F469859

General Info

Members Datasets Scaffolds Average Seq Length
619 365 587 225

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0247118|Ga0501070_0247118_411_1211
Length 266
Sequence MHSAATLPLRASPAATICNGVTRIFVVTMIMVWPDRFRTSPVSDTSDAIMLDIQNLTKTYRSAQERIAVLRGACLRVEPGESVALTGESGSGKSTLLHLIAGLDQADSGSIRFEDTEVTGLADRGRATLRRERLGLVFQQFNLIPSLTVADNLAFQARIAGRHDGRWQGELVDRLGLGDVLKRYPEQLSGGQQQRVAIGRALAVRPPLLLADEPTGNLDEATADGVMDLARDLIKRTGCGFLMVTHSARLAATLDRQVRLSAGQIS

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
7 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
8 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
9 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
10 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
11 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
12 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
13 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
14 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
15 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
16 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
17 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
18 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
19 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
20 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
21 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
179 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
333 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
337 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
338 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
339 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
340 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
341 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
342 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
343 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
347 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
348 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
349 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
350 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
351 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
352 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
353 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
354 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
355 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
356 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
357 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
358 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
359 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
360 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
361 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
362 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
363 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
364 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
365 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.13
Metatranscriptomes 0.16
Isolates 4.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.24
Nodule 3.55
Rhizoplane 3.55
Rhizosphere 74.96
Stem 0
Stem Tuber 0
Unclassified 9.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10037506 3300001990 Bacteria 1493
2 JGI25406J46586_10001070 3300003203 Bacteria 12840
3 JGI25404J52841_10005846 3300003659 Bacteria 2551
4 Ga0070683_100039979 3300005329 Bacteria 4309
5 Ga0068869_100645658 3300005334 Bacteria 898
6 Ga0070680_100097862 3300005336 Bacteria 2433
7 Ga0070680_100267135 3300005336 Bacteria 1448
8 Ga0070680_100698008 3300005336 Bacteria 873
9 Ga0070682_100140230 3300005337 Bacteria 1647
10 Ga0070660_100015135 3300005339 Bacteria 5566
11 Ga0070691_10028127 3300005341 Bacteria 2625
12 Ga0070692_10108039 3300005345 Bacteria 1535
13 Ga0070668_100124669 3300005347 Bacteria 2062
14 Ga0070671_100376557 3300005355 Bacteria 1213
15 Ga0070674_100021497 3300005356 Bacteria 4144
16 Ga0070659_100061934 3300005366 Bacteria 2957
17 Ga0070659_100566076 3300005366 Bacteria 974
18 Ga0070709_10000732 3300005434 Bacteria 18548
19 Ga0070709_10068699 3300005434 Bacteria 2280
20 Ga0070709_10123135 3300005434 Bacteria 1761
21 Ga0070709_10489253 3300005434 Bacteria 933
22 Ga0070714_100010788 3300005435 Bacteria 7232
23 Ga0070714_100056936 3300005435 Bacteria 3345
24 Ga0070714_100130000 3300005435 Bacteria 2250
25 Ga0070714_100558377 3300005435 Bacteria 1097
26 Ga0070713_100004657 3300005436 Bacteria 9258
27 Ga0070713_100053012 3300005436 Bacteria 3360
28 Ga0070713_100089395 3300005436 Bacteria 2645
29 Ga0070713_100128305 3300005436 Bacteria 2234
30 Ga0070713_100310531 3300005436 Bacteria 1454
31 Ga0070710_10004377 3300005437 Bacteria 6688
32 Ga0070710_10014128 3300005437 Bacteria 4012
33 Ga0070710_10167727 3300005437 Bacteria 1366
34 Ga0070711_100001113 3300005439 Bacteria 14371
35 Ga0070663_100015495 3300005455 Bacteria 4924
36 Ga0070662_100029453 3300005457 Bacteria 3832
37 Ga0070681_10087866 3300005458 Bacteria 3061
38 Ga0070681_10168780 3300005458 Bacteria 2110
39 Ga0070707_100062897 3300005468 Bacteria 3561
40 Ga0070698_100083348 3300005471 Bacteria 3187
41 Ga0070679_100023653 3300005530 Bacteria 6017
42 Ga0070679_100396250 3300005530 Bacteria 1327
43 Ga0070684_100008002 3300005535 Bacteria 8253
44 Ga0070684_100021034 3300005535 Bacteria 5420
45 Ga0070697_100031162 3300005536 Bacteria 4288
46 Ga0070697_100062812 3300005536 Bacteria 3032
47 Ga0070697_100165141 3300005536 Bacteria 1872
48 Ga0068853_100034017 3300005539 Bacteria 4324
49 Ga0068853_100127126 3300005539 Bacteria 2278
50 Ga0070672_100042288 3300005543 Bacteria 3508
51 Ga0070693_100096847 3300005547 Bacteria 1789
52 Ga0070665_100401617 3300005548 Bacteria 1378
53 Ga0068855_100012487 3300005563 Bacteria 10252
54 Ga0068855_100052929 3300005563 Bacteria 4778
55 Ga0068857_100023914 3300005577 Bacteria 5378
56 Ga0068857_100059405 3300005577 Bacteria 3396
57 Ga0068857_100420465 3300005577 Bacteria 1246
58 Ga0068854_100376662 3300005578 Bacteria 1168
59 Ga0068854_100511060 3300005578 Bacteria 1013
60 Ga0068856_100928639 3300005614 Bacteria 889
61 Ga0070702_100032706 3300005615 Bacteria 2855
62 Ga0068852_100002923 3300005616 Bacteria 11867
63 Ga0068852_100048949 3300005616 Bacteria 3614
64 Ga0068852_100786722 3300005616 Bacteria 965
65 Ga0068859_100132852 3300005617 Bacteria 2561
66 Ga0068866_10026038 3300005718 Bacteria 2757
67 Ga0068861_100031166 3300005719 Bacteria 3914
68 Ga0068860_100000257 3300005843 Bacteria 78468
69 Ga0068862_100177207 3300005844 Bacteria 1912
70 Ga0081455_10010356 3300005937 Bacteria 9474
71 Ga0081455_10088422 3300005937 Bacteria 2517
72 Ga0081540_1006050 3300005983 Bacteria 8898
73 Ga0081540_1006692 3300005983 Bacteria 8337
74 Ga0081540_1040529 3300005983 Bacteria 2427
75 Ga0081539_10000530 3300005985 Bacteria 79454
76 Ga0070717_10168325 3300006028 Bacteria 1905
77 Ga0075365_10027944 3300006038 Bacteria 3593
78 Ga0075368_10029829 3300006042 Bacteria 2110
79 Ga0075364_10225961 3300006051 Bacteria 1271
80 Ga0070715_10157171 3300006163 Bacteria 1120
81 Ga0070716_100009694 3300006173 Bacteria 4806
82 Ga0070716_100012248 3300006173 Bacteria 4343
83 Ga0070716_100537794 3300006173 Bacteria 869
84 Ga0070712_100014993 3300006175 Bacteria 4983
85 Ga0070712_100141682 3300006175 Bacteria 1836
86 Ga0070712_100470155 3300006175 Bacteria 1050
87 Ga0075369_10049606 3300006186 Bacteria 1813
88 Ga0075428_100125716 3300006844 Bacteria 2790
89 Ga0075428_100356015 3300006844 Bacteria 1571
90 Ga0075434_100072646 3300006871 Bacteria 3432
91 Ga0068865_100148872 3300006881 Bacteria 1774
92 Ga0075436_100098286 3300006914 Bacteria 2037
93 Ga0097620_100132852 3300006931 Bacteria 2561
94 Ga0075435_100327410 3300007076 Bacteria 1312
95 Ga0099794_10034843 3300007265 Bacteria 2374
96 Ga0099794_10038540 3300007265 Bacteria 2265
97 Ga0099795_10037570 3300007788 Bacteria 1705
98 Ga0099795_10090904 3300007788 Bacteria 1183
99 Ga0105240_10009432 3300009093 Bacteria 13814
100 Ga0105240_10013377 3300009093 Bacteria 11267
101 Ga0105240_10027328 3300009093 Bacteria 7471
102 Ga0111539_10121973 3300009094 Bacteria 3054
103 Ga0105245_10023002 3300009098 Bacteria 5468
104 Ga0114129_10078084 3300009147 Bacteria 4605
105 Ga0105243_10036413 3300009148 Bacteria 3820
106 Ga0105243_10836287 3300009148 Bacteria 910
107 Ga0105243_11101531 3300009148 Bacteria 802
108 Ga0105241_10141400 3300009174 Bacteria 1960
109 Ga0105248_10008995 3300009177 Bacteria 10981
110 Ga0105248_10175028 3300009177 Bacteria 2419
111 Ga0105237_10005001 3300009545 Bacteria 15097
112 Ga0105237_10012543 3300009545 Bacteria 8927
113 Ga0105238_10011156 3300009551 Bacteria 9037
114 Ga0105238_10472193 3300009551 Bacteria 1253
115 Ga0105249_10032742 3300009553 Bacteria 4704
116 Ga0099796_10044981 3300010159 Bacteria 1511
117 Ga0099796_10078459 3300010159 Bacteria 1206
118 Ga0105239_10004474 3300010375 Bacteria 16696
119 Ga0105239_10819732 3300010375 Bacteria 1066
120 Ga0105239_10968208 3300010375 Bacteria 978
121 Ga0105246_10407952 3300011119 Bacteria 1130
122 Ga0157369_10009146 3300013105 Bacteria 11335
123 Ga0157369_10031113 3300013105 Bacteria 5880
124 Ga0157369_10267128 3300013105 Bacteria 1783
125 Ga0157369_10346000 3300013105 Bacteria 1544
126 Ga0157378_10134227 3300013297 Bacteria 2294
127 Ga0157375_10033840 3300013308 Bacteria 4861
128 Ga0163163_10347324 3300014325 Bacteria 1539
129 Ga0163163_10822047 3300014325 Bacteria 993
130 Ga0157380_10131962 3300014326 Bacteria 2133
131 Ga0157379_10149767 3300014968 Bacteria 2105
132 Ga0157376_10431800 3300014969 Bacteria 1280
133 Ga0163161_10047181 3300017792 Bacteria 3111
134 Ga0163161_10108055 3300017792 Bacteria 2077
135 Ga0163161_10147496 3300017792 Bacteria 1786
136 Ga0213876_10000991 3300021384 Bacteria 18609
137 Ga0213876_10296837 3300021384 Bacteria 859
138 Ga0209148_1009224 3300025254 Bacteria 1934
139 Ga0209233_1002050 3300025261 Bacteria 7637
140 Ga0209233_1004852 3300025261 Bacteria 4528
141 Ga0209455_1005109 3300025272 Bacteria 4129
142 Ga0209455_1012118 3300025272 Bacteria 2082
143 Ga0207656_10062872 3300025321 Bacteria 1633
144 Ga0207692_10000494 3300025898 Bacteria 13955
145 Ga0207692_10042495 3300025898 Bacteria 2257
146 Ga0207710_10006473 3300025900 Bacteria 4997
147 Ga0207688_10130340 3300025901 Bacteria 1474
148 Ga0207685_10069101 3300025905 Bacteria 1425
149 Ga0207699_10004161 3300025906 Bacteria 6928
150 Ga0207699_10015928 3300025906 Bacteria 3920
151 Ga0207645_10065263 3300025907 Bacteria 2326
152 Ga0207654_10203702 3300025911 Bacteria 1304
153 Ga0207707_10043500 3300025912 Bacteria 3918
154 Ga0207707_10058212 3300025912 Bacteria 3363
155 Ga0207695_10020475 3300025913 Bacteria 7574
156 Ga0207695_10028143 3300025913 Bacteria 6240
157 Ga0207671_10145683 3300025914 Bacteria 1827
158 Ga0207693_10007348 3300025915 Bacteria 9061
159 Ga0207693_10054260 3300025915 Bacteria 3144
160 Ga0207663_10000356 3300025916 Bacteria 19925
161 Ga0207663_10056552 3300025916 Bacteria 2467
162 Ga0207660_10026709 3300025917 Bacteria 3933
163 Ga0207660_10166299 3300025917 Bacteria 1705
164 Ga0207660_10236008 3300025917 Bacteria 1439
165 Ga0207657_10006056 3300025919 Bacteria 12577
166 Ga0207657_10117003 3300025919 Bacteria 2195
167 Ga0207649_10417556 3300025920 Bacteria 1007
168 Ga0207652_10018674 3300025921 Bacteria 5690
169 Ga0207652_10997065 3300025921 Bacteria 736
170 Ga0207646_10057962 3300025922 Bacteria 3460
171 Ga0207646_10628179 3300025922 Bacteria 963
172 Ga0207694_10015674 3300025924 Bacteria 5717
173 Ga0207687_10050362 3300025927 Bacteria 2899
174 Ga0207700_10037768 3300025928 Bacteria 3500
175 Ga0207700_10336598 3300025928 Bacteria 1311
176 Ga0207700_10429936 3300025928 Bacteria 1161
177 Ga0207664_10001702 3300025929 Bacteria 14493
178 Ga0207664_10309465 3300025929 Bacteria 1391
179 Ga0207706_10359974 3300025933 Bacteria 1264
180 Ga0207686_10345406 3300025934 Bacteria 1119
181 Ga0207669_10005920 3300025937 Bacteria 5536
182 Ga0207704_10027636 3300025938 Bacteria 3134
183 Ga0207665_10033184 3300025939 Bacteria 3420
184 Ga0207665_10560749 3300025939 Bacteria 888
185 Ga0207691_10091254 3300025940 Bacteria 2730
186 Ga0207691_10766584 3300025940 Bacteria 812
187 Ga0207661_10012674 3300025944 Bacteria 6137
188 Ga0207661_10043590 3300025944 Bacteria 3541
189 Ga0207667_10011217 3300025949 Bacteria 10427
190 Ga0207667_10088803 3300025949 Bacteria 3196
191 Ga0207667_10435136 3300025949 Bacteria 1334
192 Ga0207667_10993550 3300025949 Bacteria 827
193 Ga0207668_10137570 3300025972 Bacteria 1874
194 Ga0207668_10234194 3300025972 Bacteria 1482
195 Ga0207677_10019638 3300026023 Bacteria 4087
196 Ga0207703_10389261 3300026035 Bacteria 1291
197 Ga0207639_10015161 3300026041 Bacteria 5430
198 Ga0207678_10073479 3300026067 Bacteria 2930
199 Ga0207678_10432212 3300026067 Bacteria 1143
200 Ga0207708_10023977 3300026075 Bacteria 4614
201 Ga0207702_10000056 3300026078 Bacteria 131186
202 Ga0207641_10008809 3300026088 Bacteria 8334
203 Ga0207648_10058517 3300026089 Bacteria 3361
204 Ga0207674_10018427 3300026116 Bacteria 7587
205 Ga0207674_10619321 3300026116 Bacteria 1045
206 Ga0207698_10032169 3300026142 Bacteria 3797
207 Ga0207698_10093936 3300026142 Bacteria 2464
208 Ga0207698_10810232 3300026142 Bacteria 939
209 Ga0209588_1017686 3300027671 Bacteria 2212
210 Ga0209588_1021532 3300027671 Bacteria 2026
211 Ga0268266_10341939 3300028379 Bacteria 1405
212 Ga0268265_10195946 3300028380 Bacteria 1748
213 Ga0268264_10000049 3300028381 Bacteria 329992
214 Ga0265326_10002792 3300028558 Bacteria 5848
215 Ga0265334_10003782 3300028573 Bacteria 6840
216 Ga0265336_10000430 3300028666 Bacteria 25854
217 Ga0307517_10002211 3300028786 Bacteria 31433
218 Ga0307517_10301388 3300028786 Bacteria 898
219 Ga0307517_10349299 3300028786 Bacteria 804
220 Ga0307515_10338941 3300028794 Bacteria 1157
221 Ga0265338_10000024 3300028800 Bacteria 297778
222 Ga0265324_10031172 3300029957 Bacteria 1868
223 Ga0307511_10100749 3300030521 Bacteria 1898
224 Ga0265330_10008045 3300031235 Bacteria 5103
225 Ga0265330_10013923 3300031235 Bacteria 3739
226 Ga0265330_10033253 3300031235 Bacteria 2307
227 Ga0265332_10011317 3300031238 Bacteria 3967
228 Ga0265328_10146619 3300031239 Bacteria 887
229 Ga0265325_10002005 3300031241 Bacteria 13988
230 Ga0265340_10103774 3300031247 Bacteria 1319
231 Ga0265339_10045819 3300031249 Bacteria 2406
232 Ga0265331_10021452 3300031250 Bacteria 3306
233 Ga0307513_10130648 3300031456 Bacteria 2458
234 Ga0307513_10547723 3300031456 Bacteria 870
235 Ga0307509_10040521 3300031507 Bacteria 5065
236 Ga0307509_10103840 3300031507 Bacteria 2869
237 Ga0307509_10241750 3300031507 Bacteria 1597
238 Ga0307508_10000005 3300031616 Bacteria 286511
239 Ga0307508_10059018 3300031616 Bacteria 3394
240 Ga0265314_10000900 3300031711 Bacteria 35261
241 Ga0265342_10050901 3300031712 Bacteria 2472
242 Ga0265342_10070545 3300031712 Bacteria 2038
243 Ga0265342_10330904 3300031712 Bacteria 796
244 Ga0307516_10013014 3300031730 Bacteria 8910
245 Ga0307516_10118051 3300031730 Bacteria 2447
246 Ga0307516_10245238 3300031730 Bacteria 1488
247 Ga0307416_100174939 3300032002 Bacteria 2004
248 Ga0307415_100160604 3300032126 Bacteria 1741
249 Ga0307507_10006568 3300033179 Bacteria 17727
250 Ga0307510_10020522 3300033180 Bacteria 7720
251 Ga0307510_10068511 3300033180 Bacteria 3560
252 Ga0315911_1000018 3300033442 Bacteria 152089
253 Ga0316215_1001164 3300033544 Bacteria 2550
254 Ga0373934_0006395 3300035086 Bacteria 4370
255 Ga0373940_0020359 3300035088 Bacteria 1685
256 Ga0373944_0055378 3300035089 Bacteria 1259
257 Ga0373952_0067162 3300035092 Bacteria 890
258 Ga0373923_0001363 3300035111 Bacteria 6953
259 Ga0373953_0008643 3300035117 Bacteria 3468
260 Ga0373954_0005748 3300035118 Bacteria 5382
261 Ga0373954_0033492 3300035118 Bacteria 2377
262 Ga0373956_0003734 3300035119 Bacteria 6134
263 Ga0373956_0248536 3300035119 Bacteria 845
264 Ga0373957_0001574 3300035120 Bacteria 6227
265 Ga0373957_0039158 3300035120 Bacteria 1777
266 Ga0373960_0137412 3300035121 Bacteria 825
267 Ga0373946_0002379 3300035171 Bacteria 6653
268 Ga0373946_0054265 3300035171 Bacteria 1686
269 Ga0373955_0003197 3300035172 Bacteria 7172
270 Ga0373955_0033444 3300035172 Bacteria 2708
271 Ga0373924_0002150 3300035410 Bacteria 6599
272 Ga0373924_0294345 3300035410 Bacteria 720
273 Ga0373931_0414396 3300035691 Bacteria 855
274 Ga0373935_0000229 3300035692 Bacteria 27393
275 Ga0373935_0046204 3300035692 Bacteria 2749
276 Ga0373935_0112353 3300035692 Bacteria 1809
277 Ga0373935_0427797 3300035692 Bacteria 954
278 Ga0373927_0000071 3300035695 Bacteria 73794
279 Ga0373927_0004081 3300035695 Bacteria 10306
280 Ga0373927_0035793 3300035695 Bacteria 3229
281 Ga0373927_0063549 3300035695 Bacteria 2387
282 Ga0373927_0146282 3300035695 Bacteria 1547
283 Ga0373927_0164629 3300035695 Bacteria 1453
284 Ga0373927_0466129 3300035695 Bacteria 834
285 Ga0373933_0000114 3300035724 Bacteria 52016
286 Ga0373933_0001425 3300035724 Bacteria 14028
287 Ga0373947_0000540 3300035725 Bacteria 22139
288 Ga0373947_0001708 3300035725 Bacteria 13470
289 Ga0373947_0011676 3300035725 Bacteria 5038
290 Ga0373947_0069223 3300035725 Bacteria 2160
291 Ga0373947_0143608 3300035725 Bacteria 1533
292 Ga0373947_0295532 3300035725 Bacteria 1079
293 Ga0373937_0025351 3300036401 Bacteria 5353
294 Ga0373937_0083156 3300036401 Bacteria 2962
295 Ga0373937_0313318 3300036401 Bacteria 1484
296 Ga0372808_002837 3300036459 Bacteria 2053
297 Ga0373925_0011299 3300037068 Bacteria 6478
298 Ga0373925_0015901 3300037068 Bacteria 5445
299 Ga0373925_0024578 3300037068 Bacteria 4399
300 Ga0373925_0025137 3300037068 Bacteria 4349
301 Ga0373925_0039338 3300037068 Bacteria 3499
302 Ga0373925_0154604 3300037068 Bacteria 1803
303 Ga0395899_0092631 3300037312 Bacteria 2188
304 Ga0395900_0003234 3300037418 Bacteria 17637
305 Ga0395900_0131044 3300037418 Bacteria 2570
306 Ga0395900_0430249 3300037418 Bacteria 1279
307 Ga0395898_0003112 3300037466 Bacteria 18739
308 Ga0395905_0059181 3300037471 Bacteria 3582
309 Ga0395905_0319599 3300037471 Bacteria 1442
310 Ga0395901_0052714 3300038443 Bacteria 4228
311 Ga0395901_0234804 3300038443 Bacteria 1914
312 Ga0436365_0650112 3300039437 Bacteria 58550
313 Ga0436365_1026947 3300039437 Bacteria 1223
314 Ga0436360_1193161 3300039438 Bacteria 2031
315 Ga0436362_0790756 3300039453 Bacteria 2420
316 Ga0451795_0646620 3300041456 Bacteria 775
317 Ga0451807_0166552 3300041486 Bacteria 1078
318 Ga0466963_0127118 3300044694 Bacteria 1758
319 Ga0466957_0026692 3300044842 Bacteria 3427
320 Ga0466959_0095788 3300045049 Bacteria 2128
321 Ga0466967_1136960 3300045976 Bacteria 778
322 Ga0495617_004269 3300046452 Bacteria 5219
323 Ga0495592_0011328 3300046454 Bacteria 6745
324 Ga0495592_0035153 3300046454 Bacteria 3775
325 Ga0495603_0000035 3300046455 Bacteria 57510
326 Ga0495603_0012240 3300046455 Bacteria 5196
327 Ga0495603_0214493 3300046455 Bacteria 1111
328 Ga0495629_0000081 3300046459 Bacteria 85305
329 Ga0495629_0002236 3300046459 Bacteria 14921
330 Ga0495629_0043007 3300046459 Bacteria 3173
331 Ga0495629_0419301 3300046459 Bacteria 908
332 Ga0495629_0509716 3300046459 Bacteria 811
333 Ga0495641_0003571 3300046461 Bacteria 11545
334 Ga0495641_0119489 3300046461 Bacteria 1176
335 Ga0495651_0033024 3300046462 Bacteria 4037
336 Ga0495651_0107370 3300046462 Bacteria 2068
337 Ga0495653_0021802 3300046463 Bacteria 5185
338 Ga0495580_0007845 3300046472 Bacteria 8545
339 Ga0495582_0000235 3300046473 Bacteria 30725
340 Ga0495582_0186347 3300046473 Bacteria 1183
341 Ga0495582_0299611 3300046473 Bacteria 924
342 Ga0495639_0000010 3300046475 Bacteria 93685
343 Ga0495639_0008724 3300046475 Bacteria 4348
344 Ga0495662_0003600 3300046476 Bacteria 7816
345 Ga0495662_0110847 3300046476 Bacteria 1345
346 Ga0495664_0003381 3300046477 Bacteria 8667
347 Ga0495664_0127817 3300046477 Bacteria 1538
348 Ga0495664_0195603 3300046477 Bacteria 1226
349 Ga0495594_0045839 3300046499 Bacteria 2401
350 Ga0495606_0231448 3300046507 Bacteria 1035
351 Ga0495608_0037291 3300046511 Bacteria 3268
352 Ga0495608_0095113 3300046511 Bacteria 1925
353 Ga0495610_0044581 3300046512 Bacteria 2201
354 Ga0495618_0029014 3300046514 Bacteria 3450
355 Ga0495618_0072387 3300046514 Bacteria 2193
356 Ga0495618_0193470 3300046514 Bacteria 1289
357 Ga0495628_0018214 3300046516 Bacteria 5822
358 Ga0495628_0050808 3300046516 Bacteria 3279
359 Ga0495630_0003778 3300046517 Bacteria 10573
360 Ga0495630_0021706 3300046517 Bacteria 4741
361 Ga0495630_0142515 3300046517 Bacteria 1823
362 Ga0495632_0160759 3300046519 Bacteria 1035
363 Ga0495644_0016803 3300046523 Bacteria 2800
364 Ga0495648_0005171 3300046524 Bacteria 10917
365 Ga0495648_0118560 3300046524 Bacteria 1427
366 Ga0495666_0041695 3300046526 Bacteria 2222
367 Ga0495666_0046722 3300046526 Bacteria 2086
368 Ga0495652_0023860 3300046529 Bacteria 5418
369 Ga0495652_0027318 3300046529 Bacteria 5029
370 Ga0495652_0413290 3300046529 Bacteria 952
371 Ga0495665_0000005 3300046531 Bacteria 86491
372 Ga0495640_0004314 3300046533 Bacteria 11359
373 Ga0495640_0006942 3300046533 Bacteria 8915
374 Ga0495640_0010386 3300046533 Bacteria 7202
375 Ga0495640_0415723 3300046533 Bacteria 824
376 Ga0495586_0028532 3300046535 Bacteria 2986
377 Ga0495587_0032742 3300046536 Bacteria 3140
378 Ga0495587_0107421 3300046536 Bacteria 1605
379 Ga0495587_0200318 3300046536 Bacteria 1129
380 Ga0495609_0014031 3300046538 Bacteria 3773
381 Ga0495645_0005858 3300046543 Bacteria 8485
382 Ga0495645_0033977 3300046543 Bacteria 3721
383 Ga0495645_0210646 3300046543 Bacteria 1312
384 Ga0495645_0273510 3300046543 Bacteria 1114
385 Ga0495622_0004449 3300046557 Bacteria 6508
386 Ga0495622_0008890 3300046557 Bacteria 4654
387 Ga0495622_0155192 3300046557 Bacteria 1034
388 Ga0495622_0211096 3300046557 Bacteria 862
389 Ga0495667_0020935 3300046559 Bacteria 4412
390 Ga0495667_0030300 3300046559 Bacteria 3636
391 Ga0495667_0042926 3300046559 Bacteria 2998
392 Ga0495667_0277557 3300046559 Bacteria 1064
393 Ga0495656_0023525 3300046615 Bacteria 2425
394 Ga0495656_0060560 3300046615 Bacteria 1650
395 Ga0495668_0012203 3300046616 Bacteria 5106
396 Ga0495668_0034272 3300046616 Bacteria 2849
397 Ga0495634_0000261 3300046642 Bacteria 49735
398 Ga0495634_0021377 3300046642 Bacteria 4575
399 Ga0495634_0037057 3300046642 Bacteria 3333
400 Ga0495634_0174845 3300046642 Bacteria 1348
401 Ga0495611_0210613 3300046648 Bacteria 905
402 Ga0495625_0091563 3300046660 Bacteria 2102
403 Ga0495625_0273812 3300046660 Bacteria 1088
404 Ga0495625_0352933 3300046660 Bacteria 929
405 Ga0495635_0006062 3300046663 Bacteria 8435
406 Ga0495635_0018394 3300046663 Bacteria 4876
407 Ga0495588_0010000 3300046674 Bacteria 4398
408 Ga0495657_0011243 3300046675 Bacteria 6705
409 Ga0495599_0007860 3300046678 Bacteria 6471
410 Ga0495599_0088539 3300046678 Bacteria 1933
411 Ga0495599_0349752 3300046678 Bacteria 886
412 Ga0495623_0067061 3300046679 Bacteria 2240
413 Ga0495623_0069387 3300046679 Bacteria 2197
414 Ga0495623_0415395 3300046679 Bacteria 722
415 Ga0495646_0031838 3300046680 Bacteria 3285
416 Ga0495646_0059190 3300046680 Bacteria 2289
417 Ga0495646_0313745 3300046680 Bacteria 827
418 Ga0495647_0000500 3300046681 Bacteria 11389
419 Ga0495658_0000771 3300046683 Bacteria 17323
420 Ga0495658_0006453 3300046683 Bacteria 5763
421 Ga0495658_0314274 3300046683 Bacteria 992
422 Ga0495669_0010508 3300046684 Bacteria 3912
423 Ga0495613_0006929 3300046689 Bacteria 8453
424 Ga0495613_0015463 3300046689 Bacteria 5674
425 Ga0495613_0032505 3300046689 Bacteria 3877
426 Ga0495624_0001342 3300046690 Bacteria 19226
427 Ga0495624_0215228 3300046690 Bacteria 1165
428 Ga0495624_0276473 3300046690 Bacteria 1014
429 Ga0495589_0268182 3300046794 Bacteria 795
430 Ga0495600_0032744 3300046809 Bacteria 3373
431 Ga0495600_0059504 3300046809 Bacteria 2495
432 Ga0495600_0148292 3300046809 Bacteria 1520
433 Ga0495660_0220297 3300046810 Bacteria 895
434 Ga0495581_0000018 3300047315 Bacteria 58791
435 Ga0495581_0016589 3300047315 Bacteria 4280
436 Ga0495604_0045914 3300047317 Bacteria 3407
437 Ga0495604_0073781 3300047317 Bacteria 2574
438 Ga0495604_0211974 3300047317 Bacteria 1338
439 Ga0495674_0000134 3300047319 Bacteria 56618
440 Ga0495674_0252255 3300047319 Bacteria 1452
441 Ga0495672_0008522 3300047320 Bacteria 7550
442 Ga0495676_0034073 3300047321 Bacteria 4276
443 Ga0495676_0347515 3300047321 Bacteria 992
444 Ga0495680_0031781 3300047322 Bacteria 4292
445 Ga0495675_0016169 3300047444 Bacteria 4718
446 Ga0495685_042713 3300047447 Bacteria 1547
447 Ga0495684_0013146 3300047471 Bacteria 6387
448 Ga0495684_0035829 3300047471 Bacteria 3805
449 Ga0495686_0237691 3300047472 Bacteria 1029
450 Ga0495593_0000072 3300047673 Bacteria 43039
451 Ga0495593_0000594 3300047673 Bacteria 20595
452 Ga0495593_0032448 3300047673 Bacteria 2847
453 Ga0495593_0103318 3300047673 Bacteria 1460
454 Ga0495593_0251518 3300047673 Bacteria 885
455 Ga0496101_0187462 3300048904 Bacteria 1595
456 Ga0496102_0407294 3300048905 Bacteria 1278
457 Ga0496102_0860033 3300048905 Bacteria 829
458 Ga0496103_0029706 3300048906 Bacteria 3323
459 Ga0496106_0007422 3300048909 Bacteria 8101
460 Ga0496106_0101809 3300048909 Bacteria 2228
461 Ga0496106_0252906 3300048909 Bacteria 1409
462 Ga0496106_0488955 3300048909 Bacteria 989
463 Ga0496107_0029943 3300048910 Bacteria 3877
464 Ga0496107_0274032 3300048910 Bacteria 1256
465 Ga0496108_0438969 3300048911 Bacteria 1140
466 Ga0496110_0477090 3300048913 Bacteria 1136
467 Ga0496112_0075692 3300048915 Bacteria 3329
468 Ga0496114_0106185 3300048917 Bacteria 2403
469 Ga0496114_0291857 3300048917 Bacteria 1439
470 Ga0496114_0403821 3300048917 Bacteria 1210
471 Ga0496115_0017903 3300048918 Bacteria 5428
472 Ga0496115_0045996 3300048918 Bacteria 3486
473 Ga0496115_0248022 3300048918 Bacteria 1467
474 Ga0496115_0436732 3300048918 Bacteria 1059
475 Ga0496116_0305297 3300048919 Bacteria 755
476 Ga0496117_0037310 3300048920 Bacteria 3622
477 Ga0496117_0037409 3300048920 Bacteria 3615
478 Ga0496118_0003042 3300048921 Bacteria 21608
479 Ga0496118_0035533 3300048921 Bacteria 4044
480 Ga0496120_0091510 3300048923 Bacteria 1624
481 Ga0496121_0000091 3300048924 Bacteria 216685
482 Ga0496121_0000716 3300048924 Bacteria 61451
483 Ga0496121_0005545 3300048924 Bacteria 16120
484 Ga0496121_0019090 3300048924 Bacteria 6876
485 Ga0496121_0040476 3300048924 Bacteria 4087
486 Ga0496121_0041274 3300048924 Bacteria 4035
487 Ga0496121_0353043 3300048924 Bacteria 979
488 Ga0496121_0553768 3300048924 Bacteria 719
489 Ga0496124_0012598 3300048927 Bacteria 8323
490 Ga0496124_0257753 3300048927 Bacteria 1286
491 Ga0496125_0000048 3300048928 Bacteria 290651
492 Ga0496125_0000746 3300048928 Bacteria 53671
493 Ga0496125_0013770 3300048928 Bacteria 7926
494 Ga0496126_0004591 3300048929 Bacteria 16376
495 Ga0496126_0005693 3300048929 Bacteria 14121
496 Ga0496126_0021180 3300048929 Bacteria 6357
497 Ga0496126_0061520 3300048929 Bacteria 3372
498 Ga0496126_0129801 3300048929 Bacteria 2179
499 Ga0496126_0174464 3300048929 Bacteria 1829
500 Ga0495682_0134228 3300049460 Bacteria 885
501 Ga0501031_0096761 3300049568 Bacteria 1926
502 Ga0501032_0031733 3300049569 Bacteria 3621
503 Ga0501032_0215846 3300049569 Bacteria 1249
504 Ga0501033_0068962 3300049570 Bacteria 2599
505 Ga0501034_0454308 3300049571 Bacteria 1198
506 Ga0501036_0070794 3300049572 Bacteria 2949
507 Ga0501036_0310787 3300049572 Bacteria 1318
508 Ga0501037_0014354 3300049573 Bacteria 5833
509 Ga0501037_0192717 3300049573 Bacteria 1442
510 Ga0501038_0000621 3300049574 Bacteria 31613
511 Ga0501038_0086836 3300049574 Bacteria 2627
512 Ga0501038_0199039 3300049574 Bacteria 1608
513 Ga0501039_0096527 3300049575 Bacteria 2304
514 Ga0501040_0043042 3300049576 Bacteria 3077
515 Ga0501042_0098853 3300049578 Bacteria 2098
516 Ga0501043_0090823 3300049579 Bacteria 2401
517 Ga0501043_0269462 3300049579 Bacteria 1307
518 Ga0501046_0025427 3300049580 Bacteria 4845
519 Ga0501047_0112228 3300049581 Bacteria 2608
520 Ga0501047_0305411 3300049581 Bacteria 1433
521 Ga0501048_0036430 3300049582 Bacteria 3536
522 Ga0501067_0087347 3300049583 Bacteria 1730
523 Ga0501068_0168483 3300049584 Bacteria 1381
524 Ga0501070_0247118 3300049586 Bacteria 1460
525 Ga0501071_0631393 3300049587 Bacteria 824
526 Ga0501072_0177268 3300049588 Bacteria 1700
527 Ga0501073_0098838 3300049589 Bacteria 2026
528 Ga0501074_0017150 3300049590 Bacteria 5253
529 Ga0501077_0093609 3300049593 Bacteria 1905
530 Ga0501079_0018245 3300049741 Bacteria 5360
531 Ga0501080_0524744 3300049742 Bacteria 1056
532 Ga0501083_0024395 3300049744 Bacteria 4189
533 Ga0501035_0125732 3300049822 Bacteria 2238
534 Ga0501044_0008922 3300049823 Bacteria 10959
535 Ga0501044_0494047 3300049823 Bacteria 1125
536 Ga0501045_0139799 3300049824 Bacteria 1800
537 nmdc:mga03n38_12566_c1 3300050490 Bacteria 3190
538 nmdc:mga06z11_303276_c1 3300050494 Bacteria 950
539 nmdc:mga06z11_320653_c1 3300050494 Bacteria 924
540 nmdc:mga04h51_48535_c1 3300050495 Bacteria 1415
541 nmdc:mga0n895_128691_c1 3300050512 Bacteria 2556
542 nmdc:mga0n895_134642_c1 3300050512 Bacteria 2497
543 nmdc:mga0rr50_370536_c1 3300050513 Bacteria 1206
544 nmdc:mga08x19_85407_c1 3300050514 Bacteria 2077
545 Ga0495601_0034250 3300053077 Bacteria 3167
546 Ga0495612_0011133 3300053078 Bacteria 3631
547 Ga0495612_0109356 3300053078 Bacteria 1182
548 Ga0500610_0100392 3300053079 Bacteria 1498
549 Ga0500635_0001063 3300053080 Bacteria 6566
550 Ga0500635_0001671 3300053080 Bacteria 5362
551 Ga0500635_0012384 3300053080 Bacteria 2448
552 Ga0495595_0000449 3300053084 Bacteria 15558
553 Ga0495619_0020998 3300053085 Bacteria 4165
554 Ga0500643_095976 3300053087 Bacteria 806
555 Ga0500651_0028614 3300053093 Bacteria 3504
556 Ga0500566_0000065 3300053094 Bacteria 50325
557 Ga0500566_0073701 3300053094 Bacteria 1913
558 Ga0500554_000253 3300053102 Bacteria 11538
559 Ga0500562_039128 3300053108 Bacteria 1260
560 Ga0500572_004849 3300053111 Bacteria 3047
561 Ga0500595_000253 3300053119 Bacteria 35306
562 Ga0500595_002443 3300053119 Bacteria 9214
563 Ga0500595_007200 3300053119 Bacteria 4635
564 Ga0500595_019169 3300053119 Bacteria 2487
565 Ga0500595_091501 3300053119 Bacteria 880
566 Ga0500608_018508 3300053122 Bacteria 3179
567 Ga0500658_0139657 3300053134 Bacteria 1086
568 Ga0500559_0068320 3300053136 Bacteria 1596
569 Ga0500561_0023415 3300053137 Bacteria 1480
570 Ga0500573_0090793 3300053140 Bacteria 1725
571 Ga0500577_0000112 3300053142 Bacteria 19856
572 Ga0500590_045923 3300053148 Bacteria 2235
573 Ga0500590_088033 3300053148 Bacteria 1513
574 Ga0500603_000158 3300053150 Bacteria 16730
575 Ga0500603_008705 3300053150 Bacteria 2258
576 Ga0500630_124419 3300053159 Bacteria 1136
577 Ga0500638_017919 3300053162 Bacteria 3296
578 Ga0500638_110194 3300053162 Bacteria 1272
579 Ga0500636_0041245 3300053177 Bacteria 2730
580 Ga0500636_0088678 3300053177 Bacteria 1774
581 Ga0500636_0346668 3300053177 Bacteria 710
582 Ga0500637_0000157 3300053178 Bacteria 24963
583 Ga0500637_0040903 3300053178 Bacteria 2619
584 Ga0500570_105258 3300053724 Bacteria 1168
585 Ga0500596_001862 3300053735 Bacteria 4240
586 Ga0500596_001994 3300053735 Bacteria 4086
587 Ga0500661_000942 3300055283 Bacteria 5444

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100356015 Ga0075428_1003560151 194
2 3300009094 Ga0111539_10121973 Ga0111539_101219732 194
3 3300035691 Ga0373931_0414396 Ga0373931_0414396_75_827 194
4 3300006051 Ga0075364_10225961 Ga0075364_102259612 199
5 3300011119 Ga0105246_10407952 Ga0105246_104079522 203
6 3300010159 Ga0099796_10044981 Ga0099796_100449812 204
7 iso_pu_bacteria 2513237096 2513658214 205
8 iso_pu_bacteria 2513237098 2513677508 205
9 iso_pu_bacteria 2513237137 2513862956 205
10 iso_pu_bacteria 2513237145 2513920294 205
11 iso_pu_bacteria 2517572143 2517889286 205
12 iso_pu_bacteria 2524023210 2524470334 205
13 iso_pu_bacteria 2791355197 2793070943 205
14 iso_pu_bacteria 2885374607 2885377931 205
15 iso_pu_bacteria 2885383462 2885392420 205
16 iso_pu_bacteria 2903748898 2903750243 205
17 iso_pu_bacteria 2903768456 2903773116 205
18 iso_pu_bacteria 2904690495 2904692521 205
19 iso_pu_bacteria 2906610324 2906613240 205
20 iso_pu_bacteria 2906635258 2906635470 205
21 iso_pu_bacteria 2906660503 2906668601 205
22 iso_pu_bacteria 2908756301 2908756789 205
23 iso_pu_bacteria 2922425934 2922433736 205
24 iso_pu_bacteria 2935630451 2935634779 205
25 iso_pu_bacteria 2941507105 2941511891 205
26 iso_pu_bacteria 2941515067 2941519593 205
27 iso_pu_bacteria 2941523033 2941527715 205
28 iso_pu_bacteria 8006933436 8006935774 205
29 iso_pu_bacteria 8006973647 8006975693 205
30 iso_pu_bacteria 8019555841 8019563020 205
31 iso_pu_bacteria 8019565922 8019573098 205
32 3300014969 Ga0157376_10431800 Ga0157376_104318002 206
33 3300046660 Ga0495625_0273812 Ga0495625_0273812_431_1075 206
34 3300049574 Ga0501038_0199039 Ga0501038_0199039_386_1039 208
35 3300049579 Ga0501043_0090823 Ga0501043_0090823_1343_1996 208
36 3300049579 Ga0501043_0269462 Ga0501043_0269462_419_1072 208
37 3300049581 Ga0501047_0112228 Ga0501047_0112228_546_1199 208
38 3300049822 Ga0501035_0125732 Ga0501035_0125732_1351_2004 208
39 3300003203 JGI25406J46586_10001070 JGI25406J46586_100010708 209
40 3300003659 JGI25404J52841_10005846 JGI25404J52841_100058462 209
41 3300005329 Ga0070683_100039979 Ga0070683_1000399792 209
42 3300005336 Ga0070680_100267135 Ga0070680_1002671352 209
43 3300005336 Ga0070680_100698008 Ga0070680_1006980081 209
44 3300005434 Ga0070709_10000732 Ga0070709_1000073217 209
45 3300005434 Ga0070709_10068699 Ga0070709_100686991 209
46 3300005434 Ga0070709_10123135 Ga0070709_101231352 209
47 3300005434 Ga0070709_10489253 Ga0070709_104892532 209
48 3300005435 Ga0070714_100010788 Ga0070714_1000107883 209
49 3300005435 Ga0070714_100130000 Ga0070714_1001300002 209
50 3300005436 Ga0070713_100004657 Ga0070713_1000046575 209
51 3300005436 Ga0070713_100053012 Ga0070713_1000530123 209
52 3300005436 Ga0070713_100089395 Ga0070713_1000893952 209
53 3300005436 Ga0070713_100128305 Ga0070713_1001283052 209
54 3300005437 Ga0070710_10004377 Ga0070710_100043774 209
55 3300005437 Ga0070710_10014128 Ga0070710_100141282 209
56 3300005439 Ga0070711_100001113 Ga0070711_1000011132 209
57 3300005458 Ga0070681_10087866 Ga0070681_100878663 209
58 3300005458 Ga0070681_10168780 Ga0070681_101687802 209
59 3300005530 Ga0070679_100396250 Ga0070679_1003962502 209
60 3300005535 Ga0070684_100021034 Ga0070684_1000210342 209
61 3300005577 Ga0068857_100059405 Ga0068857_1000594052 209
62 3300005577 Ga0068857_100420465 Ga0068857_1004204652 209
63 3300005578 Ga0068854_100511060 Ga0068854_1005110601 209
64 3300005616 Ga0068852_100786722 Ga0068852_1007867222 209
65 3300005617 Ga0068859_100132852 Ga0068859_1001328522 209
66 3300005843 Ga0068860_100000257 Ga0068860_10000025755 209
67 3300005937 Ga0081455_10010356 Ga0081455_100103567 209
68 3300005937 Ga0081455_10088422 Ga0081455_100884223 209
69 3300005983 Ga0081540_1006050 Ga0081540_10060504 209
70 3300005983 Ga0081540_1040529 Ga0081540_10405292 209
71 3300005985 Ga0081539_10000530 Ga0081539_1000053032 209
72 3300006028 Ga0070717_10168325 Ga0070717_101683252 209
73 3300006163 Ga0070715_10157171 Ga0070715_101571712 209
74 3300006173 Ga0070716_100009694 Ga0070716_1000096943 209
75 3300006173 Ga0070716_100537794 Ga0070716_1005377941 209
76 3300006175 Ga0070712_100014993 Ga0070712_1000149932 209
77 3300006871 Ga0075434_100072646 Ga0075434_1000726463 209
78 3300006914 Ga0075436_100098286 Ga0075436_1000982861 209
79 3300006931 Ga0097620_100132852 Ga0097620_1001328522 209
80 3300007076 Ga0075435_100327410 Ga0075435_1003274102 209
81 3300009093 Ga0105240_10013377 Ga0105240_100133777 209
82 3300009148 Ga0105243_10836287 Ga0105243_108362871 209
83 3300009545 Ga0105237_10005001 Ga0105237_100050012 209
84 3300009551 Ga0105238_10472193 Ga0105238_104721932 209
85 3300013105 Ga0157369_10031113 Ga0157369_100311133 209
86 3300013105 Ga0157369_10346000 Ga0157369_103460002 209
87 3300013297 Ga0157378_10134227 Ga0157378_101342272 209
88 3300014325 Ga0163163_10347324 Ga0163163_103473241 209
89 3300014325 Ga0163163_10822047 Ga0163163_108220472 209
90 3300017792 Ga0163161_10147496 Ga0163161_101474961 209
91 3300021384 Ga0213876_10296837 Ga0213876_102968371 209
92 3300025254 Ga0209148_1009224 Ga0209148_10092242 209
93 3300025261 Ga0209233_1002050 Ga0209233_10020503 209
94 3300025261 Ga0209233_1004852 Ga0209233_10048522 209
95 3300025272 Ga0209455_1005109 Ga0209455_10051092 209
96 3300025272 Ga0209455_1012118 Ga0209455_10121182 209
97 3300025898 Ga0207692_10000494 Ga0207692_1000049413 209
98 3300025898 Ga0207692_10042495 Ga0207692_100424953 209
99 3300025900 Ga0207710_10006473 Ga0207710_100064735 209
100 3300025905 Ga0207685_10069101 Ga0207685_100691012 209
101 3300025906 Ga0207699_10004161 Ga0207699_100041612 209
102 3300025906 Ga0207699_10015928 Ga0207699_100159281 209
103 3300025912 Ga0207707_10058212 Ga0207707_100582123 209
104 3300025913 Ga0207695_10028143 Ga0207695_100281434 209
105 3300025914 Ga0207671_10145683 Ga0207671_101456832 209
106 3300025915 Ga0207693_10054260 Ga0207693_100542602 209
107 3300025916 Ga0207663_10000356 Ga0207663_100003562 209
108 3300025916 Ga0207663_10056552 Ga0207663_100565523 209
109 3300025917 Ga0207660_10166299 Ga0207660_101662992 209
110 3300025917 Ga0207660_10236008 Ga0207660_102360082 209
111 3300025920 Ga0207649_10417556 Ga0207649_104175562 209
112 3300025921 Ga0207652_10997065 Ga0207652_109970651 209
113 3300025928 Ga0207700_10037768 Ga0207700_100377682 209
114 3300025928 Ga0207700_10429936 Ga0207700_104299361 209
115 3300025929 Ga0207664_10001702 Ga0207664_100017028 209
116 3300025939 Ga0207665_10560749 Ga0207665_105607491 209
117 3300025940 Ga0207691_10766584 Ga0207691_107665841 209
118 3300025944 Ga0207661_10043590 Ga0207661_100435902 209
119 3300025949 Ga0207667_10088803 Ga0207667_100888032 209
120 3300026035 Ga0207703_10389261 Ga0207703_103892612 209
121 3300026088 Ga0207641_10008809 Ga0207641_100088096 209
122 3300026116 Ga0207674_10619321 Ga0207674_106193211 209
123 3300028381 Ga0268264_10000049 Ga0268264_10000049245 209
124 3300028558 Ga0265326_10002792 Ga0265326_100027924 209
125 3300028573 Ga0265334_10003782 Ga0265334_100037824 209
126 3300028666 Ga0265336_10000430 Ga0265336_100004305 209
127 3300028794 Ga0307515_10338941 Ga0307515_103389412 209
128 3300028800 Ga0265338_10000024 Ga0265338_1000002488 209
129 3300029957 Ga0265324_10031172 Ga0265324_100311722 209
130 3300030521 Ga0307511_10100749 Ga0307511_101007492 209
131 3300031235 Ga0265330_10008045 Ga0265330_100080453 209
132 3300031507 Ga0307509_10040521 Ga0307509_100405212 209
133 3300031507 Ga0307509_10103840 Ga0307509_101038402 209
134 3300031730 Ga0307516_10013014 Ga0307516_100130142 209
135 3300031730 Ga0307516_10118051 Ga0307516_101180512 209
136 3300033179 Ga0307507_10006568 Ga0307507_100065686 209
137 3300033442 Ga0315911_1000018 Ga0315911_10000184 209
138 3300033544 Ga0316215_1001164 Ga0316215_10011642 209
139 3300035089 Ga0373944_0055378 Ga0373944_0055378_199_852 209
140 3300035111 Ga0373923_0001363 Ga0373923_0001363_4749_5402 209
141 3300035118 Ga0373954_0033492 Ga0373954_0033492_997_1650 209
142 3300035119 Ga0373956_0248536 Ga0373956_0248536_80_733 209
143 3300035120 Ga0373957_0039158 Ga0373957_0039158_1059_1712 209
144 3300035121 Ga0373960_0137412 Ga0373960_0137412_12_671 209
145 3300035171 Ga0373946_0002379 Ga0373946_0002379_4740_5393 209
146 3300035172 Ga0373955_0033444 Ga0373955_0033444_74_727 209
147 3300035410 Ga0373924_0294345 Ga0373924_0294345_27_680 209
148 3300035692 Ga0373935_0000229 Ga0373935_0000229_9854_10507 209
149 3300035692 Ga0373935_0046204 Ga0373935_0046204_1914_2567 209
150 3300035692 Ga0373935_0112353 Ga0373935_0112353_683_1336 209
151 3300035695 Ga0373927_0000071 Ga0373927_0000071_25240_25893 209
152 3300035695 Ga0373927_0063549 Ga0373927_0063549_525_1178 209
153 3300035695 Ga0373927_0466129 Ga0373927_0466129_100_753 209
154 3300035725 Ga0373947_0000540 Ga0373947_0000540_19172_19825 209
155 3300035725 Ga0373947_0069223 Ga0373947_0069223_898_1551 209
156 3300035725 Ga0373947_0143608 Ga0373947_0143608_351_1004 209
157 3300036401 Ga0373937_0313318 Ga0373937_0313318_630_1283 209
158 3300036459 Ga0372808_002837 Ga0372808_002837_1301_1954 209
159 3300037068 Ga0373925_0011299 Ga0373925_0011299_3948_4601 209
160 3300037068 Ga0373925_0154604 Ga0373925_0154604_92_745 209
161 3300037312 Ga0395899_0092631 Ga0395899_0092631_608_1261 209
162 3300037418 Ga0395900_0003234 Ga0395900_0003234_1672_2325 209
163 3300037418 Ga0395900_0430249 Ga0395900_0430249_350_1003 209
164 3300037466 Ga0395898_0003112 Ga0395898_0003112_7989_8642 209
165 3300038443 Ga0395901_0052714 Ga0395901_0052714_741_1394 209
166 3300039437 Ga0436365_1026947 Ga0436365_1026947_289_942 209
167 3300041486 Ga0451807_0166552 Ga0451807_0166552_138_791 209
168 3300044694 Ga0466963_0127118 Ga0466963_0127118_208_861 209
169 3300044842 Ga0466957_0026692 Ga0466957_0026692_2202_2855 209
170 3300045049 Ga0466959_0095788 Ga0466959_0095788_684_1337 209
171 3300045976 Ga0466967_1136960 Ga0466967_1136960_115_768 209
172 3300046454 Ga0495592_0011328 Ga0495592_0011328_1058_1711 209
173 3300046455 Ga0495603_0000035 Ga0495603_0000035_21602_22255 209
174 3300046459 Ga0495629_0000081 Ga0495629_0000081_58839_59492 209
175 3300046459 Ga0495629_0043007 Ga0495629_0043007_2151_2804 209
176 3300046461 Ga0495641_0003571 Ga0495641_0003571_5501_6154 209
177 3300046472 Ga0495580_0007845 Ga0495580_0007845_1837_2490 209
178 3300046473 Ga0495582_0000235 Ga0495582_0000235_6669_7322 209
179 3300046475 Ga0495639_0000010 Ga0495639_0000010_17496_18149 209
180 3300046475 Ga0495639_0008724 Ga0495639_0008724_2490_3143 209
181 3300046476 Ga0495662_0003600 Ga0495662_0003600_1175_1828 209
182 3300046477 Ga0495664_0003381 Ga0495664_0003381_308_961 209
183 3300046477 Ga0495664_0127817 Ga0495664_0127817_162_815 209
184 3300046477 Ga0495664_0195603 Ga0495664_0195603_532_1185 209
185 3300046499 Ga0495594_0045839 Ga0495594_0045839_597_1250 209
186 3300046511 Ga0495608_0095113 Ga0495608_0095113_28_681 209
187 3300046514 Ga0495618_0029014 Ga0495618_0029014_1651_2304 209
188 3300046514 Ga0495618_0072387 Ga0495618_0072387_459_1112 209
189 3300046516 Ga0495628_0050808 Ga0495628_0050808_2532_3185 209
190 3300046517 Ga0495630_0003778 Ga0495630_0003778_3932_4585 209
191 3300046517 Ga0495630_0021706 Ga0495630_0021706_2887_3540 209
192 3300046524 Ga0495648_0118560 Ga0495648_0118560_477_1130 209
193 3300046526 Ga0495666_0041695 Ga0495666_0041695_1216_1869 209
194 3300046526 Ga0495666_0046722 Ga0495666_0046722_1107_1760 209
195 3300046529 Ga0495652_0027318 Ga0495652_0027318_2140_2793 209
196 3300046529 Ga0495652_0413290 Ga0495652_0413290_228_881 209
197 3300046531 Ga0495665_0000005 Ga0495665_0000005_4623_5276 209
198 3300046533 Ga0495640_0006942 Ga0495640_0006942_5620_6273 209
199 3300046533 Ga0495640_0010386 Ga0495640_0010386_2151_2804 209
200 3300046535 Ga0495586_0028532 Ga0495586_0028532_36_689 209
201 3300046536 Ga0495587_0107421 Ga0495587_0107421_60_713 209
202 3300046536 Ga0495587_0200318 Ga0495587_0200318_359_1012 209
203 3300046543 Ga0495645_0033977 Ga0495645_0033977_1513_2166 209
204 3300046543 Ga0495645_0210646 Ga0495645_0210646_364_1017 209
205 3300046543 Ga0495645_0273510 Ga0495645_0273510_276_929 209
206 3300046557 Ga0495622_0004449 Ga0495622_0004449_3874_4527 209
207 3300046557 Ga0495622_0008890 Ga0495622_0008890_3068_3721 209
208 3300046559 Ga0495667_0030300 Ga0495667_0030300_2917_3570 209
209 3300046559 Ga0495667_0042926 Ga0495667_0042926_322_975 209
210 3300046642 Ga0495634_0000261 Ga0495634_0000261_20978_21631 209
211 3300046642 Ga0495634_0037057 Ga0495634_0037057_100_753 209
212 3300046642 Ga0495634_0174845 Ga0495634_0174845_393_1046 209
213 3300046663 Ga0495635_0006062 Ga0495635_0006062_1431_2084 209
214 3300046678 Ga0495599_0349752 Ga0495599_0349752_211_864 209
215 3300046679 Ga0495623_0069387 Ga0495623_0069387_822_1475 209
216 3300046679 Ga0495623_0415395 Ga0495623_0415395_26_679 209
217 3300046680 Ga0495646_0031838 Ga0495646_0031838_2099_2752 209
218 3300046680 Ga0495646_0313745 Ga0495646_0313745_93_746 209
219 3300046681 Ga0495647_0000500 Ga0495647_0000500_7182_7835 209
220 3300046683 Ga0495658_0000771 Ga0495658_0000771_2101_2754 209
221 3300046683 Ga0495658_0006453 Ga0495658_0006453_109_762 209
222 3300046689 Ga0495613_0006929 Ga0495613_0006929_2260_2913 209
223 3300046690 Ga0495624_0001342 Ga0495624_0001342_1457_2110 209
224 3300046690 Ga0495624_0215228 Ga0495624_0215228_399_1052 209
225 3300046809 Ga0495600_0032744 Ga0495600_0032744_441_1094 209
226 3300047315 Ga0495581_0000018 Ga0495581_0000018_19880_20533 209
227 3300047315 Ga0495581_0016589 Ga0495581_0016589_1106_1759 209
228 3300047317 Ga0495604_0073781 Ga0495604_0073781_1421_2074 209
229 3300047317 Ga0495604_0211974 Ga0495604_0211974_497_1150 209
230 3300047319 Ga0495674_0000134 Ga0495674_0000134_6258_6911 209
231 3300047319 Ga0495674_0252255 Ga0495674_0252255_205_858 209
232 3300047321 Ga0495676_0034073 Ga0495676_0034073_2181_2834 209
233 3300047471 Ga0495684_0035829 Ga0495684_0035829_1512_2165 209
234 3300047673 Ga0495593_0000072 Ga0495593_0000072_24420_25073 209
235 3300047673 Ga0495593_0032448 Ga0495593_0032448_110_763 209
236 3300048905 Ga0496102_0860033 Ga0496102_0860033_101_754 209
237 3300048906 Ga0496103_0029706 Ga0496103_0029706_1110_1763 209
238 3300048909 Ga0496106_0007422 Ga0496106_0007422_3815_4468 209
239 3300048919 Ga0496116_0305297 Ga0496116_0305297_60_713 209
240 3300048920 Ga0496117_0037310 Ga0496117_0037310_1538_2191 209
241 3300048920 Ga0496117_0037409 Ga0496117_0037409_2629_3282 209
242 3300048921 Ga0496118_0003042 Ga0496118_0003042_3618_4271 209
243 3300048921 Ga0496118_0035533 Ga0496118_0035533_144_797 209
244 3300048923 Ga0496120_0091510 Ga0496120_0091510_282_935 209
245 3300048924 Ga0496121_0000716 Ga0496121_0000716_3679_4332 209
246 3300048924 Ga0496121_0005545 Ga0496121_0005545_14741_15394 209
247 3300048924 Ga0496121_0019090 Ga0496121_0019090_1610_2263 209
248 3300048924 Ga0496121_0041274 Ga0496121_0041274_1289_1942 209
249 3300048924 Ga0496121_0553768 Ga0496121_0553768_41_694 209
250 3300048927 Ga0496124_0012598 Ga0496124_0012598_3266_3919 209
251 3300048928 Ga0496125_0000048 Ga0496125_0000048_119703_120356 209
252 3300048928 Ga0496125_0000746 Ga0496125_0000746_6245_6898 209
253 3300048928 Ga0496125_0013770 Ga0496125_0013770_4804_5457 209
254 3300048929 Ga0496126_0005693 Ga0496126_0005693_3488_4141 209
255 3300049460 Ga0495682_0134228 Ga0495682_0134228_26_679 209
256 3300049581 Ga0501047_0305411 Ga0501047_0305411_98_751 209
257 3300050512 nmdc:mga0n895_128691_c1 nmdc:mga0n895_128691_c1_239_898 209
258 3300050512 nmdc:mga0n895_134642_c1 nmdc:mga0n895_134642_c1_633_1286 209
259 3300050513 nmdc:mga0rr50_370536_c1 nmdc:mga0rr50_370536_c1_190_849 209
260 3300050514 nmdc:mga08x19_85407_c1 nmdc:mga08x19_85407_c1_253_906 209
261 3300053078 Ga0495612_0011133 Ga0495612_0011133_1897_2550 209
262 3300053080 Ga0500635_0012384 Ga0500635_0012384_801_1454 209
263 3300053093 Ga0500651_0028614 Ga0500651_0028614_56_709 209
264 3300053094 Ga0500566_0073701 Ga0500566_0073701_1173_1826 209
265 3300053119 Ga0500595_002443 Ga0500595_002443_3893_4546 209
266 3300053119 Ga0500595_019169 Ga0500595_019169_1602_2255 209
267 3300053119 Ga0500595_091501 Ga0500595_091501_217_870 209
268 3300053134 Ga0500658_0139657 Ga0500658_0139657_19_684 209
269 3300053136 Ga0500559_0068320 Ga0500559_0068320_718_1371 209
270 3300053140 Ga0500573_0090793 Ga0500573_0090793_978_1631 209
271 3300053142 Ga0500577_0000112 Ga0500577_0000112_4313_4966 209
272 3300053148 Ga0500590_045923 Ga0500590_045923_1109_1762 209
273 3300053162 Ga0500638_110194 Ga0500638_110194_131_784 209
274 3300053177 Ga0500636_0346668 Ga0500636_0346668_27_680 209
275 3300053178 Ga0500637_0040903 Ga0500637_0040903_1165_1818 209
276 3300053724 Ga0500570_105258 Ga0500570_105258_141_794 209
277 3300053735 Ga0500596_001994 Ga0500596_001994_559_1212 209
278 3300037418 Ga0395900_0131044 Ga0395900_0131044_1795_2460 210
279 3300037471 Ga0395905_0059181 Ga0395905_0059181_1881_2546 210
280 3300038443 Ga0395901_0234804 Ga0395901_0234804_1129_1794 210
281 iso_pu_bacteria 2721755755 2723842008 210
282 iso_pu_bacteria 2791355199 2793077443 210
283 iso_pu_bacteria 8006964411 8006968294 210
284 iso_pu_bacteria 8006994254 8007000224 210
285 3300005844 Ga0068862_100177207 Ga0068862_1001772072 211
286 3300025972 Ga0207668_10234194 Ga0207668_102341942 211
287 3300028380 Ga0268265_10195946 Ga0268265_101959462 211
288 3300028786 Ga0307517_10002211 Ga0307517_1000221121 211
289 3300028786 Ga0307517_10301388 Ga0307517_103013881 211
290 3300031456 Ga0307513_10547723 Ga0307513_105477232 211
291 3300049572 Ga0501036_0310787 Ga0501036_0310787_551_1225 211
292 3300049578 Ga0501042_0098853 Ga0501042_0098853_1342_2016 211
293 3300049587 Ga0501071_0631393 Ga0501071_0631393_98_772 211
294 3300005548 Ga0070665_100401617 Ga0070665_1004016172 212
295 3300005615 Ga0070702_100032706 Ga0070702_1000327061 212
296 3300006038 Ga0075365_10027944 Ga0075365_100279442 212
297 3300006844 Ga0075428_100125716 Ga0075428_1001257162 212
298 3300009147 Ga0114129_10078084 Ga0114129_100780843 212
299 3300031507 Ga0307509_10241750 Ga0307509_102417502 212
300 3300033180 Ga0307510_10020522 Ga0307510_100205223 212
301 3300046452 Ga0495617_004269 Ga0495617_004269_3830_4561 212
302 3300046507 Ga0495606_0231448 Ga0495606_0231448_43_774 212
303 3300046512 Ga0495610_0044581 Ga0495610_0044581_1258_1989 212
304 3300046538 Ga0495609_0014031 Ga0495609_0014031_1467_2198 212
305 3300046557 Ga0495622_0211096 Ga0495622_0211096_71_802 212
306 3300046615 Ga0495656_0060560 Ga0495656_0060560_359_1090 212
307 3300046616 Ga0495668_0034272 Ga0495668_0034272_579_1310 212
308 3300046810 Ga0495660_0220297 Ga0495660_0220297_16_747 212
309 3300048924 Ga0496121_0040476 Ga0496121_0040476_3167_3841 212
310 3300048929 Ga0496126_0004591 Ga0496126_0004591_14536_15210 212
311 3300053119 Ga0500595_007200 Ga0500595_007200_379_1110 212
312 3300053137 Ga0500561_0023415 Ga0500561_0023415_417_1148 212
313 iso_pu_bacteria 8006984368 8006985971 212
314 3300005334 Ga0068869_100645658 Ga0068869_1006456581 213
315 3300005336 Ga0070680_100097862 Ga0070680_1000978622 213
316 3300005337 Ga0070682_100140230 Ga0070682_1001402302 213
317 3300005339 Ga0070660_100015135 Ga0070660_1000151353 213
318 3300005341 Ga0070691_10028127 Ga0070691_100281272 213
319 3300005345 Ga0070692_10108039 Ga0070692_101080392 213
320 3300005347 Ga0070668_100124669 Ga0070668_1001246692 213
321 3300005355 Ga0070671_100376557 Ga0070671_1003765571 213
322 3300005356 Ga0070674_100021497 Ga0070674_1000214972 213
323 3300005366 Ga0070659_100061934 Ga0070659_1000619341 213
324 3300005366 Ga0070659_100566076 Ga0070659_1005660762 213
325 3300005435 Ga0070714_100056936 Ga0070714_1000569362 213
326 3300005435 Ga0070714_100558377 Ga0070714_1005583772 213
327 3300005436 Ga0070713_100310531 Ga0070713_1003105312 213
328 3300005437 Ga0070710_10167727 Ga0070710_101677272 213
329 3300005455 Ga0070663_100015495 Ga0070663_1000154953 213
330 3300005457 Ga0070662_100029453 Ga0070662_1000294531 213
331 3300005468 Ga0070707_100062897 Ga0070707_1000628973 213
332 3300005471 Ga0070698_100083348 Ga0070698_1000833483 213
333 3300005530 Ga0070679_100023653 Ga0070679_1000236532 213
334 3300005535 Ga0070684_100008002 Ga0070684_1000080023 213
335 3300005536 Ga0070697_100031162 Ga0070697_1000311621 213
336 3300005536 Ga0070697_100062812 Ga0070697_1000628122 213
337 3300005536 Ga0070697_100165141 Ga0070697_1001651411 213
338 3300005539 Ga0068853_100034017 Ga0068853_1000340173 213
339 3300005539 Ga0068853_100127126 Ga0068853_1001271262 213
340 3300005543 Ga0070672_100042288 Ga0070672_1000422881 213
341 3300005547 Ga0070693_100096847 Ga0070693_1000968472 213
342 3300005563 Ga0068855_100012487 Ga0068855_1000124872 213
343 3300005563 Ga0068855_100052929 Ga0068855_1000529291 213
344 3300005577 Ga0068857_100023914 Ga0068857_1000239143 213
345 3300005578 Ga0068854_100376662 Ga0068854_1003766622 213
346 3300005614 Ga0068856_100928639 Ga0068856_1009286391 213
347 3300005616 Ga0068852_100002923 Ga0068852_1000029235 213
348 3300005616 Ga0068852_100048949 Ga0068852_1000489493 213
349 3300005718 Ga0068866_10026038 Ga0068866_100260382 213
350 3300005719 Ga0068861_100031166 Ga0068861_1000311663 213
351 3300005983 Ga0081540_1006692 Ga0081540_10066925 213
352 3300006042 Ga0075368_10029829 Ga0075368_100298292 213
353 3300006173 Ga0070716_100012248 Ga0070716_1000122482 213
354 3300006175 Ga0070712_100141682 Ga0070712_1001416823 213
355 3300006175 Ga0070712_100470155 Ga0070712_1004701552 213
356 3300006186 Ga0075369_10049606 Ga0075369_100496062 213
357 3300006881 Ga0068865_100148872 Ga0068865_1001488722 213
358 3300007265 Ga0099794_10034843 Ga0099794_100348432 213
359 3300007265 Ga0099794_10038540 Ga0099794_100385403 213
360 3300007788 Ga0099795_10037570 Ga0099795_100375702 213
361 3300007788 Ga0099795_10090904 Ga0099795_100909042 213
362 3300009093 Ga0105240_10009432 Ga0105240_100094322 213
363 3300009093 Ga0105240_10027328 Ga0105240_100273283 213
364 3300009098 Ga0105245_10023002 Ga0105245_100230023 213
365 3300009148 Ga0105243_10036413 Ga0105243_100364132 213
366 3300009148 Ga0105243_11101531 Ga0105243_111015311 213
367 3300009174 Ga0105241_10141400 Ga0105241_101414002 213
368 3300009177 Ga0105248_10008995 Ga0105248_100089957 213
369 3300009177 Ga0105248_10175028 Ga0105248_101750282 213
370 3300009545 Ga0105237_10012543 Ga0105237_100125439 213
371 3300009551 Ga0105238_10011156 Ga0105238_100111567 213
372 3300009553 Ga0105249_10032742 Ga0105249_100327422 213
373 3300010159 Ga0099796_10078459 Ga0099796_100784592 213
374 3300010375 Ga0105239_10004474 Ga0105239_1000447410 213
375 3300010375 Ga0105239_10819732 Ga0105239_108197322 213
376 3300010375 Ga0105239_10968208 Ga0105239_109682082 213
377 3300013105 Ga0157369_10009146 Ga0157369_100091463 213
378 3300013105 Ga0157369_10267128 Ga0157369_102671282 213
379 3300013308 Ga0157375_10033840 Ga0157375_100338402 213
380 3300014326 Ga0157380_10131962 Ga0157380_101319622 213
381 3300014968 Ga0157379_10149767 Ga0157379_101497672 213
382 3300017792 Ga0163161_10047181 Ga0163161_100471812 213
383 3300017792 Ga0163161_10108055 Ga0163161_101080552 213
384 3300021384 Ga0213876_10000991 Ga0213876_100009914 213
385 3300025321 Ga0207656_10062872 Ga0207656_100628722 213
386 3300025901 Ga0207688_10130340 Ga0207688_101303401 213
387 3300025907 Ga0207645_10065263 Ga0207645_100652632 213
388 3300025911 Ga0207654_10203702 Ga0207654_102037022 213
389 3300025912 Ga0207707_10043500 Ga0207707_100435002 213
390 3300025913 Ga0207695_10020475 Ga0207695_100204755 213
391 3300025915 Ga0207693_10007348 Ga0207693_100073482 213
392 3300025917 Ga0207660_10026709 Ga0207660_100267092 213
393 3300025919 Ga0207657_10006056 Ga0207657_100060562 213
394 3300025919 Ga0207657_10117003 Ga0207657_101170032 213
395 3300025921 Ga0207652_10018674 Ga0207652_100186743 213
396 3300025922 Ga0207646_10057962 Ga0207646_100579622 213
397 3300025922 Ga0207646_10628179 Ga0207646_106281791 213
398 3300025924 Ga0207694_10015674 Ga0207694_100156742 213
399 3300025927 Ga0207687_10050362 Ga0207687_100503621 213
400 3300025928 Ga0207700_10336598 Ga0207700_103365981 213
401 3300025929 Ga0207664_10309465 Ga0207664_103094652 213
402 3300025933 Ga0207706_10359974 Ga0207706_103599742 213
403 3300025934 Ga0207686_10345406 Ga0207686_103454062 213
404 3300025937 Ga0207669_10005920 Ga0207669_100059203 213
405 3300025938 Ga0207704_10027636 Ga0207704_100276362 213
406 3300025939 Ga0207665_10033184 Ga0207665_100331842 213
407 3300025940 Ga0207691_10091254 Ga0207691_100912542 213
408 3300025944 Ga0207661_10012674 Ga0207661_100126742 213
409 3300025949 Ga0207667_10011217 Ga0207667_100112177 213
410 3300025949 Ga0207667_10435136 Ga0207667_104351362 213
411 3300025972 Ga0207668_10137570 Ga0207668_101375702 213
412 3300026023 Ga0207677_10019638 Ga0207677_100196382 213
413 3300026041 Ga0207639_10015161 Ga0207639_100151612 213
414 3300026067 Ga0207678_10073479 Ga0207678_100734792 213
415 3300026067 Ga0207678_10432212 Ga0207678_104322122 213
416 3300026075 Ga0207708_10023977 Ga0207708_100239772 213
417 3300026078 Ga0207702_10000056 Ga0207702_1000005626 213
418 3300026089 Ga0207648_10058517 Ga0207648_100585172 213
419 3300026116 Ga0207674_10018427 Ga0207674_100184274 213
420 3300026142 Ga0207698_10032169 Ga0207698_100321692 213
421 3300026142 Ga0207698_10093936 Ga0207698_100939363 213
422 3300026142 Ga0207698_10810232 Ga0207698_108102321 213
423 3300027671 Ga0209588_1017686 Ga0209588_10176862 213
424 3300027671 Ga0209588_1021532 Ga0209588_10215322 213
425 3300028379 Ga0268266_10341939 Ga0268266_103419392 213
426 3300028786 Ga0307517_10349299 Ga0307517_103492991 213
427 3300031235 Ga0265330_10013923 Ga0265330_100139232 213
428 3300031235 Ga0265330_10033253 Ga0265330_100332532 213
429 3300031238 Ga0265332_10011317 Ga0265332_100113172 213
430 3300031239 Ga0265328_10146619 Ga0265328_101466192 213
431 3300031241 Ga0265325_10002005 Ga0265325_100020057 213
432 3300031247 Ga0265340_10103774 Ga0265340_101037741 213
433 3300031249 Ga0265339_10045819 Ga0265339_100458192 213
434 3300031250 Ga0265331_10021452 Ga0265331_100214523 213
435 3300031456 Ga0307513_10130648 Ga0307513_101306482 213
436 3300031616 Ga0307508_10000005 Ga0307508_10000005219 213
437 3300031616 Ga0307508_10059018 Ga0307508_100590182 213
438 3300031711 Ga0265314_10000900 Ga0265314_1000090011 213
439 3300031712 Ga0265342_10050901 Ga0265342_100509012 213
440 3300031712 Ga0265342_10070545 Ga0265342_100705452 213
441 3300031712 Ga0265342_10330904 Ga0265342_103309041 213
442 3300031730 Ga0307516_10245238 Ga0307516_102452382 213
443 3300032002 Ga0307416_100174939 Ga0307416_1001749392 213
444 3300032126 Ga0307415_100160604 Ga0307415_1001606042 213
445 3300033180 Ga0307510_10068511 Ga0307510_100685112 213
446 3300035086 Ga0373934_0006395 Ga0373934_0006395_2458_3132 213
447 3300035088 Ga0373940_0020359 Ga0373940_0020359_141_815 213
448 3300035092 Ga0373952_0067162 Ga0373952_0067162_77_751 213
449 3300035117 Ga0373953_0008643 Ga0373953_0008643_455_1129 213
450 3300035118 Ga0373954_0005748 Ga0373954_0005748_2243_2917 213
451 3300035119 Ga0373956_0003734 Ga0373956_0003734_2385_3059 213
452 3300035120 Ga0373957_0001574 Ga0373957_0001574_2097_2771 213
453 3300035171 Ga0373946_0054265 Ga0373946_0054265_276_950 213
454 3300035172 Ga0373955_0003197 Ga0373955_0003197_4047_4721 213
455 3300035410 Ga0373924_0002150 Ga0373924_0002150_3768_4442 213
456 3300035692 Ga0373935_0427797 Ga0373935_0427797_113_898 213
457 3300035695 Ga0373927_0004081 Ga0373927_0004081_5168_5842 213
458 3300035695 Ga0373927_0035793 Ga0373927_0035793_2455_3129 213
459 3300035695 Ga0373927_0146282 Ga0373927_0146282_684_1358 213
460 3300035695 Ga0373927_0164629 Ga0373927_0164629_700_1374 213
461 3300035724 Ga0373933_0000114 Ga0373933_0000114_3097_3771 213
462 3300035724 Ga0373933_0001425 Ga0373933_0001425_11107_11781 213
463 3300035725 Ga0373947_0001708 Ga0373947_0001708_4313_4987 213
464 3300035725 Ga0373947_0011676 Ga0373947_0011676_4006_4680 213
465 3300035725 Ga0373947_0295532 Ga0373947_0295532_151_825 213
466 3300036401 Ga0373937_0025351 Ga0373937_0025351_2206_2880 213
467 3300036401 Ga0373937_0083156 Ga0373937_0083156_321_995 213
468 3300037068 Ga0373925_0015901 Ga0373925_0015901_4476_5150 213
469 3300037068 Ga0373925_0024578 Ga0373925_0024578_2866_3651 213
470 3300037068 Ga0373925_0025137 Ga0373925_0025137_633_1307 213
471 3300037068 Ga0373925_0039338 Ga0373925_0039338_2474_3148 213
472 3300037471 Ga0395905_0319599 Ga0395905_0319599_442_1116 213
473 3300039437 Ga0436365_0650112 Ga0436365_0650112_39633_40316 213
474 3300039453 Ga0436362_0790756 Ga0436362_0790756_623_1306 213
475 3300041456 Ga0451795_0646620 Ga0451795_0646620_51_725 213
476 3300046454 Ga0495592_0035153 Ga0495592_0035153_2466_3140 213
477 3300046455 Ga0495603_0012240 Ga0495603_0012240_497_1171 213
478 3300046455 Ga0495603_0214493 Ga0495603_0214493_73_858 213
479 3300046459 Ga0495629_0002236 Ga0495629_0002236_11800_12474 213
480 3300046459 Ga0495629_0419301 Ga0495629_0419301_138_881 213
481 3300046459 Ga0495629_0509716 Ga0495629_0509716_121_801 213
482 3300046461 Ga0495641_0119489 Ga0495641_0119489_236_910 213
483 3300046462 Ga0495651_0033024 Ga0495651_0033024_890_1564 213
484 3300046462 Ga0495651_0107370 Ga0495651_0107370_1275_1949 213
485 3300046463 Ga0495653_0021802 Ga0495653_0021802_2455_3129 213
486 3300046473 Ga0495582_0186347 Ga0495582_0186347_40_714 213
487 3300046473 Ga0495582_0299611 Ga0495582_0299611_53_838 213
488 3300046476 Ga0495662_0110847 Ga0495662_0110847_350_1024 213
489 3300046511 Ga0495608_0037291 Ga0495608_0037291_805_1479 213
490 3300046514 Ga0495618_0193470 Ga0495618_0193470_204_878 213
491 3300046516 Ga0495628_0018214 Ga0495628_0018214_2408_3082 213
492 3300046517 Ga0495630_0142515 Ga0495630_0142515_456_1130 213
493 3300046519 Ga0495632_0160759 Ga0495632_0160759_193_867 213
494 3300046523 Ga0495644_0016803 Ga0495644_0016803_836_1588 213
495 3300046524 Ga0495648_0005171 Ga0495648_0005171_3678_4352 213
496 3300046529 Ga0495652_0023860 Ga0495652_0023860_2477_3151 213
497 3300046533 Ga0495640_0004314 Ga0495640_0004314_4079_4753 213
498 3300046533 Ga0495640_0415723 Ga0495640_0415723_58_732 213
499 3300046536 Ga0495587_0032742 Ga0495587_0032742_1790_2464 213
500 3300046543 Ga0495645_0005858 Ga0495645_0005858_6076_6750 213
501 3300046557 Ga0495622_0155192 Ga0495622_0155192_291_965 213
502 3300046559 Ga0495667_0020935 Ga0495667_0020935_1273_1947 213
503 3300046559 Ga0495667_0277557 Ga0495667_0277557_198_872 213
504 3300046615 Ga0495656_0023525 Ga0495656_0023525_601_1344 213
505 3300046616 Ga0495668_0012203 Ga0495668_0012203_4342_5028 213
506 3300046642 Ga0495634_0021377 Ga0495634_0021377_3239_3913 213
507 3300046648 Ga0495611_0210613 Ga0495611_0210613_16_690 213
508 3300046660 Ga0495625_0091563 Ga0495625_0091563_280_954 213
509 3300046660 Ga0495625_0352933 Ga0495625_0352933_186_860 213
510 3300046663 Ga0495635_0018394 Ga0495635_0018394_2413_3087 213
511 3300046674 Ga0495588_0010000 Ga0495588_0010000_3553_4227 213
512 3300046675 Ga0495657_0011243 Ga0495657_0011243_3549_4223 213
513 3300046678 Ga0495599_0007860 Ga0495599_0007860_2057_2731 213
514 3300046678 Ga0495599_0088539 Ga0495599_0088539_778_1452 213
515 3300046679 Ga0495623_0067061 Ga0495623_0067061_890_1564 213
516 3300046680 Ga0495646_0059190 Ga0495646_0059190_1289_1963 213
517 3300046683 Ga0495658_0314274 Ga0495658_0314274_167_952 213
518 3300046684 Ga0495669_0010508 Ga0495669_0010508_280_1032 213
519 3300046689 Ga0495613_0015463 Ga0495613_0015463_4160_4834 213
520 3300046689 Ga0495613_0032505 Ga0495613_0032505_843_1517 213
521 3300046690 Ga0495624_0276473 Ga0495624_0276473_144_818 213
522 3300046794 Ga0495589_0268182 Ga0495589_0268182_26_778 213
523 3300046809 Ga0495600_0059504 Ga0495600_0059504_677_1351 213
524 3300046809 Ga0495600_0148292 Ga0495600_0148292_245_919 213
525 3300047317 Ga0495604_0045914 Ga0495604_0045914_677_1351 213
526 3300047320 Ga0495672_0008522 Ga0495672_0008522_3237_3911 213
527 3300047321 Ga0495676_0347515 Ga0495676_0347515_156_941 213
528 3300047322 Ga0495680_0031781 Ga0495680_0031781_2474_3148 213
529 3300047444 Ga0495675_0016169 Ga0495675_0016169_805_1479 213
530 3300047447 Ga0495685_042713 Ga0495685_042713_76_819 213
531 3300047471 Ga0495684_0013146 Ga0495684_0013146_3240_3914 213
532 3300047472 Ga0495686_0237691 Ga0495686_0237691_240_983 213
533 3300047673 Ga0495593_0000594 Ga0495593_0000594_17445_18119 213
534 3300047673 Ga0495593_0103318 Ga0495593_0103318_385_1128 213
535 3300047673 Ga0495593_0251518 Ga0495593_0251518_102_776 213
536 3300048904 Ga0496101_0187462 Ga0496101_0187462_157_831 213
537 3300048905 Ga0496102_0407294 Ga0496102_0407294_167_919 213
538 3300048909 Ga0496106_0101809 Ga0496106_0101809_301_975 213
539 3300048909 Ga0496106_0252906 Ga0496106_0252906_285_1037 213
540 3300048909 Ga0496106_0488955 Ga0496106_0488955_279_974 213
541 3300048910 Ga0496107_0029943 Ga0496107_0029943_51_746 213
542 3300048910 Ga0496107_0274032 Ga0496107_0274032_338_1012 213
543 3300048911 Ga0496108_0438969 Ga0496108_0438969_37_711 213
544 3300048913 Ga0496110_0477090 Ga0496110_0477090_84_827 213
545 3300048915 Ga0496112_0075692 Ga0496112_0075692_508_1182 213
546 3300048917 Ga0496114_0106185 Ga0496114_0106185_976_1650 213
547 3300048917 Ga0496114_0291857 Ga0496114_0291857_68_742 213
548 3300048917 Ga0496114_0403821 Ga0496114_0403821_335_1087 213
549 3300048918 Ga0496115_0017903 Ga0496115_0017903_2685_3359 213
550 3300048918 Ga0496115_0045996 Ga0496115_0045996_323_997 213
551 3300048918 Ga0496115_0248022 Ga0496115_0248022_742_1416 213
552 3300048918 Ga0496115_0436732 Ga0496115_0436732_228_902 213
553 3300048924 Ga0496121_0000091 Ga0496121_0000091_192644_193318 213
554 3300048924 Ga0496121_0353043 Ga0496121_0353043_80_763 213
555 3300048927 Ga0496124_0257753 Ga0496124_0257753_445_1119 213
556 3300048929 Ga0496126_0021180 Ga0496126_0021180_2462_3136 213
557 3300048929 Ga0496126_0061520 Ga0496126_0061520_2513_3187 213
558 3300048929 Ga0496126_0129801 Ga0496126_0129801_128_802 213
559 3300048929 Ga0496126_0174464 Ga0496126_0174464_729_1403 213
560 3300049573 Ga0501037_0014354 Ga0501037_0014354_3558_4271 213
561 3300049583 Ga0501067_0087347 Ga0501067_0087347_279_983 213
562 3300050490 nmdc:mga03n38_12566_c1 nmdc:mga03n38_12566_c1_1270_1944 213
563 3300050494 nmdc:mga06z11_303276_c1 nmdc:mga06z11_303276_c1_122_796 213
564 3300050494 nmdc:mga06z11_320653_c1 nmdc:mga06z11_320653_c1_101_775 213
565 3300050495 nmdc:mga04h51_48535_c1 nmdc:mga04h51_48535_c1_145_819 213
566 3300053077 Ga0495601_0034250 Ga0495601_0034250_22_696 213
567 3300053078 Ga0495612_0109356 Ga0495612_0109356_52_726 213
568 3300053079 Ga0500610_0100392 Ga0500610_0100392_729_1403 213
569 3300053080 Ga0500635_0001063 Ga0500635_0001063_2875_3549 213
570 3300053080 Ga0500635_0001671 Ga0500635_0001671_2258_2932 213
571 3300053084 Ga0495595_0000449 Ga0495595_0000449_4978_5652 213
572 3300053085 Ga0495619_0020998 Ga0495619_0020998_2474_3148 213
573 3300053087 Ga0500643_095976 Ga0500643_095976_106_792 213
574 3300053094 Ga0500566_0000065 Ga0500566_0000065_41894_42568 213
575 3300053102 Ga0500554_000253 Ga0500554_000253_5830_6504 213
576 3300053108 Ga0500562_039128 Ga0500562_039128_118_861 213
577 3300053111 Ga0500572_004849 Ga0500572_004849_74_748 213
578 3300053119 Ga0500595_000253 Ga0500595_000253_29899_30579 213
579 3300053122 Ga0500608_018508 Ga0500608_018508_1945_2619 213
580 3300053148 Ga0500590_088033 Ga0500590_088033_643_1317 213
581 3300053150 Ga0500603_000158 Ga0500603_000158_13192_13866 213
582 3300053150 Ga0500603_008705 Ga0500603_008705_1318_1992 213
583 3300053159 Ga0500630_124419 Ga0500630_124419_79_753 213
584 3300053162 Ga0500638_017919 Ga0500638_017919_1519_2199 213
585 3300053177 Ga0500636_0041245 Ga0500636_0041245_567_1250 213
586 3300053177 Ga0500636_0088678 Ga0500636_0088678_979_1653 213
587 3300053178 Ga0500637_0000157 Ga0500637_0000157_18214_18894 213
588 3300053735 Ga0500596_001862 Ga0500596_001862_1738_2412 213
589 3300055283 Ga0500661_000942 Ga0500661_000942_3662_4342 213
590 iso_pu_bacteria 2889033259 2889035093 213
591 iso_pu_bacteria 8056681323 8056685160 213
592 3300049568 Ga0501031_0096761 Ga0501031_0096761_421_1200 214
593 3300049569 Ga0501032_0031733 Ga0501032_0031733_2162_2941 214
594 3300049569 Ga0501032_0215846 Ga0501032_0215846_341_1126 214
595 3300049570 Ga0501033_0068962 Ga0501033_0068962_395_1174 214
596 3300049571 Ga0501034_0454308 Ga0501034_0454308_167_946 214
597 3300049572 Ga0501036_0070794 Ga0501036_0070794_1330_2115 214
598 3300049573 Ga0501037_0192717 Ga0501037_0192717_94_873 214
599 3300049574 Ga0501038_0000621 Ga0501038_0000621_15167_15952 214
600 3300049574 Ga0501038_0086836 Ga0501038_0086836_1219_1998 214
601 3300049575 Ga0501039_0096527 Ga0501039_0096527_1273_2052 214
602 3300049576 Ga0501040_0043042 Ga0501040_0043042_1829_2608 214
603 3300049580 Ga0501046_0025427 Ga0501046_0025427_2809_3588 214
604 3300049582 Ga0501048_0036430 Ga0501048_0036430_2700_3479 214
605 3300049584 Ga0501068_0168483 Ga0501068_0168483_133_912 214
606 3300049586 Ga0501070_0247118 Ga0501070_0247118_411_1211 214
607 3300049588 Ga0501072_0177268 Ga0501072_0177268_864_1643 214
608 3300049589 Ga0501073_0098838 Ga0501073_0098838_421_1200 214
609 3300049590 Ga0501074_0017150 Ga0501074_0017150_3889_4668 214
610 3300049593 Ga0501077_0093609 Ga0501077_0093609_931_1710 214
611 3300049741 Ga0501079_0018245 Ga0501079_0018245_2533_3312 214
612 3300049742 Ga0501080_0524744 Ga0501080_0524744_206_991 214
613 3300049744 Ga0501083_0024395 Ga0501083_0024395_599_1378 214
614 3300049823 Ga0501044_0008922 Ga0501044_0008922_9199_9984 214
615 3300049823 Ga0501044_0494047 Ga0501044_0494047_94_873 214
616 3300049824 Ga0501045_0139799 Ga0501045_0139799_392_1171 214
617 3300039438 Ga0436360_1193161 Ga0436360_1193161_917_1633 216
618 3300025949 Ga0207667_10993550 Ga0207667_109935502 219
619 3300001990 JGI24737J22298_10037506 JGI24737J22298_100375062 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

70

216

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9391 7 243
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9384 5 226
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9366 5 226
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9343 5 243
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9279 4 223
ID Description Score Start End Superfamily
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.939 7 243 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.936 3 230 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9354 4 243 3.40.50.300
af_Q9VDR4_1380_1622_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9338 5 227 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9335 7 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N3CF17-F1-model_v4 ABC transporter ATP-binding protein 0.9476 1 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A4V2YIE4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9472 4 226 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A6P0JTR8-F1-model_v4 ABC transporter ATP-binding protein 0.946 5 226 GO:0005524
GO:0016887
AF-A0A844W1P5-F1-model_v4 deleted 0.9438 7 222
AF-A0A4Y3RI34-F1-model_v4 Daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein 0.943 3 226 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753

Feature Viewer

pLDDT pTM Quality
84.92 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map