588_10176862 | 213 |
| 424 | 3300027671 | Ga0209588_1021532 | Ga0209588_10215322 | 213 |
| 425 | 3300028379 | Ga0268266_10341939 | Ga0268266_103419392 | 213 |
| 426 | 3300028786 | Ga0307517_10349299 | Ga0307517_103492991 | 213 |
| 427 | 3300031235 | Ga0265330_10013923 | Ga0265330_100139232 | 213 |
| 428 | 3300031235 | Ga0265330_10033253 | Ga0265330_100332532 | 213 |
| 429 | 3300031238 | Ga0265332_10011317 | Ga0265332_100113172 | 213 |
| 430 | 3300031239 | Ga0265328_10146619 | Ga0265328_101466192 | 213 |
| 431 | 3300031241 | Ga0265325_10002005 | Ga0265325_100020057 | 213 |
| 432 | 3300031247 | Ga0265340_10103774 | Ga0265340_101037741 | 213 |
| 433 | 3300031249 | Ga0265339_10045819 | Ga0265339_100458192 | 213 |
| 434 | 3300031250 | Ga0265331_10021452 | Ga0265331_100214523 | 213 |
| 435 | 3300031456 | Ga0307513_10130648 | Ga0307513_101306482 | 213 |
| 436 | 3300031616 | Ga0307508_10000005 | Ga0307508_10000005219 | 213 |
| 437 | 3300031616 | Ga0307508_10059018 | Ga0307508_100590182 | 213 |
| 438 | 3300031711 | Ga0265314_10000900 | Ga0265314_1000090011 | 213 |
| 439 | 3300031712 | Ga0265342_10050901 | Ga0265342_100509012 | 213 |
| 440 | 3300031712 | Ga0265342_10070545 | Ga0265342_100705452 | 213 |
| 441 | 3300031712 | Ga0265342_10330904 | Ga0265342_103309041 | 213 |
| 442 | 3300031730 | Ga0307516_10245238 | Ga0307516_102452382 | 213 |
| 443 | 3300032002 | Ga0307416_100174939 | Ga0307416_1001749392 | 213 |
| 444 | 3300032126 | Ga0307415_100160604 | Ga0307415_1001606042 | 213 |
| 445 | 3300033180 | Ga0307510_10068511 | Ga0307510_100685112 | 213 |
| 446 | 3300035086 | Ga0373934_0006395 | Ga0373934_0006395_2458_3132 | 213 |
| 447 | 3300035088 | Ga0373940_0020359 | Ga0373940_0020359_141_815 | 213 |
| 448 | 3300035092 | Ga0373952_0067162 | Ga0373952_0067162_77_751 | 213 |
| 449 | 3300035117 | Ga0373953_0008643 | Ga0373953_0008643_455_1129 | 213 |
| 450 | 3300035118 | Ga0373954_0005748 | Ga0373954_0005748_2243_2917 | 213 |
| 451 | 3300035119 | Ga0373956_0003734 | Ga0373956_0003734_2385_3059 | 213 |
| 452 | 3300035120 | Ga0373957_0001574 | Ga0373957_0001574_2097_2771 | 213 |
| 453 | 3300035171 | Ga0373946_0054265 | Ga0373946_0054265_276_950 | 213 |
| 454 | 3300035172 | Ga0373955_0003197 | Ga0373955_0003197_4047_4721 | 213 |
| 455 | 3300035410 | Ga0373924_0002150 | Ga0373924_0002150_3768_4442 | 213 |
| 456 | 3300035692 | Ga0373935_0427797 | Ga0373935_0427797_113_898 | 213 |
| 457 | 3300035695 | Ga0373927_0004081 | Ga0373927_0004081_5168_5842 | 213 |
| 458 | 3300035695 | Ga0373927_0035793 | Ga0373927_0035793_2455_3129 | 213 |
| 459 | 3300035695 | Ga0373927_0146282 | Ga0373927_0146282_684_1358 | 213 |
| 460 | 3300035695 | Ga0373927_0164629 | Ga0373927_0164629_700_1374 | 213 |
| 461 | 3300035724 | Ga0373933_0000114 | Ga0373933_0000114_3097_3771 | 213 |
| 462 | 3300035724 | Ga0373933_0001425 | Ga0373933_0001425_11107_11781 | 213 |
| 463 | 3300035725 | Ga0373947_0001708 | Ga0373947_0001708_4313_4987 | 213 |
| 464 | 3300035725 | Ga0373947_0011676 | Ga0373947_0011676_4006_4680 | 213 |
| 465 | 3300035725 | Ga0373947_0295532 | Ga0373947_0295532_151_825 | 213 |
| 466 | 3300036401 | Ga0373937_0025351 | Ga0373937_0025351_2206_2880 | 213 |
| 467 | 3300036401 | Ga0373937_0083156 | Ga0373937_0083156_321_995 | 213 |
| 468 | 3300037068 | Ga0373925_0015901 | Ga0373925_0015901_4476_5150 | 213 |
| 469 | 3300037068 | Ga0373925_0024578 | Ga0373925_0024578_2866_3651 | 213 |
| 470 | 3300037068 | Ga0373925_0025137 | Ga0373925_0025137_633_1307 | 213 |
| 471 | 3300037068 | Ga0373925_0039338 | Ga0373925_0039338_2474_3148 | 213 |
| 472 | 3300037471 | Ga0395905_0319599 | Ga0395905_0319599_442_1116 | 213 |
| 473 | 3300039437 | Ga0436365_0650112 | Ga0436365_0650112_39633_40316 | 213 |
| 474 | 3300039453 | Ga0436362_0790756 | Ga0436362_0790756_623_1306 | 213 |
| 475 | 3300041456 | Ga0451795_0646620 | Ga0451795_0646620_51_725 | 213 |
| 476 | 3300046454 | Ga0495592_0035153 | Ga0495592_0035153_2466_3140 | 213 |
| 477 | 3300046455 | Ga0495603_0012240 | Ga0495603_0012240_497_1171 | 213 |
| 478 | 3300046455 | Ga0495603_0214493 | Ga0495603_0214493_73_858 | 213 |
| 479 | 3300046459 | Ga0495629_0002236 | Ga0495629_0002236_11800_12474 | 213 |
| 480 | 3300046459 | Ga0495629_0419301 | Ga0495629_0419301_138_881 | 213 |
| 481 | 3300046459 | Ga0495629_0509716 | Ga0495629_0509716_121_801 | 213 |
| 482 | 3300046461 | Ga0495641_0119489 | Ga0495641_0119489_236_910 | 213 |
| 483 | 3300046462 | Ga0495651_0033024 | Ga0495651_0033024_890_1564 | 213 |
| 484 | 3300046462 | Ga0495651_0107370 | Ga0495651_0107370_1275_1949 | 213 |
| 485 | 3300046463 | Ga0495653_0021802 | Ga0495653_0021802_2455_3129 | 213 |
| 486 | 3300046473 | Ga0495582_0186347 | Ga0495582_0186347_40_714 | 213 |
| 487 | 3300046473 | Ga0495582_0299611 | Ga0495582_0299611_53_838 | 213 |
| 488 | 3300046476 | Ga0495662_0110847 | Ga0495662_0110847_350_1024 | 213 |
| 489 | 3300046511 | Ga0495608_0037291 | Ga0495608_0037291_805_1479 | 213 |
| 490 | 3300046514 | Ga0495618_0193470 | Ga0495618_0193470_204_878 | 213 |
| 491 | 3300046516 | Ga0495628_0018214 | Ga0495628_0018214_2408_3082 | 213 |
| 492 | 3300046517 | Ga0495630_0142515 | Ga0495630_0142515_456_1130 | 213 |
| 493 | 3300046519 | Ga0495632_0160759 | Ga0495632_0160759_193_867 | 213 |
| 494 | 3300046523 | Ga0495644_0016803 | Ga0495644_0016803_836_1588 | 213 |
| 495 | 3300046524 | Ga0495648_0005171 | Ga0495648_0005171_3678_4352 | 213 |
| 496 | 3300046529 | Ga0495652_0023860 | Ga0495652_0023860_2477_3151 | 213 |
| 497 | 3300046533 | Ga0495640_0004314 | Ga0495640_0004314_4079_4753 | 213 |
| 498 | 3300046533 | Ga0495640_0415723 | Ga0495640_0415723_58_732 | 213 |
| 499 | 3300046536 | Ga0495587_0032742 | Ga0495587_0032742_1790_2464 | 213 |
| 500 | 3300046543 | Ga0495645_0005858 | Ga0495645_0005858_6076_6750 | 213 |
| 501 | 3300046557 | Ga0495622_0155192 | Ga0495622_0155192_291_965 | 213 |
| 502 | 3300046559 | Ga0495667_0020935 | Ga0495667_0020935_1273_1947 | 213 |
| 503 | 3300046559 | Ga0495667_0277557 | Ga0495667_0277557_198_872 | 213 |
| 504 | 3300046615 | Ga0495656_0023525 | Ga0495656_0023525_601_1344 | 213 |
| 505 | 3300046616 | Ga0495668_0012203 | Ga0495668_0012203_4342_5028 | 213 |
| 506 | 3300046642 | Ga0495634_0021377 | Ga0495634_0021377_3239_3913 | 213 |
| 507 | 3300046648 | Ga0495611_0210613 | Ga0495611_0210613_16_690 | 213 |
| 508 | 3300046660 | Ga0495625_0091563 | Ga0495625_0091563_280_954 | 213 |
| 509 | 3300046660 | Ga0495625_0352933 | Ga0495625_0352933_186_860 | 213 |
| 510 | 3300046663 | Ga0495635_0018394 | Ga0495635_0018394_2413_3087 | 213 |
| 511 | 3300046674 | Ga0495588_0010000 | Ga0495588_0010000_3553_4227 | 213 |
| 512 | 3300046675 | Ga0495657_0011243 | Ga0495657_0011243_3549_4223 | 213 |
| 513 | 3300046678 | Ga0495599_0007860 | Ga0495599_0007860_2057_2731 | 213 |
| 514 | 3300046678 | Ga0495599_0088539 | Ga0495599_0088539_778_1452 | 213 |
| 515 | 3300046679 | Ga0495623_0067061 | Ga0495623_0067061_890_1564 | 213 |
| 516 | 3300046680 | Ga0495646_0059190 | Ga0495646_0059190_1289_1963 | 213 |
| 517 | 3300046683 | Ga0495658_0314274 | Ga0495658_0314274_167_952 | 213 |
| 518 | 3300046684 | Ga0495669_0010508 | Ga0495669_0010508_280_1032 | 213 |
| 519 | 3300046689 | Ga0495613_0015463 | Ga0495613_0015463_4160_4834 | 213 |
| 520 | 3300046689 | Ga0495613_0032505 | Ga0495613_0032505_843_1517 | 213 |
| 521 | 3300046690 | Ga0495624_0276473 | Ga0495624_0276473_144_818 | 213 |
| 522 | 3300046794 | Ga0495589_0268182 | Ga0495589_0268182_26_778 | 213 |
| 523 | 3300046809 | Ga0495600_0059504 | Ga0495600_0059504_677_1351 | 213 |
| 524 | 3300046809 | Ga0495600_0148292 | Ga0495600_0148292_245_919 | 213 |
| 525 | 3300047317 | Ga0495604_0045914 | Ga0495604_0045914_677_1351 | 213 |
| 526 | 3300047320 | Ga0495672_0008522 | Ga0495672_0008522_3237_3911 | 213 |
| 527 | 3300047321 | Ga0495676_0347515 | Ga0495676_0347515_156_941 | 213 |
| 528 | 3300047322 | Ga0495680_0031781 | Ga0495680_0031781_2474_3148 | 213 |
| 529 | 3300047444 | Ga0495675_0016169 | Ga0495675_0016169_805_1479 | 213 |
| 530 | 3300047447 | Ga0495685_042713 | Ga0495685_042713_76_819 | 213 |
| 531 | 3300047471 | Ga0495684_0013146 | Ga0495684_0013146_3240_3914 | 213 |
| 532 | 3300047472 | Ga0495686_0237691 | Ga0495686_0237691_240_983 | 213 |
| 533 | 3300047673 | Ga0495593_0000594 | Ga0495593_0000594_17445_18119 | 213 |
| 534 | 3300047673 | Ga0495593_0103318 | Ga0495593_0103318_385_1128 | 213 |
| 535 | 3300047673 | Ga0495593_0251518 | Ga0495593_0251518_102_776 | 213 |
| 536 | 3300048904 | Ga0496101_0187462 | Ga0496101_0187462_157_831 | 213 |
| 537 | 3300048905 | Ga0496102_0407294 | Ga0496102_0407294_167_919 | 213 |
| 538 | 3300048909 | Ga0496106_0101809 | Ga0496106_0101809_301_975 | 213 |
| 539 | 3300048909 | Ga0496106_0252906 | Ga0496106_0252906_285_1037 | 213 |
| 540 | 3300048909 | Ga0496106_0488955 | Ga0496106_0488955_279_974 | 213 |
| 541 | 3300048910 | Ga0496107_0029943 | Ga0496107_0029943_51_746 | 213 |
| 542 | 3300048910 | Ga0496107_0274032 | Ga0496107_0274032_338_1012 | 213 |
| 543 | 3300048911 | Ga0496108_0438969 | Ga0496108_0438969_37_711 | 213 |
| 544 | 3300048913 | Ga0496110_0477090 | Ga0496110_0477090_84_827 | 213 |
| 545 | 3300048915 | Ga0496112_0075692 | Ga0496112_0075692_508_1182 | 213 |
| 546 | 3300048917 | Ga0496114_0106185 | Ga0496114_0106185_976_1650 | 213 |
| 547 | 3300048917 | Ga0496114_0291857 | Ga0496114_0291857_68_742 | 213 |
| 548 | 3300048917 | Ga0496114_0403821 | Ga0496114_0403821_335_1087 | 213 |
| 549 | 3300048918 | Ga0496115_0017903 | Ga0496115_0017903_2685_3359 | 213 |
| 550 | 3300048918 | Ga0496115_0045996 | Ga0496115_0045996_323_997 | 213 |
| 551 | 3300048918 | Ga0496115_0248022 | Ga0496115_0248022_742_1416 | 213 |
| 552 | 3300048918 | Ga0496115_0436732 | Ga0496115_0436732_228_902 | 213 |
| 553 | 3300048924 | Ga0496121_0000091 | Ga0496121_0000091_192644_193318 | 213 |
| 554 | 3300048924 | Ga0496121_0353043 | Ga0496121_0353043_80_763 | 213 |
| 555 | 3300048927 | Ga0496124_0257753 | Ga0496124_0257753_445_1119 | 213 |
| 556 | 3300048929 | Ga0496126_0021180 | Ga0496126_0021180_2462_3136 | 213 |
| 557 | 3300048929 | Ga0496126_0061520 | Ga0496126_0061520_2513_3187 | 213 |
| 558 | 3300048929 | Ga0496126_0129801 | Ga0496126_0129801_128_802 | 213 |
| 559 | 3300048929 | Ga0496126_0174464 | Ga0496126_0174464_729_1403 | 213 |
| 560 | 3300049573 | Ga0501037_0014354 | Ga0501037_0014354_3558_4271 | 213 |
| 561 | 3300049583 | Ga0501067_0087347 | Ga0501067_0087347_279_983 | 213 |
| 562 | 3300050490 | nmdc:mga03n38_12566_c1 | nmdc:mga03n38_12566_c1_1270_1944 | 213 |
| 563 | 3300050494 | nmdc:mga06z11_303276_c1 | nmdc:mga06z11_303276_c1_122_796 | 213 |
| 564 | 3300050494 | nmdc:mga06z11_320653_c1 | nmdc:mga06z11_320653_c1_101_775 | 213 |
| 565 | 3300050495 | nmdc:mga04h51_48535_c1 | nmdc:mga04h51_48535_c1_145_819 | 213 |
| 566 | 3300053077 | Ga0495601_0034250 | Ga0495601_0034250_22_696 | 213 |
| 567 | 3300053078 | Ga0495612_0109356 | Ga0495612_0109356_52_726 | 213 |
| 568 | 3300053079 | Ga0500610_0100392 | Ga0500610_0100392_729_1403 | 213 |
| 569 | 3300053080 | Ga0500635_0001063 | Ga0500635_0001063_2875_3549 | 213 |
| 570 | 3300053080 | Ga0500635_0001671 | Ga0500635_0001671_2258_2932 | 213 |
| 571 | 3300053084 | Ga0495595_0000449 | Ga0495595_0000449_4978_5652 | 213 |
| 572 | 3300053085 | Ga0495619_0020998 | Ga0495619_0020998_2474_3148 | 213 |
| 573 | 3300053087 | Ga0500643_095976 | Ga0500643_095976_106_792 | 213 |
| 574 | 3300053094 | Ga0500566_0000065 | Ga0500566_0000065_41894_42568 | 213 |
| 575 | 3300053102 | Ga0500554_000253 | Ga0500554_000253_5830_6504 | 213 |
| 576 | 3300053108 | Ga0500562_039128 | Ga0500562_039128_118_861 | 213 |
| 577 | 3300053111 | Ga0500572_004849 | Ga0500572_004849_74_748 | 213 |
| 578 | 3300053119 | Ga0500595_000253 | Ga0500595_000253_29899_30579 | 213 |
| 579 | 3300053122 | Ga0500608_018508 | Ga0500608_018508_1945_2619 | 213 |
| 580 | 3300053148 | Ga0500590_088033 | Ga0500590_088033_643_1317 | 213 |
| 581 | 3300053150 | Ga0500603_000158 | Ga0500603_000158_13192_13866 | 213 |
| 582 | 3300053150 | Ga0500603_008705 | Ga0500603_008705_1318_1992 | 213 |
| 583 | 3300053159 | Ga0500630_124419 | Ga0500630_124419_79_753 | 213 |
| 584 | 3300053162 | Ga0500638_017919 | Ga0500638_017919_1519_2199 | 213 |
| 585 | 3300053177 | Ga0500636_0041245 | Ga0500636_0041245_567_1250 | 213 |
| 586 | 3300053177 | Ga0500636_0088678 | Ga0500636_0088678_979_1653 | 213 |
| 587 | 3300053178 | Ga0500637_0000157 | Ga0500637_0000157_18214_18894 | 213 |
| 588 | 3300053735 | Ga0500596_001862 | Ga0500596_001862_1738_2412 | 213 |
| 589 | 3300055283 | Ga0500661_000942 | Ga0500661_000942_3662_4342 | 213 |
| 590 | iso_pu_bacteria | 2889033259 | 2889035093 | 213 |
| 591 | iso_pu_bacteria | 8056681323 | 8056685160 | 213 |
| 592 | 3300049568 | Ga0501031_0096761 | Ga0501031_0096761_421_1200 | 214 |
| 593 | 3300049569 | Ga0501032_0031733 | Ga0501032_0031733_2162_2941 | 214 |
| 594 | 3300049569 | Ga0501032_0215846 | Ga0501032_0215846_341_1126 | 214 |
| 595 | 3300049570 | Ga0501033_0068962 | Ga0501033_0068962_395_1174 | 214 |
| 596 | 3300049571 | Ga0501034_0454308 | Ga0501034_0454308_167_946 | 214 |
| 597 | 3300049572 | Ga0501036_0070794 | Ga0501036_0070794_1330_2115 | 214 |
| 598 | 3300049573 | Ga0501037_0192717 | Ga0501037_0192717_94_873 | 214 |
| 599 | 3300049574 | Ga0501038_0000621 | Ga0501038_0000621_15167_15952 | 214 |
| 600 | 3300049574 | Ga0501038_0086836 | Ga0501038_0086836_1219_1998 | 214 |
| 601 | 3300049575 | Ga0501039_0096527 | Ga0501039_0096527_1273_2052 | 214 |
| 602 | 3300049576 | Ga0501040_0043042 | Ga0501040_0043042_1829_2608 | 214 |
| 603 | 3300049580 | Ga0501046_0025427 | Ga0501046_0025427_2809_3588 | 214 |
| 604 | 3300049582 | Ga0501048_0036430 | Ga0501048_0036430_2700_3479 | 214 |
| 605 | 3300049584 | Ga0501068_0168483 | Ga0501068_0168483_133_912 | 214 |
| 606 | 3300049586 | Ga0501070_0247118 | Ga0501070_0247118_411_1211 | 214 |
| 607 | 3300049588 | Ga0501072_0177268 | Ga0501072_0177268_864_1643 | 214 |
| 608 | 3300049589 | Ga0501073_0098838 | Ga0501073_0098838_421_1200 | 214 |
| 609 | 3300049590 | Ga0501074_0017150 | Ga0501074_0017150_3889_4668 | 214 |
| 610 | 3300049593 | Ga0501077_0093609 | Ga0501077_0093609_931_1710 | 214 |
| 611 | 3300049741 | Ga0501079_0018245 | Ga0501079_0018245_2533_3312 | 214 |
| 612 | 3300049742 | Ga0501080_0524744 | Ga0501080_0524744_206_991 | 214 |
| 613 | 3300049744 | Ga0501083_0024395 | Ga0501083_0024395_599_1378 | 214 |
| 614 | 3300049823 | Ga0501044_0008922 | Ga0501044_0008922_9199_9984 | 214 |
| 615 | 3300049823 | Ga0501044_0494047 | Ga0501044_0494047_94_873 | 214 |
| 616 | 3300049824 | Ga0501045_0139799 | Ga0501045_0139799_392_1171 | 214 |
| 617 | 3300039438 | Ga0436360_1193161 | Ga0436360_1193161_917_1633 | 216 |
| 618 | 3300025949 | Ga0207667_10993550 | Ga0207667_109935502 | 219 |
| 619 | 3300001990 | JGI24737J22298_10037506 | JGI24737J22298_100375062 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4yms-assembly1.cif.gz_A | crystal structure of an amino acid abc transporter | 0.9391 | 7 | 243 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9384 | 5 | 226 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9366 | 5 | 226 |
| 3c41-assembly1.cif.gz_K | abc protein artp in complex with amp-pnp/mg2+ | 0.9343 | 5 | 243 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9279 | 4 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ymtJ00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.939 | 7 | 243 | 3.40.50.300 |
| af_Q9XW49_1237_1482_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.936 | 3 | 230 | 3.40.50.300 |
| af_P63386_5_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9354 | 4 | 243 | 3.40.50.300 |
| af_Q9VDR4_1380_1622_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9338 | 5 | 227 | 3.40.50.300 |
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9335 | 7 | 227 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3CF17-F1-model_v4 | ABC transporter ATP-binding protein | 0.9476 | 1 | 225 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A4V2YIE4-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9472 | 4 | 226 |
GO:0005524
GO:0016887 GO:0043215 GO:0046677 GO:1900753 |
| AF-A0A6P0JTR8-F1-model_v4 | ABC transporter ATP-binding protein | 0.946 | 5 | 226 |
GO:0005524
GO:0016887 |
| AF-A0A844W1P5-F1-model_v4 | deleted | 0.9438 | 7 | 222 |
|
| AF-A0A4Y3RI34-F1-model_v4 | Daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein | 0.943 | 3 | 226 |
GO:0005524
GO:0016887 GO:0043215 GO:0046677 GO:1900753 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar